content
stringlengths
1
1.04M
input_ids
listlengths
1
774k
ratio_char_token
float64
0.38
22.9
token_count
int64
1
774k
import os import logging from gamechangerml.api.fastapi.model_config import Config logger = logging.getLogger()
[ 11748, 28686, 198, 11748, 18931, 198, 6738, 983, 354, 2564, 4029, 13, 15042, 13, 7217, 15042, 13, 19849, 62, 11250, 1330, 17056, 198, 198, 6404, 1362, 796, 18931, 13, 1136, 11187, 1362, 3419, 628 ]
3.352941
34
# Licensed under a 3-clause BSD style license - see PYFITS.rst import warnings from ...extern import six from ...utils.compat.numpycompat import NUMPY_LT_1_10 from ...utils.exceptions import AstropyUserWarning if not six.PY2: # Stuff to do if Python 3 # Make the decode_ascii utility function actually work from . import util import numpy util.encode_ascii = encode_ascii util.decode_ascii = decode_ascii # Here we monkey patch (yes, I know) numpy to fix a few numpy Python 3 # bugs. The only behavior that's modified is that bugs are fixed, so that # should be OK. # Fix chararrays; this is necessary in numpy 1.9.x and below # The fix for this is in https://github.com/numpy/numpy/pull/5982 and is # available as of Numpy 1.10 if NUMPY_LT_1_10: _chararray = numpy.char.chararray for m in [numpy, numpy.char, numpy.core.defchararray, numpy.core.records]: m.chararray = chararray
[ 2, 49962, 739, 257, 513, 12, 565, 682, 347, 10305, 3918, 5964, 532, 766, 350, 56, 37, 29722, 13, 81, 301, 198, 198, 11748, 14601, 198, 6738, 2644, 1069, 759, 1330, 2237, 198, 6738, 2644, 26791, 13, 5589, 265, 13, 77, 32152, 5589, 265, 1330, 399, 20476, 56, 62, 27734, 62, 16, 62, 940, 198, 6738, 2644, 26791, 13, 1069, 11755, 1330, 8304, 28338, 12982, 20361, 198, 198, 361, 407, 2237, 13, 47, 56, 17, 25, 198, 220, 220, 220, 1303, 27864, 284, 466, 611, 11361, 513, 628, 220, 220, 220, 1303, 6889, 262, 36899, 62, 292, 979, 72, 10361, 2163, 1682, 670, 198, 220, 220, 220, 422, 764, 1330, 7736, 198, 220, 220, 220, 1330, 299, 32152, 198, 220, 220, 220, 7736, 13, 268, 8189, 62, 292, 979, 72, 796, 37773, 62, 292, 979, 72, 198, 220, 220, 220, 7736, 13, 12501, 1098, 62, 292, 979, 72, 796, 36899, 62, 292, 979, 72, 628, 220, 220, 220, 1303, 3423, 356, 21657, 8529, 357, 8505, 11, 314, 760, 8, 299, 32152, 284, 4259, 257, 1178, 299, 32152, 11361, 513, 198, 220, 220, 220, 1303, 11316, 13, 220, 383, 691, 4069, 326, 338, 9518, 318, 326, 11316, 389, 5969, 11, 523, 326, 198, 220, 220, 220, 1303, 815, 307, 7477, 13, 628, 220, 220, 220, 1303, 13268, 1149, 3258, 592, 26, 428, 318, 3306, 287, 299, 32152, 352, 13, 24, 13, 87, 290, 2174, 198, 220, 220, 220, 1303, 383, 4259, 329, 428, 318, 287, 3740, 1378, 12567, 13, 785, 14, 77, 32152, 14, 77, 32152, 14, 31216, 14, 3270, 6469, 290, 318, 198, 220, 220, 220, 1303, 1695, 355, 286, 399, 32152, 352, 13, 940, 628, 220, 220, 220, 611, 399, 20476, 56, 62, 27734, 62, 16, 62, 940, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4808, 10641, 18747, 796, 299, 32152, 13, 10641, 13, 10641, 18747, 628, 220, 220, 220, 220, 220, 220, 220, 329, 285, 287, 685, 77, 32152, 11, 299, 32152, 13, 10641, 11, 299, 32152, 13, 7295, 13, 4299, 10641, 18747, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 299, 32152, 13, 7295, 13, 8344, 3669, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 285, 13, 10641, 18747, 796, 1149, 18747, 198 ]
2.567708
384
# -*- coding: utf-8 -*- """ Script Name: GraphicPathItem.py Author: Do Trinh/Jimmy - 3D artist. Description: """ # ------------------------------------------------------------------------------------------------------------- """ Import """ from PySide2.QtWidgets import QGraphicsPathItem from pyPLM.models import DamgSignals from pyPLM.settings import AppSettings # ------------------------------------------------------------------------------------------------------------- # Created by panda on 3/12/2019 - 4:12 AM # © 2017 - 2018 DAMGteam. All rights reserved
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 37811, 198, 198, 7391, 6530, 25, 43029, 15235, 7449, 13, 9078, 198, 13838, 25, 2141, 33822, 71, 14, 40335, 532, 513, 35, 6802, 13, 198, 198, 11828, 25, 198, 198, 37811, 198, 2, 16529, 3880, 32501, 198, 37811, 17267, 37227, 198, 198, 6738, 9485, 24819, 17, 13, 48, 83, 54, 312, 11407, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1330, 1195, 18172, 15235, 7449, 198, 6738, 12972, 6489, 44, 13, 27530, 1330, 5245, 70, 11712, 874, 198, 6738, 12972, 6489, 44, 13, 33692, 1330, 2034, 26232, 628, 198, 198, 2, 16529, 3880, 32501, 198, 2, 15622, 416, 279, 5282, 319, 513, 14, 1065, 14, 23344, 532, 604, 25, 1065, 3001, 198, 2, 10673, 2177, 532, 2864, 29506, 38, 15097, 13, 1439, 2489, 10395 ]
3.913907
151
#!/usr/bin/env python3 # -*- coding: utf-8 -*- # @trojanzhex from pyrogram import filters from pyrogram import Client as trojanz from pyrogram.types import InlineKeyboardMarkup, InlineKeyboardButton from config import Config from script import Script @trojanz.on_message(filters.private & (filters.document | filters.video))
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 18, 201, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 201, 198, 2, 2488, 23528, 13881, 89, 33095, 201, 198, 201, 198, 201, 198, 6738, 12972, 39529, 1330, 16628, 201, 198, 6738, 12972, 39529, 1330, 20985, 355, 4161, 13881, 89, 201, 198, 6738, 12972, 39529, 13, 19199, 1330, 554, 1370, 9218, 3526, 9704, 929, 11, 554, 1370, 9218, 3526, 21864, 201, 198, 201, 198, 6738, 4566, 1330, 17056, 201, 198, 6738, 4226, 1330, 12327, 201, 198, 201, 198, 201, 198, 31, 23528, 13881, 89, 13, 261, 62, 20500, 7, 10379, 1010, 13, 19734, 1222, 357, 10379, 1010, 13, 22897, 930, 16628, 13, 15588, 4008, 201, 198 ]
2.866667
120
from paraview.simple import * # Load the distributed plugin. LoadDistributedPlugin("VTKmFilters" , remote=False, ns=globals()) assert VTKmContour
[ 6738, 1582, 615, 769, 13, 36439, 1330, 1635, 198, 198, 2, 8778, 262, 9387, 13877, 13, 198, 8912, 20344, 6169, 37233, 7203, 36392, 42, 76, 11928, 1010, 1, 837, 6569, 28, 25101, 11, 36545, 28, 4743, 672, 874, 28955, 198, 198, 30493, 32751, 42, 76, 4264, 454, 198 ]
3.083333
48
from __future__ import print_function import os import time import sys sys.path.append("..") import tensorflow as tf import keras.backend.tensorflow_backend as KTF gpu_frac = 0.7 def get_session(gpu_fraction=gpu_frac): '''Assume that you have 6GB of GPU memory and want to allocate ~2GB then gpu_frac=0.3 ''' num_threads = os.environ.get('OMP_NUM_THREADS') gpu_options = tf.GPUOptions(per_process_gpu_memory_fraction=gpu_fraction) if num_threads: return tf.Session(config=tf.ConfigProto( gpu_options=gpu_options, intra_op_parallelism_threads=num_threads)) else: return tf.Session(config=tf.ConfigProto(gpu_options=gpu_options)) ## attempt to limit the memory usage of TF KTF.set_session(get_session(gpu_fraction=gpu_frac)) import keras from keras.utils import plot_model from keras.callbacks import CSVLogger, ModelCheckpoint from keras.models import Sequential from keras.layers import Dense, Dropout, Flatten from keras.layers import Conv2D, MaxPooling2D from keras import backend as K import numpy as np import cv2 import matplotlib.pyplot as plt from utils import * from get_config import * from get_models import * from data_loader import * class ETATimer: ''' Simple class to store a timer for the ETA of one epoch/validation run ''' if __name__ == '__main__': train_with_multibatch()
[ 6738, 11593, 37443, 834, 1330, 3601, 62, 8818, 198, 198, 11748, 28686, 198, 11748, 640, 198, 198, 11748, 25064, 198, 17597, 13, 6978, 13, 33295, 7203, 492, 4943, 198, 198, 11748, 11192, 273, 11125, 355, 48700, 198, 11748, 41927, 292, 13, 1891, 437, 13, 83, 22854, 11125, 62, 1891, 437, 355, 509, 10234, 198, 198, 46999, 62, 31944, 796, 657, 13, 22, 198, 4299, 651, 62, 29891, 7, 46999, 62, 69, 7861, 28, 46999, 62, 31944, 2599, 198, 220, 220, 220, 705, 7061, 8021, 2454, 326, 345, 423, 718, 4579, 286, 11362, 4088, 290, 765, 284, 31935, 5299, 17, 4579, 788, 308, 19944, 62, 31944, 28, 15, 13, 18, 705, 7061, 198, 220, 220, 220, 997, 62, 16663, 82, 796, 28686, 13, 268, 2268, 13, 1136, 10786, 2662, 47, 62, 41359, 62, 4221, 15675, 50, 11537, 198, 220, 220, 220, 308, 19944, 62, 25811, 796, 48700, 13, 33346, 29046, 7, 525, 62, 14681, 62, 46999, 62, 31673, 62, 69, 7861, 28, 46999, 62, 69, 7861, 8, 628, 220, 220, 220, 611, 997, 62, 16663, 82, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 48700, 13, 36044, 7, 11250, 28, 27110, 13, 16934, 2964, 1462, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 308, 19944, 62, 25811, 28, 46999, 62, 25811, 11, 23422, 62, 404, 62, 1845, 29363, 1042, 62, 16663, 82, 28, 22510, 62, 16663, 82, 4008, 198, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 48700, 13, 36044, 7, 11250, 28, 27110, 13, 16934, 2964, 1462, 7, 46999, 62, 25811, 28, 46999, 62, 25811, 4008, 198, 198, 2235, 2230, 284, 4179, 262, 4088, 8748, 286, 24958, 198, 42, 10234, 13, 2617, 62, 29891, 7, 1136, 62, 29891, 7, 46999, 62, 69, 7861, 28, 46999, 62, 31944, 4008, 628, 198, 11748, 41927, 292, 198, 6738, 41927, 292, 13, 26791, 1330, 7110, 62, 19849, 198, 6738, 41927, 292, 13, 13345, 10146, 1330, 44189, 11187, 1362, 11, 9104, 9787, 4122, 198, 6738, 41927, 292, 13, 27530, 1330, 24604, 1843, 198, 6738, 41927, 292, 13, 75, 6962, 1330, 360, 1072, 11, 14258, 448, 11, 1610, 41769, 198, 6738, 41927, 292, 13, 75, 6962, 1330, 34872, 17, 35, 11, 5436, 27201, 278, 17, 35, 198, 6738, 41927, 292, 1330, 30203, 355, 509, 198, 198, 11748, 299, 32152, 355, 45941, 220, 198, 11748, 269, 85, 17, 198, 198, 11748, 2603, 29487, 8019, 13, 9078, 29487, 355, 458, 83, 198, 198, 6738, 3384, 4487, 1330, 1635, 198, 198, 6738, 651, 62, 11250, 1330, 1635, 198, 6738, 651, 62, 27530, 1330, 1635, 198, 6738, 1366, 62, 29356, 1330, 1635, 628, 198, 4871, 12152, 1404, 22723, 25, 198, 220, 220, 220, 705, 7061, 17427, 1398, 284, 3650, 257, 19781, 329, 262, 412, 5603, 286, 530, 36835, 14, 12102, 341, 1057, 705, 7061, 628, 628, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 4512, 62, 4480, 62, 16680, 571, 963, 3419, 628, 198 ]
2.769231
494
#!/usr/bin/env python import argparse import subprocess import sqlite3 as sql from LLC_Membranes.llclib import topology, file_rw from LLC_Membranes.analysis import solute_partitioning from LLC_Membranes.setup import lc_class, equil, solvate_tails import mdtraj as md import numpy as np import os if __name__ == "__main__": os.environ["GMX_MAXBACKUP"] = "-1" # stop GROMACS from making backups args = initialize().parse_args() sys = System(args.build_monomer, args.weight_percent, args.ratio, solute='HOH', nopores=args.nopores, ncolumns=args.ncolumns, monomers_per_column=args.monomers_per_column, p2p=args.p2p, parallel_displaced=args.parallel_displaced, dbwl=args.dbwl, random_seed=args.random_seed, mpi=args.mpi, nproc=args.nproc, tolerance=args.tolerance) while not sys.converged: sys.query_database(database='water_content.db', guess_range=args.guess_range, guess_stride=args.guess_stride) sys.equilibrate(input_files=True, length=args.length_nvt, force=args.forces[0], restraint_residue=args.restraint_residue, restraint_axis=args.restraint_axis, ring_restraints=args.ring_restraints) sys.calculate_pore_water(args.forces[0]) sys.write_final_pore_configuration() sys.place_water_tails(args.output) sys.full_equilibration(args.forces, fully_solvated=args.output, l_berendsen=args.length_berendsen, l_nvt=args.length_nvt, l_pr=args.length_Parrinello_Rahman, restraint_axis=args.restraint_axis, restraint_residue=args.restraint_residue, ring_restraints=args.ring_restraints)
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 198, 11748, 1822, 29572, 198, 11748, 850, 14681, 198, 11748, 44161, 578, 18, 355, 44161, 198, 6738, 11419, 62, 13579, 1671, 7305, 13, 297, 565, 571, 1330, 1353, 1435, 11, 2393, 62, 31653, 198, 6738, 11419, 62, 13579, 1671, 7305, 13, 20930, 1330, 1540, 1133, 62, 3911, 653, 278, 198, 6738, 11419, 62, 13579, 1671, 7305, 13, 40406, 1330, 300, 66, 62, 4871, 11, 1602, 346, 11, 1540, 85, 378, 62, 26404, 198, 11748, 45243, 9535, 73, 355, 45243, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 28686, 628, 628, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 628, 220, 220, 220, 28686, 13, 268, 2268, 14692, 15548, 55, 62, 22921, 31098, 8577, 8973, 796, 27444, 16, 1, 220, 1303, 2245, 10863, 2662, 2246, 50, 422, 1642, 35872, 628, 220, 220, 220, 26498, 796, 41216, 22446, 29572, 62, 22046, 3419, 628, 220, 220, 220, 25064, 796, 4482, 7, 22046, 13, 11249, 62, 2144, 12057, 11, 26498, 13, 6551, 62, 25067, 11, 26498, 13, 10366, 952, 11, 1540, 1133, 11639, 39, 12096, 3256, 299, 404, 2850, 28, 22046, 13, 77, 404, 2850, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 299, 28665, 82, 28, 22046, 13, 77, 28665, 82, 11, 937, 21499, 62, 525, 62, 28665, 28, 22046, 13, 2144, 21499, 62, 525, 62, 28665, 11, 279, 17, 79, 28, 22046, 13, 79, 17, 79, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10730, 62, 6381, 21820, 28, 22046, 13, 1845, 29363, 62, 6381, 21820, 11, 20613, 40989, 28, 22046, 13, 9945, 40989, 11, 4738, 62, 28826, 28, 22046, 13, 25120, 62, 28826, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 285, 14415, 28, 22046, 13, 3149, 72, 11, 299, 36942, 28, 22046, 13, 77, 36942, 11, 15621, 28, 22046, 13, 83, 37668, 8, 628, 220, 220, 220, 981, 407, 25064, 13, 1102, 332, 2004, 25, 198, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 22766, 62, 48806, 7, 48806, 11639, 7050, 62, 11299, 13, 9945, 3256, 4724, 62, 9521, 28, 22046, 13, 5162, 408, 62, 9521, 11, 4724, 62, 2536, 485, 28, 22046, 13, 5162, 408, 62, 2536, 485, 8, 198, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 4853, 346, 2889, 378, 7, 15414, 62, 16624, 28, 17821, 11, 4129, 28, 22046, 13, 13664, 62, 77, 36540, 11, 2700, 28, 22046, 13, 27087, 58, 15, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 24596, 62, 411, 312, 518, 28, 22046, 13, 2118, 16947, 62, 411, 312, 518, 11, 24596, 62, 22704, 28, 22046, 13, 2118, 16947, 62, 22704, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5858, 62, 2118, 15517, 28, 22046, 13, 1806, 62, 2118, 15517, 8, 198, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 9948, 3129, 378, 62, 79, 382, 62, 7050, 7, 22046, 13, 27087, 58, 15, 12962, 628, 220, 220, 220, 25064, 13, 13564, 62, 20311, 62, 79, 382, 62, 11250, 3924, 3419, 198, 220, 220, 220, 25064, 13, 5372, 62, 7050, 62, 26404, 7, 22046, 13, 22915, 8, 198, 220, 220, 220, 25064, 13, 12853, 62, 4853, 22282, 1358, 7, 22046, 13, 27087, 11, 3938, 62, 34453, 85, 515, 28, 22046, 13, 22915, 11, 300, 62, 65, 567, 358, 6248, 28, 22046, 13, 13664, 62, 65, 567, 358, 6248, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 300, 62, 77, 36540, 28, 22046, 13, 13664, 62, 77, 36540, 11, 300, 62, 1050, 28, 22046, 13, 13664, 62, 47, 3258, 500, 18798, 62, 47135, 805, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 24596, 62, 22704, 28, 22046, 13, 2118, 16947, 62, 22704, 11, 24596, 62, 411, 312, 518, 28, 22046, 13, 2118, 16947, 62, 411, 312, 518, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5858, 62, 2118, 15517, 28, 22046, 13, 1806, 62, 2118, 15517, 8, 198 ]
2.252618
764
from anarcho import app from flask import jsonify from flask_swagger import swagger @app.route('/swagger/spec.json', methods=['GET']) def spec(): """ Returns the swagger spec. Read more by this link https://github.com/swagger-api/swagger-spec/blob/master/versions/2.0.md :return: """ swag = swagger(app) swag['info']['title'] = app.name swag['consumes'] = ['application/json'] swag['produces'] = ['application/json'] return jsonify(swag)
[ 6738, 14061, 78, 1330, 598, 198, 6738, 42903, 1330, 33918, 1958, 198, 6738, 42903, 62, 2032, 7928, 1330, 1509, 7928, 628, 198, 31, 1324, 13, 38629, 10786, 14, 2032, 7928, 14, 16684, 13, 17752, 3256, 5050, 28, 17816, 18851, 6, 12962, 198, 4299, 1020, 33529, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 16409, 262, 1509, 7928, 1020, 13, 198, 220, 220, 220, 4149, 517, 416, 428, 2792, 3740, 1378, 12567, 13, 785, 14, 2032, 7928, 12, 15042, 14, 2032, 7928, 12, 16684, 14, 2436, 672, 14, 9866, 14, 47178, 14, 17, 13, 15, 13, 9132, 198, 220, 220, 220, 1058, 7783, 25, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 1509, 363, 796, 1509, 7928, 7, 1324, 8, 198, 220, 220, 220, 1509, 363, 17816, 10951, 6, 7131, 6, 7839, 20520, 796, 598, 13, 3672, 198, 220, 220, 220, 1509, 363, 17816, 5936, 8139, 20520, 796, 37250, 31438, 14, 17752, 20520, 198, 220, 220, 220, 1509, 363, 17816, 18230, 728, 20520, 796, 37250, 31438, 14, 17752, 20520, 198, 220, 220, 220, 1441, 33918, 1958, 7, 2032, 363, 8, 198 ]
2.637363
182
#!/usr/bin/env python # -*- coding: utf-8 -*- ''' Copyright 2020, Yutong Xie, UIUC. Using Two Pointers to find the interval intersection. '''
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 7061, 6, 198, 220, 220, 220, 15069, 12131, 11, 575, 315, 506, 48989, 11, 12454, 9598, 13, 198, 220, 220, 220, 8554, 4930, 7695, 20193, 284, 1064, 262, 16654, 16246, 13, 198, 705, 7061, 628 ]
2.62069
58
import asyncio import json import os import sys import multiprocessing import webbrowser import requests import requests.cookies import logging as log import subprocess import time from galaxy.api.consts import LocalGameState, Platform from galaxy.api.plugin import Plugin, create_and_run_plugin from galaxy.api.types import Achievement, Game, LicenseInfo, LocalGame from galaxy.api.errors import ( AuthenticationRequired, BackendTimeout, BackendNotAvailable, BackendError, NetworkError, UnknownError, InvalidCredentials ) from version import __version__ as version from process import ProcessProvider from local_client_base import ClientNotInstalledError from local_client import LocalClient from backend import BackendClient, AccessTokenExpired from definitions import Blizzard, DataclassJSONEncoder, License_Map, ClassicGame from consts import SYSTEM from consts import Platform as pf from http_client import AuthenticatedHttpClient # async def get_unlocked_achievements(self, game_id): # if not self.website_client.is_authenticated(): # raise AuthenticationRequired() # try: # if game_id == "21298": # return await self._get_sc2_achievements() # elif game_id == "5730135": # return await self._get_wow_achievements() # else: # return [] # except requests.Timeout: # raise BackendTimeout() # except requests.ConnectionError: # raise NetworkError() # except Exception as e: # log.exception(str(e)) # return [] if __name__ == "__main__": main()
[ 11748, 30351, 952, 198, 11748, 33918, 198, 11748, 28686, 198, 11748, 25064, 198, 11748, 18540, 305, 919, 278, 198, 11748, 3992, 40259, 198, 11748, 7007, 198, 11748, 7007, 13, 27916, 444, 198, 11748, 18931, 355, 2604, 198, 11748, 850, 14681, 198, 11748, 640, 628, 198, 6738, 16161, 13, 15042, 13, 1102, 6448, 1330, 10714, 8777, 9012, 11, 19193, 198, 6738, 16161, 13, 15042, 13, 33803, 1330, 42636, 11, 2251, 62, 392, 62, 5143, 62, 33803, 198, 6738, 16161, 13, 15042, 13, 19199, 1330, 45511, 11, 3776, 11, 13789, 12360, 11, 10714, 8777, 198, 6738, 16161, 13, 15042, 13, 48277, 1330, 357, 48191, 37374, 11, 198, 220, 220, 220, 5157, 437, 48031, 11, 5157, 437, 3673, 10493, 11, 5157, 437, 12331, 11, 7311, 12331, 11, 16185, 12331, 11, 17665, 34, 445, 14817, 198, 8, 198, 198, 6738, 2196, 1330, 11593, 9641, 834, 355, 2196, 198, 6738, 1429, 1330, 10854, 29495, 198, 6738, 1957, 62, 16366, 62, 8692, 1330, 20985, 3673, 6310, 4262, 12331, 198, 6738, 1957, 62, 16366, 1330, 10714, 11792, 198, 6738, 30203, 1330, 5157, 437, 11792, 11, 8798, 30642, 3109, 6474, 198, 6738, 17336, 1330, 20206, 11, 16092, 330, 31172, 40386, 27195, 12342, 11, 13789, 62, 13912, 11, 13449, 8777, 198, 6738, 1500, 82, 1330, 36230, 198, 6738, 1500, 82, 1330, 19193, 355, 279, 69, 198, 6738, 2638, 62, 16366, 1330, 31885, 3474, 43481, 11792, 628, 198, 220, 220, 220, 1303, 30351, 825, 651, 62, 403, 24162, 62, 620, 12311, 902, 7, 944, 11, 983, 62, 312, 2599, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 611, 407, 2116, 13, 732, 12485, 62, 16366, 13, 271, 62, 41299, 3474, 33529, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 48191, 37374, 3419, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 611, 983, 62, 312, 6624, 366, 21777, 4089, 1298, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 25507, 2116, 13557, 1136, 62, 1416, 17, 62, 620, 12311, 902, 3419, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 983, 62, 312, 6624, 366, 3553, 18938, 2327, 1298, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 25507, 2116, 13557, 1136, 62, 42773, 62, 620, 12311, 902, 3419, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 17635, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 2845, 7007, 13, 48031, 25, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 5157, 437, 48031, 3419, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 2845, 7007, 13, 32048, 12331, 25, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 7311, 12331, 3419, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 2845, 35528, 355, 304, 25, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 2604, 13, 1069, 4516, 7, 2536, 7, 68, 4008, 198, 220, 220, 220, 1303, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 17635, 628, 198, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 198, 220, 220, 220, 1388, 3419, 198 ]
2.874564
574
# Copyright (C) 2017 Beijing Didi Infinity Technology and Development Co.,Ltd. # All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # ============================================================================== ''' synthesis filter bank Op unit-test ''' import os from pathlib import Path import tensorflow as tf from absl import logging from delta.layers.ops import py_x_ops from delta.data import feat as feat_lib class SfbOpTest(tf.test.TestCase): ''' synthesis filter bank op unittest''' def setUp(self): '''set up''' self.wavpath = str( Path(os.environ['MAIN_ROOT']).joinpath( 'delta/layers/ops/data/sm1_cln.wav')) def tearDown(self): '''tear down''' def test_sfb(self): ''' test sfb op''' with self.session(): sample_rate, input_data = feat_lib.load_wav(self.wavpath, sr=16000) power_spc, phase_spc = py_x_ops.analyfiltbank(input_data, sample_rate) logging.info('power_spc: {}'.format(power_spc.eval().shape)) logging.info('phase_spc: {}'.format(phase_spc.eval().shape)) output = py_x_ops.synthfiltbank(power_spc.eval(), phase_spc.eval(), sample_rate) self.assertEqual(tf.rank(output).eval(), 1) # beginning 400 samples are different, due to the overlap and add self.assertAllClose( output.eval().flatten()[500:550], input_data[500:550], rtol=1e-4, atol=1e-4) if __name__ == '__main__': logging.set_verbosity(logging.INFO) tf.test.main()
[ 2, 15069, 357, 34, 8, 2177, 11618, 7731, 72, 22385, 8987, 290, 7712, 1766, 1539, 43, 8671, 13, 198, 2, 1439, 2489, 10395, 13, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 345, 743, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789, 13, 198, 2, 921, 743, 7330, 257, 4866, 286, 262, 13789, 379, 198, 2, 198, 2, 220, 220, 220, 220, 2638, 1378, 2503, 13, 43073, 13, 2398, 14, 677, 4541, 14, 43, 2149, 24290, 12, 17, 13, 15, 198, 2, 198, 2, 17486, 2672, 416, 9723, 1099, 393, 4987, 284, 287, 3597, 11, 3788, 198, 2, 9387, 739, 262, 13789, 318, 9387, 319, 281, 366, 1921, 3180, 1, 29809, 1797, 11, 198, 2, 42881, 34764, 11015, 6375, 7102, 49828, 11053, 3963, 15529, 509, 12115, 11, 2035, 4911, 393, 17142, 13, 198, 2, 4091, 262, 13789, 329, 262, 2176, 3303, 15030, 21627, 290, 198, 2, 11247, 739, 262, 13789, 13, 198, 2, 38093, 25609, 28, 198, 7061, 6, 21263, 8106, 3331, 8670, 4326, 12, 9288, 705, 7061, 198, 198, 11748, 28686, 198, 6738, 3108, 8019, 1330, 10644, 198, 198, 11748, 11192, 273, 11125, 355, 48700, 198, 6738, 2352, 75, 1330, 18931, 198, 198, 6738, 25979, 13, 75, 6962, 13, 2840, 1330, 12972, 62, 87, 62, 2840, 198, 6738, 25979, 13, 7890, 1330, 2218, 355, 2218, 62, 8019, 628, 198, 4871, 311, 21855, 18257, 14402, 7, 27110, 13, 9288, 13, 14402, 20448, 2599, 198, 220, 705, 7061, 21263, 8106, 3331, 1034, 555, 715, 395, 7061, 6, 628, 220, 825, 900, 4933, 7, 944, 2599, 198, 220, 220, 220, 705, 7061, 2617, 510, 7061, 6, 198, 220, 220, 220, 2116, 13, 45137, 6978, 796, 965, 7, 198, 220, 220, 220, 220, 220, 220, 220, 10644, 7, 418, 13, 268, 2268, 17816, 5673, 1268, 62, 13252, 2394, 20520, 737, 22179, 6978, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 67, 12514, 14, 75, 6962, 14, 2840, 14, 7890, 14, 5796, 16, 62, 565, 77, 13, 45137, 6, 4008, 628, 220, 825, 11626, 8048, 7, 944, 2599, 198, 220, 220, 220, 705, 7061, 83, 451, 866, 7061, 6, 628, 220, 825, 1332, 62, 82, 21855, 7, 944, 2599, 198, 220, 220, 220, 705, 7061, 1332, 264, 21855, 1034, 7061, 6, 198, 220, 220, 220, 351, 2116, 13, 29891, 33529, 198, 220, 220, 220, 220, 220, 6291, 62, 4873, 11, 5128, 62, 7890, 796, 2218, 62, 8019, 13, 2220, 62, 45137, 7, 944, 13, 45137, 6978, 11, 19677, 28, 1433, 830, 8, 628, 220, 220, 220, 220, 220, 1176, 62, 2777, 66, 11, 7108, 62, 2777, 66, 796, 12972, 62, 87, 62, 2840, 13, 38200, 69, 2326, 17796, 7, 15414, 62, 7890, 11, 6291, 62, 4873, 8, 628, 220, 220, 220, 220, 220, 18931, 13, 10951, 10786, 6477, 62, 2777, 66, 25, 23884, 4458, 18982, 7, 6477, 62, 2777, 66, 13, 18206, 22446, 43358, 4008, 198, 220, 220, 220, 220, 220, 18931, 13, 10951, 10786, 40715, 62, 2777, 66, 25, 23884, 4458, 18982, 7, 40715, 62, 2777, 66, 13, 18206, 22446, 43358, 4008, 628, 220, 220, 220, 220, 220, 5072, 796, 12972, 62, 87, 62, 2840, 13, 28869, 400, 69, 2326, 17796, 7, 6477, 62, 2777, 66, 13, 18206, 22784, 7108, 62, 2777, 66, 13, 18206, 22784, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6291, 62, 4873, 8, 628, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 27110, 13, 43027, 7, 22915, 737, 18206, 22784, 352, 8, 628, 220, 220, 220, 220, 220, 1303, 3726, 7337, 8405, 389, 1180, 11, 2233, 284, 262, 21721, 290, 751, 198, 220, 220, 220, 220, 220, 2116, 13, 30493, 3237, 26125, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5072, 13, 18206, 22446, 2704, 41769, 3419, 58, 4059, 25, 22730, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5128, 62, 7890, 58, 4059, 25, 22730, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 374, 83, 349, 28, 16, 68, 12, 19, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 379, 349, 28, 16, 68, 12, 19, 8, 628, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 18931, 13, 2617, 62, 19011, 16579, 7, 6404, 2667, 13, 10778, 8, 198, 220, 48700, 13, 9288, 13, 12417, 3419, 198 ]
2.700394
761
from django.urls import path from rest_framework.authtoken import views as drf_views from . import views from . import api_views urlpatterns = [ path('users/', api_views.UserList.as_view()), path('users/<int:id>/', api_views.UserRetrieveUpdate.as_view()), ]
[ 6738, 42625, 14208, 13, 6371, 82, 1330, 3108, 198, 6738, 1334, 62, 30604, 13, 18439, 30001, 1330, 5009, 355, 1553, 69, 62, 33571, 198, 6738, 764, 1330, 5009, 198, 6738, 764, 1330, 40391, 62, 33571, 198, 198, 6371, 33279, 82, 796, 685, 198, 220, 220, 220, 3108, 10786, 18417, 14, 3256, 40391, 62, 33571, 13, 12982, 8053, 13, 292, 62, 1177, 3419, 828, 198, 220, 220, 220, 3108, 10786, 18417, 14, 27, 600, 25, 312, 29, 14, 3256, 40391, 62, 33571, 13, 12982, 9781, 30227, 10260, 13, 292, 62, 1177, 3419, 828, 198, 60, 198 ]
2.810526
95
import numpy as np import pandas as pd class Cake: """example""" x=2 class Datacleaner: """"class for cleaning our data""" def replace_values(self, value=np.nan, new=0): """replace values in a dataframe""" self.df = self.df.replace(value, new)
[ 11748, 299, 32152, 355, 45941, 198, 11748, 19798, 292, 355, 279, 67, 198, 198, 4871, 30799, 25, 220, 198, 220, 220, 220, 37227, 20688, 37811, 198, 220, 220, 220, 2124, 28, 17, 198, 198, 4871, 16092, 6008, 272, 263, 25, 220, 198, 220, 220, 220, 13538, 15931, 4871, 329, 12724, 674, 1366, 37811, 198, 220, 220, 220, 825, 6330, 62, 27160, 7, 944, 11, 1988, 28, 37659, 13, 12647, 11, 649, 28, 15, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 33491, 3815, 287, 257, 1366, 14535, 37811, 220, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 7568, 796, 2116, 13, 7568, 13, 33491, 7, 8367, 11, 649, 8, 628, 198 ]
2.46087
115
# -*- coding: utf-8 -*- import unittest from unittest import mock from pastepwn.analyzers.googleapikeyanalyzer import GoogleApiKeyAnalyzer if __name__ == '__main__': unittest.main()
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 11748, 555, 715, 395, 198, 6738, 555, 715, 395, 1330, 15290, 198, 198, 6738, 1613, 538, 675, 13, 38200, 47031, 13, 13297, 499, 522, 4121, 3400, 9107, 1330, 3012, 32, 14415, 9218, 37702, 9107, 628, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 555, 715, 395, 13, 12417, 3419, 198 ]
2.661972
71
from django.contrib import admin from .models import Entry, Topic admin.site.register(Topic) admin.site.register(Entry)
[ 6738, 42625, 14208, 13, 3642, 822, 1330, 13169, 198, 198, 6738, 764, 27530, 1330, 21617, 11, 47373, 198, 198, 28482, 13, 15654, 13, 30238, 7, 33221, 8, 198, 28482, 13, 15654, 13, 30238, 7, 30150, 8, 198 ]
3.297297
37
# uploads.py - Discourse only sends the real addresses of some embedded # images in the 'cooked' HTML. This module helps to extract them from # there and turn them into real links in the Markdown. import html.parser import io import commonmark import commonmark_extensions.plaintext
[ 2, 9516, 82, 13, 9078, 532, 8444, 9047, 691, 12800, 262, 1103, 9405, 286, 617, 14553, 198, 2, 4263, 287, 262, 705, 46591, 6, 11532, 13, 220, 770, 8265, 5419, 284, 7925, 606, 422, 198, 2, 612, 290, 1210, 606, 656, 1103, 6117, 287, 262, 2940, 2902, 13, 198, 198, 11748, 27711, 13, 48610, 198, 11748, 33245, 198, 198, 11748, 2219, 4102, 198, 11748, 2219, 4102, 62, 2302, 5736, 13, 25638, 5239, 628 ]
3.931507
73
#!/bin/env python import profile from pstats import Stats from Main import main s = profile.run('main()', 'pksampler.profile') Stats('pksampler.profile').sort_stats('calls').print_stats()
[ 2, 48443, 8800, 14, 24330, 21015, 198, 198, 11748, 7034, 198, 6738, 279, 34242, 1330, 20595, 198, 6738, 8774, 1330, 1388, 198, 198, 82, 796, 7034, 13, 5143, 10786, 12417, 3419, 3256, 705, 79, 591, 321, 20053, 13, 13317, 11537, 198, 29668, 10786, 79, 591, 321, 20053, 13, 13317, 27691, 30619, 62, 34242, 10786, 66, 5691, 27691, 4798, 62, 34242, 3419, 198 ]
3.064516
62
from piece import piece
[ 6738, 3704, 1330, 3704, 628 ]
5
5
#!/usr/bin/env python3 from nlptools.text.tokenizer import Tokenizer_BERT from nlptools.utils import zload import sys s = Tokenizer_BERT(bert_model_name='/home/pzhu/.pytorch_pretrained_bert/bert-base-uncased') txt = 'Who was Jim Henson ? Jim Henson was a puppeteer' print(s.seg(txt)) print(s.vocab)
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 18, 198, 6738, 299, 75, 457, 10141, 13, 5239, 13, 30001, 7509, 1330, 29130, 7509, 62, 13246, 51, 198, 6738, 299, 75, 457, 10141, 13, 26791, 1330, 1976, 2220, 198, 11748, 25064, 198, 198, 82, 796, 29130, 7509, 62, 13246, 51, 7, 4835, 62, 19849, 62, 3672, 11639, 14, 11195, 14, 79, 89, 13415, 11757, 9078, 13165, 354, 62, 5310, 13363, 62, 4835, 14, 4835, 12, 8692, 12, 19524, 839, 11537, 198, 198, 14116, 796, 705, 8241, 373, 5395, 367, 19069, 5633, 5395, 367, 19069, 373, 257, 13595, 14471, 263, 6, 198, 198, 4798, 7, 82, 13, 325, 70, 7, 14116, 4008, 198, 198, 4798, 7, 82, 13, 18893, 397, 8, 198 ]
2.525
120
from __future__ import unicode_literals, print_function, division import requests from datetime import datetime from bs4 import BeautifulSoup import re
[ 6738, 11593, 37443, 834, 1330, 28000, 1098, 62, 17201, 874, 11, 3601, 62, 8818, 11, 7297, 198, 11748, 7007, 198, 6738, 4818, 8079, 1330, 4818, 8079, 198, 6738, 275, 82, 19, 1330, 23762, 50, 10486, 198, 11748, 302, 628 ]
3.923077
39
# -*- coding: utf-8 -*- """ Stack Floating Buttons ====================== Copyright © 2010-2018 HeaTTheatR For suggestions and questions: <[email protected]> This file is distributed under the terms of the same license, as the Kivy framework. Example ------- from kivy.app import App from kivy.lang import Builder from kivy.factory import Factory from kivymd.toast import toast from kivymd.theming import ThemeManager from kivymd.stackfloatingbuttons import MDStackFloatingButtons Builder.load_string(''' #:import Toolbar kivymd.toolbar.Toolbar <ExampleFloatingButtons@BoxLayout> orientation: 'vertical' Toolbar: title: 'Stack Floating Buttons' md_bg_color: app.theme_cls.primary_color elevation: 10 left_action_items: [['menu', lambda x: None]] ''') class Example(App): theme_cls = ThemeManager() theme_cls.primary_palette = 'Teal' title = "Example Stack Floating Buttons" create_stack_floating_buttons = False floating_data = { 'Python': 'language-python', 'Php': 'language-php', 'C++': 'language-cpp'} def set_my_language(self, instance_button): toast(instance_button.icon) def build(self): screen = Factory.ExampleFloatingButtons() # Use this condition otherwise the stack will be created each time. if not self.create_stack_floating_buttons: screen.add_widget(MDStackFloatingButtons( icon='lead-pencil', floating_data={ 'Python': 'language-python', 'Php': 'language-php', 'C++': 'language-cpp'}, callback=self.set_my_language)) self.create_stack_floating_buttons = True return screen Example().run() """ from kivy.animation import Animation from kivy.core.window import Window from kivy.uix.floatlayout import FloatLayout from kivy.lang import Builder from kivy.properties import StringProperty, DictProperty, ObjectProperty from kivy.metrics import dp from kivymd.cards import MDCard Builder.load_string(''' #:import Window kivy.core.window.Window #:import MDFloatingActionButton kivymd.button.MDFloatingActionButton <FloatingButton@MDFloatingActionButton> x: Window.width - (self.width + dp(21)) y: dp(25) size_hint: None, None size: dp(46), dp(46) elevation: 5 md_bg_color: app.theme_cls.primary_color on_release: self.parent.callback(self) <MDFloatingLabel> size_hint: None, None height: dp(20) width: label.texture_size[0] border_color_a: .5 md_bg_color: app.theme_cls.primary_color x: -self.width Label: id: label color: 0, 0, 0, 1 bold: True markup: True text: ' %s ' % root.text <MDStackFloatingButtons> FloatingButton: id: f_btn_1 icon: list(root.floating_data.values())[0] FloatingButton: id: f_btn_2 icon: list(root.floating_data.values())[1] FloatingButton: id: f_btn_3 icon: list(root.floating_data.values())[2] MDFloatingLabel: id: f_lbl_1 text: list(root.floating_data.keys())[0] y: dp(117) MDFloatingLabel: id: f_lbl_2 text: list(root.floating_data.keys())[1] y: dp(170) MDFloatingLabel: id: f_lbl_3 text: list(root.floating_data.keys())[2] y: dp(226) MDFloatingActionButton: icon: root.icon size: dp(56), dp(56) x: Window.width - (self.width + dp(15)) md_bg_color: app.theme_cls.primary_color y: dp(15) on_release: root.show_floating_buttons() ''')
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 198, 37811, 198, 25896, 49768, 887, 27288, 198, 4770, 50155, 198, 198, 15269, 10673, 3050, 12, 7908, 679, 64, 51, 464, 265, 49, 198, 198, 1890, 11776, 290, 2683, 25, 198, 27, 74, 452, 88, 31267, 31, 14816, 13, 785, 29, 198, 198, 1212, 2393, 318, 9387, 739, 262, 2846, 286, 262, 976, 5964, 11, 198, 292, 262, 509, 452, 88, 9355, 13, 198, 198, 16281, 198, 26866, 198, 198, 6738, 479, 452, 88, 13, 1324, 1330, 2034, 198, 6738, 479, 452, 88, 13, 17204, 1330, 35869, 198, 6738, 479, 452, 88, 13, 69, 9548, 1330, 19239, 198, 198, 6738, 479, 452, 4948, 67, 13, 1462, 459, 1330, 27805, 198, 6738, 479, 452, 4948, 67, 13, 1169, 2229, 1330, 26729, 13511, 198, 6738, 479, 452, 4948, 67, 13, 25558, 48679, 803, 4360, 27288, 1330, 10670, 25896, 33574, 803, 1537, 27288, 628, 198, 32875, 13, 2220, 62, 8841, 7, 7061, 6, 198, 2, 25, 11748, 16984, 5657, 479, 452, 4948, 67, 13, 25981, 5657, 13, 25391, 5657, 628, 198, 27, 16281, 33574, 803, 1537, 27288, 31, 14253, 32517, 29, 198, 220, 220, 220, 12852, 25, 705, 1851, 605, 6, 628, 220, 220, 220, 16984, 5657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 3670, 25, 705, 25896, 49768, 887, 27288, 6, 198, 220, 220, 220, 220, 220, 220, 220, 45243, 62, 35904, 62, 8043, 25, 598, 13, 43810, 62, 565, 82, 13, 39754, 62, 8043, 198, 220, 220, 220, 220, 220, 220, 220, 22910, 25, 838, 198, 220, 220, 220, 220, 220, 220, 220, 1364, 62, 2673, 62, 23814, 25, 16410, 6, 26272, 3256, 37456, 2124, 25, 6045, 11907, 198, 198, 7061, 11537, 628, 198, 4871, 17934, 7, 4677, 2599, 198, 220, 220, 220, 7505, 62, 565, 82, 796, 26729, 13511, 3419, 198, 220, 220, 220, 7505, 62, 565, 82, 13, 39754, 62, 18596, 5857, 796, 705, 51, 2287, 6, 198, 220, 220, 220, 3670, 796, 366, 16281, 23881, 49768, 887, 27288, 1, 198, 220, 220, 220, 2251, 62, 25558, 62, 48679, 803, 62, 4360, 27288, 796, 10352, 198, 220, 220, 220, 12462, 62, 7890, 796, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 705, 37906, 10354, 705, 16129, 12, 29412, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 2725, 79, 10354, 705, 16129, 12, 10121, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 34, 4880, 10354, 705, 16129, 12, 20322, 6, 92, 628, 220, 220, 220, 825, 900, 62, 1820, 62, 16129, 7, 944, 11, 4554, 62, 16539, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 27805, 7, 39098, 62, 16539, 13, 4749, 8, 628, 220, 220, 220, 825, 1382, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 3159, 796, 19239, 13, 16281, 33574, 803, 1537, 27288, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 5765, 428, 4006, 4306, 262, 8931, 481, 307, 2727, 1123, 640, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 2116, 13, 17953, 62, 25558, 62, 48679, 803, 62, 4360, 27288, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3159, 13, 2860, 62, 42655, 7, 12740, 25896, 33574, 803, 1537, 27288, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7196, 11639, 28230, 12, 3617, 2856, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 12462, 62, 7890, 34758, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 37906, 10354, 705, 16129, 12, 29412, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 2725, 79, 10354, 705, 16129, 12, 10121, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 34, 4880, 10354, 705, 16129, 12, 20322, 6, 5512, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 23838, 28, 944, 13, 2617, 62, 1820, 62, 16129, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 17953, 62, 25558, 62, 48679, 803, 62, 4360, 27288, 796, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 3159, 628, 198, 16281, 22446, 5143, 3419, 198, 37811, 198, 198, 6738, 479, 452, 88, 13, 11227, 341, 1330, 23535, 198, 6738, 479, 452, 88, 13, 7295, 13, 17497, 1330, 26580, 198, 6738, 479, 452, 88, 13, 84, 844, 13, 22468, 39786, 1330, 48436, 32517, 198, 6738, 479, 452, 88, 13, 17204, 1330, 35869, 198, 6738, 479, 452, 88, 13, 48310, 1330, 10903, 21746, 11, 360, 713, 21746, 11, 9515, 21746, 198, 6738, 479, 452, 88, 13, 4164, 10466, 1330, 288, 79, 198, 198, 6738, 479, 452, 4948, 67, 13, 27761, 1330, 337, 9697, 446, 628, 198, 32875, 13, 2220, 62, 8841, 7, 7061, 6, 198, 2, 25, 11748, 26580, 479, 452, 88, 13, 7295, 13, 17497, 13, 27703, 198, 2, 25, 11748, 337, 8068, 5439, 803, 12502, 21864, 479, 452, 4948, 67, 13, 16539, 13, 44, 8068, 5439, 803, 12502, 21864, 628, 198, 27, 33574, 803, 21864, 31, 44, 8068, 5439, 803, 12502, 21864, 29, 198, 220, 220, 220, 2124, 25, 26580, 13, 10394, 532, 357, 944, 13, 10394, 1343, 288, 79, 7, 2481, 4008, 198, 220, 220, 220, 331, 25, 288, 79, 7, 1495, 8, 198, 220, 220, 220, 2546, 62, 71, 600, 25, 6045, 11, 6045, 198, 220, 220, 220, 2546, 25, 288, 79, 7, 3510, 828, 288, 79, 7, 3510, 8, 198, 220, 220, 220, 22910, 25, 642, 198, 220, 220, 220, 45243, 62, 35904, 62, 8043, 25, 598, 13, 43810, 62, 565, 82, 13, 39754, 62, 8043, 198, 220, 220, 220, 319, 62, 20979, 25, 2116, 13, 8000, 13, 47423, 7, 944, 8, 628, 198, 27, 44, 8068, 5439, 803, 33986, 29, 198, 220, 220, 220, 2546, 62, 71, 600, 25, 6045, 11, 6045, 198, 220, 220, 220, 6001, 25, 288, 79, 7, 1238, 8, 198, 220, 220, 220, 9647, 25, 6167, 13, 41293, 62, 7857, 58, 15, 60, 198, 220, 220, 220, 4865, 62, 8043, 62, 64, 25, 764, 20, 198, 220, 220, 220, 45243, 62, 35904, 62, 8043, 25, 598, 13, 43810, 62, 565, 82, 13, 39754, 62, 8043, 198, 220, 220, 220, 2124, 25, 532, 944, 13, 10394, 628, 220, 220, 220, 36052, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 6167, 198, 220, 220, 220, 220, 220, 220, 220, 3124, 25, 657, 11, 657, 11, 657, 11, 352, 198, 220, 220, 220, 220, 220, 220, 220, 10758, 25, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 41485, 25, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 2420, 25, 705, 220, 4064, 82, 220, 705, 4064, 6808, 13, 5239, 628, 198, 27, 12740, 25896, 33574, 803, 1537, 27288, 29, 198, 220, 220, 220, 49768, 21864, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 277, 62, 46118, 62, 16, 198, 220, 220, 220, 220, 220, 220, 220, 7196, 25, 1351, 7, 15763, 13, 48679, 803, 62, 7890, 13, 27160, 28955, 58, 15, 60, 198, 220, 220, 220, 49768, 21864, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 277, 62, 46118, 62, 17, 198, 220, 220, 220, 220, 220, 220, 220, 7196, 25, 1351, 7, 15763, 13, 48679, 803, 62, 7890, 13, 27160, 28955, 58, 16, 60, 198, 220, 220, 220, 49768, 21864, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 277, 62, 46118, 62, 18, 198, 220, 220, 220, 220, 220, 220, 220, 7196, 25, 1351, 7, 15763, 13, 48679, 803, 62, 7890, 13, 27160, 28955, 58, 17, 60, 628, 220, 220, 220, 337, 8068, 5439, 803, 33986, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 277, 62, 75, 2436, 62, 16, 198, 220, 220, 220, 220, 220, 220, 220, 2420, 25, 1351, 7, 15763, 13, 48679, 803, 62, 7890, 13, 13083, 28955, 58, 15, 60, 198, 220, 220, 220, 220, 220, 220, 220, 331, 25, 288, 79, 7, 17657, 8, 198, 220, 220, 220, 337, 8068, 5439, 803, 33986, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 277, 62, 75, 2436, 62, 17, 198, 220, 220, 220, 220, 220, 220, 220, 2420, 25, 1351, 7, 15763, 13, 48679, 803, 62, 7890, 13, 13083, 28955, 58, 16, 60, 198, 220, 220, 220, 220, 220, 220, 220, 331, 25, 288, 79, 7, 17279, 8, 198, 220, 220, 220, 337, 8068, 5439, 803, 33986, 25, 198, 220, 220, 220, 220, 220, 220, 220, 4686, 25, 277, 62, 75, 2436, 62, 18, 198, 220, 220, 220, 220, 220, 220, 220, 2420, 25, 1351, 7, 15763, 13, 48679, 803, 62, 7890, 13, 13083, 28955, 58, 17, 60, 198, 220, 220, 220, 220, 220, 220, 220, 331, 25, 288, 79, 7, 24909, 8, 628, 220, 220, 220, 337, 8068, 5439, 803, 12502, 21864, 25, 198, 220, 220, 220, 220, 220, 220, 220, 7196, 25, 6808, 13, 4749, 198, 220, 220, 220, 220, 220, 220, 220, 2546, 25, 288, 79, 7, 3980, 828, 288, 79, 7, 3980, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2124, 25, 26580, 13, 10394, 532, 357, 944, 13, 10394, 1343, 288, 79, 7, 1314, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 45243, 62, 35904, 62, 8043, 25, 598, 13, 43810, 62, 565, 82, 13, 39754, 62, 8043, 198, 220, 220, 220, 220, 220, 220, 220, 331, 25, 288, 79, 7, 1314, 8, 198, 220, 220, 220, 220, 220, 220, 220, 319, 62, 20979, 25, 6808, 13, 12860, 62, 48679, 803, 62, 4360, 27288, 3419, 198, 7061, 11537, 628, 198 ]
2.25353
1,629
# # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # import time from threading import Event from twitter.common import log from .health_check import StatusHealthCheck from .task_util import StatusHelper from gen.apache.aurora.api.ttypes import ScheduleStatus, TaskQuery
[ 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 345, 743, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789, 13, 198, 2, 921, 743, 7330, 257, 4866, 286, 262, 13789, 379, 198, 2, 198, 2, 220, 220, 220, 220, 2638, 1378, 2503, 13, 43073, 13, 2398, 14, 677, 4541, 14, 43, 2149, 24290, 12, 17, 13, 15, 198, 2, 198, 2, 17486, 2672, 416, 9723, 1099, 393, 4987, 284, 287, 3597, 11, 3788, 198, 2, 9387, 739, 262, 13789, 318, 9387, 319, 281, 366, 1921, 3180, 1, 29809, 1797, 11, 198, 2, 42881, 34764, 11015, 6375, 7102, 49828, 11053, 3963, 15529, 509, 12115, 11, 2035, 4911, 393, 17142, 13, 198, 2, 4091, 262, 13789, 329, 262, 2176, 3303, 15030, 21627, 290, 198, 2, 11247, 739, 262, 13789, 13, 198, 2, 198, 198, 11748, 640, 198, 6738, 4704, 278, 1330, 8558, 198, 198, 6738, 17044, 13, 11321, 1330, 2604, 198, 198, 6738, 764, 13948, 62, 9122, 1330, 12678, 18081, 9787, 198, 6738, 764, 35943, 62, 22602, 1330, 12678, 47429, 198, 198, 6738, 2429, 13, 43073, 13, 2899, 5799, 13, 15042, 13, 83, 19199, 1330, 19281, 19580, 11, 15941, 20746, 628, 198 ]
3.802956
203
""" Hydrus helper is module containing various functions for working with Hydrus output files and processing them in Jupyter Notebooks For now the functions are: - copy_output(): It will copy the selected files from temporary working directory of a Hydrus project to a Hydrus/project_name subdirectory. """ # some imports first import glob import os import sys import pathlib from shutil import copyfile import pandas as pd from tkinter import * from tkinter.filedialog import askopenfilename def copy_output(): """ Copy specified Hydrus output file(s) for a specified project to a working folder of this function (script), (if other destination is not specified. #should be implemented later) Works only for Temp working directory, which exists only if some project is open. Parameters ---------- (project_name) : string Need to be entered after a prompt of this function. All avaible projet names will be listed. (file_name) : string Need to be entered after a prompt of this function. All avaible output files will be listed Returns ------- copy of the original file(s) """ working_path = "C:\\HYDRUS\\Temp\\~Hydrus3D_2xx\\" cwd = os.getcwd() # creating and printing list of all projects in Hydrus working folder out_p = [p.split("\\")[-1] for p in glob.glob(working_path + "*")] out_p.remove('Hydrus3D_2xx.tmp') print("List of projects in the Hydrus working directory:") for p in out_p: print(p) print("") # choice of project with desired output files project = input("Enter the projet name from the printed list: ") print("") while project not in out_p: print("There is no such project name %s" % project) project = input( "Check the list again and enter an existing projet name: " ) print("") # creating and printing list of all output files out_f = [f.split("\\")[-1] for f in glob.glob( working_path + project + "\\" + "*.out")] print("List of output files in the %s working directory" % project) for f in out_f: print(f.split("\\")[-1]) print("") # creating the list of files to copy from user input files = input("Enter the file name(s) you want to copy: ") if "," in files: files = [x.strip() for x in files.split(',')] else: files = [x.strip() for x in files.split(' ')] # check if all the file names are right result = all(elem in out_f for elem in files) print("") # if not run it again with check while not result: print("Some error is in file(s) name(s)") files = input( "Check the list again and enter the output files names: ") print("") if "," in files: files = [x.strip() for x in files.split(',')] else: files = [x.strip() for x in files.split(' ')] result = all(elem in out_f for elem in files) # finally the copy of files will be done for name in files: print("Filename: %s" % name) source = working_path + project + "\\" + name print("Source: %s" % source) pathlib.Path( cwd + "\\hydrus\\" + project + "\\" ).mkdir(parents=True, exist_ok=True) destination = cwd + "\\hydrus\\" + project + "\\" + name print("Destination: %s" % destination) copyfile(source, destination) print("file %s succesefuly copied to %s" % (name, destination)) def read_file(proc_type='flow'): """ Function will read the specific composition of a hydrus output file and convert it to a dataframe. Now it works only for the "v_Mean.out" file type args: proc_type: string Optional argument for better processing of the Hydrus output according your simulation type. Values for choice are: - flow - only flow simulation (default value) - tracer - solution simulation with one solute (tracer) - cwm1 - biokinetic simulation with CWM1 model - cw2d - biokinetic simulation with CW2D model Parameters ---------- filepath : string Full or relative path to the file Returns ------- pandas dataframe """ proc_types = ['flow', 'tracer', 'cwm1', 'cw2d'] if proc_type not in proc_types: raise ValueError( "Invalid process type. Expected one of: %s" % proc_types ) root = Tk() root.update() filepath = askopenfilename() root.destroy() filepath = filepath.replace('/', '\\') # dictionaries for renaming columns in the returned dataframe v_mean_col = { "Time": "time", "rAtm": "pot_surface_flux_atm", "rRoot": "pot_transp_rate", "vAtm": "act_surface_flux_atm", "vRoot": "act_transp_rate", "vKode3": "total_bottom flux", "vKode1": "total_boundary_flux", "vSeep": "total_seepage_flux", "vKode5": "total_b_node_flux", "Runoff": "average_surface_ runoff", "Evapor": "average_evapor_flux", "Infiltr": "average_infil_flux", "SnowLayer": "surface_snow_layer" } cum_q_col = { "Time": "time", "CumQAP": "c_pot_surface_flux_atm", "CumQRP": "c_pot_transp_rate", "CumQA": "c_act_surface_flux_atm", "CumQR": "c_act_transp_rate", "CumQ3": "c_total_bottom flux", "CumQ1": "c_total_boundary_flux", "CumQS": "c_total_seepage_flux", "CumQ5": "c_total_b_node_flux", "cRunoff": "c_surface_ runoff", "cEvapor": "c_evapor_flux", "cInfiltr": "c_infil_flux", } obsnode_col = { "hNew": "hNew.0", "theta": "theta.0", "Temp": "Temp.0", "Conc": "Conc.0", "Sorb": "Sorb.0" } col_cwm1 = { "Conc.0": "oxygen.1", "Conc.1": "readillyCOD.1", "Conc.2": "acetat.1", "Conc.3": "in_sol_COD.1", "Conc.4": "NH4.1", "Conc.5": "NO3.1", "Conc.6": "SSO4.1", "Conc.7": "H2S.1", "Conc.8": "slowlyCOD.1", "Conc.9": "in_part_COD.1", "Sorb.10": "heterotrophic.1", "Sorb.11": "autotrophic.1", "Sorb.12": "fermenting.1", "Sorb.13": "methanogenic.1", "Sorb.14": "sulphate_reducing.1", "Sorb.15": "sulphide_oxidising.1", } if "v_Mean.out" in filepath: data = pd.read_csv(filepath, engine='python', skiprows=[0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12], sep=" ", skipinitialspace=True, skipfooter=1 ) data = data.loc[:, (data != 0).any(axis=0)] data = data.rename(v_mean_col, axis='columns') print("Data from %s were read into the Pandas DataFrame" % filepath) return data elif "Cum_Q.out" in filepath: data = pd.read_csv(filepath, engine='python', skiprows=[0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12], sep=" ", skipinitialspace=True, skipfooter=1 ) data = data.loc[:, (data != 0).any(axis=0)] data = data.rename(cum_q_col, axis='columns') print("Data from %s were read into the Pandas DataFrame" % filepath) return data elif "ObsNod.out" in filepath: if proc_type == "cwm1": data = pd.read_csv(filepath, engine='python', skiprows=[0, 1, 2, 3, 4], sep=" ", skipinitialspace=True, skipfooter=1 ) data = data.rename(obsnode_col, axis='columns') data = data.rename(col_cwm1, axis='columns') data = data.loc[:, (data != 0).any(axis=0)] else: data = pd.read_csv(filepath, engine='python', skiprows=[0, 1, 2, 3, 4], sep=" ", skipinitialspace=True, skipfooter=1 ) data = data.rename(obsnode_col, axis='columns') data = data.loc[:, (data != 0).any(axis=0)] print("Data from %s were read into the Pandas DataFrame" % filepath) return data else: print("Sorry, data reader for this file type is not yet implemented.")
[ 37811, 201, 198, 40436, 14932, 31904, 318, 8265, 7268, 2972, 5499, 329, 1762, 351, 15084, 14932, 201, 198, 22915, 3696, 290, 7587, 606, 287, 449, 929, 88, 353, 5740, 12106, 201, 198, 201, 198, 1890, 783, 262, 5499, 389, 25, 201, 198, 201, 198, 12, 4866, 62, 22915, 33529, 201, 198, 220, 220, 220, 632, 481, 4866, 262, 6163, 3696, 422, 8584, 1762, 8619, 286, 257, 201, 198, 220, 220, 220, 15084, 14932, 1628, 284, 257, 15084, 14932, 14, 16302, 62, 3672, 850, 34945, 13, 201, 198, 37811, 201, 198, 2, 617, 17944, 717, 201, 198, 11748, 15095, 201, 198, 11748, 28686, 201, 198, 11748, 25064, 201, 198, 11748, 3108, 8019, 201, 198, 6738, 4423, 346, 1330, 4866, 7753, 201, 198, 11748, 19798, 292, 355, 279, 67, 201, 198, 6738, 256, 74, 3849, 1330, 1635, 201, 198, 6738, 256, 74, 3849, 13, 69, 3902, 498, 519, 1330, 1265, 9654, 34345, 201, 198, 201, 198, 201, 198, 4299, 4866, 62, 22915, 33529, 201, 198, 220, 220, 220, 37227, 201, 198, 220, 220, 220, 17393, 7368, 15084, 14932, 5072, 2393, 7, 82, 8, 329, 257, 7368, 1628, 201, 198, 220, 220, 220, 284, 257, 1762, 9483, 286, 428, 2163, 357, 12048, 828, 201, 198, 220, 220, 220, 357, 361, 584, 10965, 318, 407, 7368, 13, 1303, 21754, 307, 9177, 1568, 8, 201, 198, 220, 220, 220, 10933, 691, 329, 24189, 1762, 8619, 11, 201, 198, 220, 220, 220, 543, 7160, 691, 611, 617, 1628, 318, 1280, 13, 201, 198, 201, 198, 220, 220, 220, 40117, 201, 198, 220, 220, 220, 24200, 438, 201, 198, 220, 220, 220, 357, 16302, 62, 3672, 8, 1058, 4731, 201, 198, 220, 220, 220, 220, 220, 220, 220, 10664, 284, 307, 5982, 706, 257, 6152, 286, 428, 2163, 13, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1439, 1196, 64, 856, 386, 31173, 3891, 481, 307, 5610, 13, 201, 198, 220, 220, 220, 357, 7753, 62, 3672, 8, 1058, 4731, 201, 198, 220, 220, 220, 220, 220, 220, 220, 10664, 284, 307, 5982, 706, 257, 6152, 286, 428, 2163, 13, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1439, 1196, 64, 856, 5072, 3696, 481, 307, 5610, 201, 198, 201, 198, 220, 220, 220, 16409, 201, 198, 220, 220, 220, 35656, 201, 198, 220, 220, 220, 4866, 286, 262, 2656, 2393, 7, 82, 8, 201, 198, 220, 220, 220, 37227, 201, 198, 201, 198, 220, 220, 220, 1762, 62, 6978, 796, 366, 34, 25, 6852, 42598, 7707, 2937, 6852, 30782, 6852, 93, 40436, 14932, 18, 35, 62, 17, 5324, 6852, 1, 201, 198, 220, 220, 220, 269, 16993, 796, 28686, 13, 1136, 66, 16993, 3419, 201, 198, 201, 198, 220, 220, 220, 1303, 4441, 290, 13570, 1351, 286, 477, 4493, 287, 15084, 14932, 1762, 9483, 201, 198, 220, 220, 220, 503, 62, 79, 796, 685, 79, 13, 35312, 7203, 6852, 4943, 58, 12, 16, 60, 329, 279, 287, 15095, 13, 4743, 672, 7, 16090, 62, 6978, 1343, 366, 9, 4943, 60, 201, 198, 220, 220, 220, 503, 62, 79, 13, 28956, 10786, 40436, 14932, 18, 35, 62, 17, 5324, 13, 22065, 11537, 201, 198, 220, 220, 220, 3601, 7203, 8053, 286, 4493, 287, 262, 15084, 14932, 1762, 8619, 25, 4943, 201, 198, 220, 220, 220, 329, 279, 287, 503, 62, 79, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 79, 8, 201, 198, 220, 220, 220, 3601, 7203, 4943, 201, 198, 201, 198, 220, 220, 220, 1303, 3572, 286, 1628, 351, 10348, 5072, 3696, 201, 198, 220, 220, 220, 1628, 796, 5128, 7203, 17469, 262, 386, 31173, 1438, 422, 262, 10398, 1351, 25, 366, 8, 201, 198, 220, 220, 220, 3601, 7203, 4943, 201, 198, 201, 198, 220, 220, 220, 981, 1628, 407, 287, 503, 62, 79, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 1858, 318, 645, 884, 1628, 1438, 4064, 82, 1, 4064, 1628, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1628, 796, 5128, 7, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9787, 262, 1351, 757, 290, 3802, 281, 4683, 386, 31173, 1438, 25, 366, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 4943, 201, 198, 201, 198, 220, 220, 220, 1303, 4441, 290, 13570, 1351, 286, 477, 5072, 3696, 201, 198, 220, 220, 220, 503, 62, 69, 796, 685, 69, 13, 35312, 7203, 6852, 4943, 58, 12, 16, 60, 329, 277, 287, 15095, 13, 4743, 672, 7, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1762, 62, 6978, 1343, 1628, 1343, 366, 6852, 1, 1343, 366, 24620, 448, 4943, 60, 201, 198, 220, 220, 220, 3601, 7203, 8053, 286, 5072, 3696, 287, 262, 4064, 82, 1762, 8619, 1, 4064, 1628, 8, 201, 198, 220, 220, 220, 329, 277, 287, 503, 62, 69, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 13, 35312, 7203, 6852, 4943, 58, 12, 16, 12962, 201, 198, 220, 220, 220, 3601, 7203, 4943, 201, 198, 201, 198, 220, 220, 220, 1303, 4441, 262, 1351, 286, 3696, 284, 4866, 422, 2836, 5128, 201, 198, 220, 220, 220, 3696, 796, 5128, 7203, 17469, 262, 2393, 1438, 7, 82, 8, 345, 765, 284, 4866, 25, 366, 8, 201, 198, 220, 220, 220, 611, 366, 553, 287, 3696, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3696, 796, 685, 87, 13, 36311, 3419, 329, 2124, 287, 3696, 13, 35312, 7, 3256, 11537, 60, 201, 198, 220, 220, 220, 2073, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3696, 796, 685, 87, 13, 36311, 3419, 329, 2124, 287, 3696, 13, 35312, 10786, 705, 15437, 201, 198, 201, 198, 220, 220, 220, 1303, 2198, 611, 477, 262, 2393, 3891, 389, 826, 201, 198, 220, 220, 220, 1255, 796, 477, 7, 68, 10671, 287, 503, 62, 69, 329, 9766, 76, 287, 3696, 8, 201, 198, 220, 220, 220, 3601, 7203, 4943, 201, 198, 201, 198, 220, 220, 220, 1303, 611, 407, 1057, 340, 757, 351, 2198, 201, 198, 220, 220, 220, 981, 407, 1255, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 4366, 4049, 318, 287, 2393, 7, 82, 8, 1438, 7, 82, 8, 4943, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3696, 796, 5128, 7, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9787, 262, 1351, 757, 290, 3802, 262, 5072, 3696, 3891, 25, 366, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 4943, 201, 198, 220, 220, 220, 220, 220, 220, 220, 611, 366, 553, 287, 3696, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3696, 796, 685, 87, 13, 36311, 3419, 329, 2124, 287, 3696, 13, 35312, 7, 3256, 11537, 60, 201, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3696, 796, 685, 87, 13, 36311, 3419, 329, 2124, 287, 3696, 13, 35312, 10786, 705, 15437, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1255, 796, 477, 7, 68, 10671, 287, 503, 62, 69, 329, 9766, 76, 287, 3696, 8, 201, 198, 201, 198, 220, 220, 220, 1303, 3443, 262, 4866, 286, 3696, 481, 307, 1760, 201, 198, 220, 220, 220, 329, 1438, 287, 3696, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 35063, 25, 4064, 82, 1, 4064, 1438, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 2723, 796, 1762, 62, 6978, 1343, 1628, 1343, 366, 6852, 1, 1343, 1438, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 7416, 25, 4064, 82, 1, 4064, 2723, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3108, 8019, 13, 15235, 7, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 269, 16993, 1343, 366, 6852, 15511, 14932, 6852, 1, 1343, 1628, 1343, 366, 6852, 1, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6739, 28015, 15908, 7, 23743, 28, 17821, 11, 2152, 62, 482, 28, 17821, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 10965, 796, 269, 16993, 1343, 366, 6852, 15511, 14932, 6852, 1, 1343, 1628, 1343, 366, 6852, 1, 1343, 1438, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 24159, 1883, 25, 4064, 82, 1, 4064, 10965, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 4866, 7753, 7, 10459, 11, 10965, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 7753, 4064, 82, 17458, 274, 891, 2062, 18984, 284, 4064, 82, 1, 4064, 357, 3672, 11, 10965, 4008, 201, 198, 201, 198, 201, 198, 4299, 1100, 62, 7753, 7, 36942, 62, 4906, 11639, 11125, 6, 2599, 201, 198, 220, 220, 220, 37227, 201, 198, 220, 220, 220, 15553, 481, 1100, 262, 2176, 11742, 286, 257, 2537, 7109, 385, 5072, 2393, 290, 201, 198, 220, 220, 220, 10385, 340, 284, 257, 1366, 14535, 13, 201, 198, 220, 220, 220, 2735, 340, 2499, 691, 329, 262, 366, 85, 62, 5308, 272, 13, 448, 1, 2393, 2099, 201, 198, 201, 198, 220, 220, 220, 26498, 25, 201, 198, 220, 220, 220, 13834, 62, 4906, 25, 4731, 201, 198, 220, 220, 220, 220, 220, 220, 220, 32233, 4578, 329, 1365, 7587, 286, 262, 15084, 14932, 5072, 1864, 201, 198, 220, 220, 220, 220, 220, 220, 220, 534, 18640, 2099, 13, 201, 198, 220, 220, 220, 220, 220, 220, 220, 27068, 329, 3572, 389, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 532, 5202, 532, 691, 5202, 18640, 357, 12286, 1988, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 532, 491, 11736, 532, 4610, 18640, 351, 530, 1540, 1133, 357, 2213, 11736, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 532, 269, 26377, 16, 532, 3182, 36749, 5139, 18640, 351, 327, 22117, 16, 2746, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 532, 269, 86, 17, 67, 532, 3182, 36749, 5139, 18640, 351, 24006, 17, 35, 2746, 201, 198, 201, 198, 220, 220, 220, 40117, 201, 198, 220, 220, 220, 24200, 438, 201, 198, 220, 220, 220, 2393, 6978, 1058, 4731, 201, 198, 220, 220, 220, 220, 220, 220, 220, 6462, 393, 3585, 3108, 284, 262, 2393, 201, 198, 201, 198, 220, 220, 220, 16409, 201, 198, 220, 220, 220, 35656, 201, 198, 220, 220, 220, 19798, 292, 1366, 14535, 201, 198, 220, 220, 220, 37227, 201, 198, 220, 220, 220, 13834, 62, 19199, 796, 37250, 11125, 3256, 705, 2213, 11736, 3256, 705, 66, 26377, 16, 3256, 705, 66, 86, 17, 67, 20520, 201, 198, 220, 220, 220, 611, 13834, 62, 4906, 407, 287, 13834, 62, 19199, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 5298, 11052, 12331, 7, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 44651, 1429, 2099, 13, 1475, 7254, 530, 286, 25, 4064, 82, 1, 4064, 13834, 62, 19199, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 201, 198, 201, 198, 220, 220, 220, 6808, 796, 309, 74, 3419, 201, 198, 220, 220, 220, 6808, 13, 19119, 3419, 201, 198, 220, 220, 220, 2393, 6978, 796, 1265, 9654, 34345, 3419, 201, 198, 220, 220, 220, 6808, 13, 41659, 3419, 201, 198, 201, 198, 220, 220, 220, 2393, 6978, 796, 2393, 6978, 13, 33491, 10786, 14, 3256, 705, 6852, 11537, 201, 198, 201, 198, 220, 220, 220, 1303, 48589, 3166, 329, 8851, 3723, 15180, 287, 262, 4504, 1366, 14535, 201, 198, 220, 220, 220, 410, 62, 32604, 62, 4033, 796, 1391, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 7575, 1298, 366, 2435, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 81, 2953, 76, 1298, 366, 13059, 62, 42029, 62, 69, 22564, 62, 265, 76, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 81, 30016, 1298, 366, 13059, 62, 7645, 79, 62, 4873, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 85, 2953, 76, 1298, 366, 529, 62, 42029, 62, 69, 22564, 62, 265, 76, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 85, 30016, 1298, 366, 529, 62, 7645, 79, 62, 4873, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 85, 42, 1098, 18, 1298, 366, 23350, 62, 22487, 28462, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 85, 42, 1098, 16, 1298, 366, 23350, 62, 7784, 560, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 85, 4653, 538, 1298, 366, 23350, 62, 325, 538, 496, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 85, 42, 1098, 20, 1298, 366, 23350, 62, 65, 62, 17440, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 10987, 2364, 1298, 366, 23913, 62, 42029, 62, 37536, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 15200, 12687, 1298, 366, 23913, 62, 1990, 12687, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 818, 10379, 2213, 1298, 366, 23913, 62, 259, 10379, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 28974, 49925, 1298, 366, 42029, 62, 82, 2197, 62, 29289, 1, 201, 198, 220, 220, 220, 1782, 201, 198, 201, 198, 220, 220, 220, 10973, 62, 80, 62, 4033, 796, 1391, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 7575, 1298, 366, 2435, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 2969, 1298, 366, 66, 62, 13059, 62, 42029, 62, 69, 22564, 62, 265, 76, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 20031, 1298, 366, 66, 62, 13059, 62, 7645, 79, 62, 4873, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 32, 1298, 366, 66, 62, 529, 62, 42029, 62, 69, 22564, 62, 265, 76, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 49, 1298, 366, 66, 62, 529, 62, 7645, 79, 62, 4873, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 18, 1298, 366, 66, 62, 23350, 62, 22487, 28462, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 16, 1298, 366, 66, 62, 23350, 62, 7784, 560, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 50, 1298, 366, 66, 62, 23350, 62, 325, 538, 496, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 34, 388, 48, 20, 1298, 366, 66, 62, 23350, 62, 65, 62, 17440, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 66, 10987, 2364, 1298, 366, 66, 62, 42029, 62, 37536, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 66, 15200, 12687, 1298, 366, 66, 62, 1990, 12687, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 66, 818, 10379, 2213, 1298, 366, 66, 62, 259, 10379, 62, 69, 22564, 1600, 201, 198, 220, 220, 220, 1782, 201, 198, 201, 198, 220, 220, 220, 10201, 17440, 62, 4033, 796, 1391, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 71, 3791, 1298, 366, 71, 3791, 13, 15, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 1169, 8326, 1298, 366, 1169, 8326, 13, 15, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 30782, 1298, 366, 30782, 13, 15, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 1298, 366, 3103, 66, 13, 15, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 1298, 366, 50, 27688, 13, 15, 1, 201, 198, 220, 220, 220, 1782, 201, 198, 201, 198, 220, 220, 220, 951, 62, 66, 26377, 16, 796, 1391, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 15, 1298, 366, 23536, 5235, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 16, 1298, 366, 961, 6548, 34, 3727, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 17, 1298, 366, 23253, 265, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 18, 1298, 366, 259, 62, 34453, 62, 34, 3727, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 19, 1298, 366, 33863, 19, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 20, 1298, 366, 15285, 18, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 21, 1298, 366, 5432, 46, 19, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 22, 1298, 366, 39, 17, 50, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 23, 1298, 366, 38246, 306, 34, 3727, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 3103, 66, 13, 24, 1298, 366, 259, 62, 3911, 62, 34, 3727, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 13, 940, 1298, 366, 43332, 313, 18191, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 13, 1157, 1298, 366, 2306, 313, 18191, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 13, 1065, 1298, 366, 2232, 434, 278, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 13, 1485, 1298, 366, 76, 2788, 272, 15147, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 13, 1415, 1298, 366, 82, 377, 746, 378, 62, 445, 25648, 13, 16, 1600, 201, 198, 220, 220, 220, 220, 220, 220, 220, 366, 50, 27688, 13, 1314, 1298, 366, 82, 377, 746, 485, 62, 1140, 312, 1710, 13, 16, 1600, 201, 198, 220, 220, 220, 1782, 201, 198, 201, 198, 220, 220, 220, 611, 366, 85, 62, 5308, 272, 13, 448, 1, 287, 2393, 6978, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 279, 67, 13, 961, 62, 40664, 7, 7753, 6978, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3113, 11639, 29412, 3256, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 8516, 41888, 15, 11, 352, 11, 362, 11, 513, 11, 604, 11, 642, 11, 718, 11, 767, 11, 807, 11, 860, 11, 1367, 11, 1105, 4357, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 41767, 2625, 33172, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 36733, 13200, 28, 17821, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 5898, 263, 28, 16, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 17946, 58, 45299, 357, 7890, 14512, 657, 737, 1092, 7, 22704, 28, 15, 15437, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 918, 480, 7, 85, 62, 32604, 62, 4033, 11, 16488, 11639, 28665, 82, 11537, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 6601, 422, 4064, 82, 547, 1100, 656, 262, 16492, 292, 6060, 19778, 1, 4064, 2393, 6978, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 1366, 201, 198, 201, 198, 220, 220, 220, 1288, 361, 366, 34, 388, 62, 48, 13, 448, 1, 287, 2393, 6978, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 279, 67, 13, 961, 62, 40664, 7, 7753, 6978, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3113, 11639, 29412, 3256, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 8516, 41888, 15, 11, 352, 11, 362, 11, 513, 11, 604, 11, 642, 11, 718, 11, 767, 11, 807, 11, 860, 11, 1367, 11, 1105, 4357, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 41767, 2625, 33172, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 36733, 13200, 28, 17821, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 5898, 263, 28, 16, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 17946, 58, 45299, 357, 7890, 14512, 657, 737, 1092, 7, 22704, 28, 15, 15437, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 918, 480, 7, 36340, 62, 80, 62, 4033, 11, 16488, 11639, 28665, 82, 11537, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 6601, 422, 4064, 82, 547, 1100, 656, 262, 16492, 292, 6060, 19778, 1, 4064, 2393, 6978, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 1366, 201, 198, 201, 198, 220, 220, 220, 1288, 361, 366, 31310, 45, 375, 13, 448, 1, 287, 2393, 6978, 25, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 611, 13834, 62, 4906, 6624, 366, 66, 26377, 16, 1298, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 279, 67, 13, 961, 62, 40664, 7, 7753, 6978, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3113, 11639, 29412, 3256, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 8516, 41888, 15, 11, 352, 11, 362, 11, 513, 11, 604, 4357, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 41767, 2625, 33172, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 36733, 13200, 28, 17821, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 5898, 263, 28, 16, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 918, 480, 7, 8158, 17440, 62, 4033, 11, 16488, 11639, 28665, 82, 11537, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 918, 480, 7, 4033, 62, 66, 26377, 16, 11, 16488, 11639, 28665, 82, 11537, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 17946, 58, 45299, 357, 7890, 14512, 657, 737, 1092, 7, 22704, 28, 15, 15437, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 279, 67, 13, 961, 62, 40664, 7, 7753, 6978, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3113, 11639, 29412, 3256, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 8516, 41888, 15, 11, 352, 11, 362, 11, 513, 11, 604, 4357, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 41767, 2625, 33172, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 36733, 13200, 28, 17821, 11, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14267, 5898, 263, 28, 16, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 918, 480, 7, 8158, 17440, 62, 4033, 11, 16488, 11639, 28665, 82, 11537, 201, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1366, 796, 1366, 13, 17946, 58, 45299, 357, 7890, 14512, 657, 737, 1092, 7, 22704, 28, 15, 15437, 201, 198, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 6601, 422, 4064, 82, 547, 1100, 656, 262, 16492, 292, 6060, 19778, 1, 4064, 2393, 6978, 8, 201, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 1366, 201, 198, 201, 198, 220, 220, 220, 2073, 25, 201, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 7203, 14385, 11, 1366, 9173, 329, 428, 2393, 2099, 318, 407, 1865, 9177, 19570, 201, 198 ]
1.968655
4,594
from telethon import events from iahr.reg import TextSender, VoidSender, MultiArgs, any_send from iahr.config import IahrConfig from iahr.utils import AccessList, EventService from .utils import mention, local, CHAT_TAG ################################################## # Routines themselves ################################################## @VoidSender(about=local['tagall']['about'], tags={CHAT_TAG})
[ 6738, 5735, 400, 261, 1330, 2995, 198, 198, 6738, 220, 9520, 81, 13, 2301, 1330, 8255, 50, 2194, 11, 18331, 50, 2194, 11, 15237, 42035, 11, 597, 62, 21280, 198, 6738, 220, 9520, 81, 13, 11250, 1330, 314, 993, 81, 16934, 198, 6738, 220, 9520, 81, 13, 26791, 1330, 8798, 8053, 11, 8558, 16177, 198, 198, 6738, 764, 26791, 1330, 3068, 11, 1957, 11, 5870, 1404, 62, 42197, 198, 198, 29113, 14468, 2235, 198, 2, 39602, 1127, 2405, 198, 29113, 14468, 2235, 628, 198, 31, 53, 1868, 50, 2194, 7, 10755, 28, 12001, 17816, 12985, 439, 6, 7131, 6, 10755, 6, 4357, 15940, 34758, 31542, 62, 42197, 30072, 198 ]
3.761468
109
# -*- coding: UTF-8 -*- # Copyright (c) 2008 - 2014, Pascal Volk # See COPYING for distribution information. """ vmm.ext.postconf ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Wrapper class for Postfix's postconf. Postconf instances can be used to read actual values of configuration parameters or edit the value of a configuration parameter. postconf.read(parameter) -> value postconf.edit(parameter, value) """ import re from gettext import gettext as _ from subprocess import Popen, PIPE from vmm.errors import VMMError from vmm.constants import VMM_ERROR class Postconf: """Wrapper class for Postfix's postconf.""" __slots__ = ("_bin", "_val") _parameter_re = re.compile(r"^\w+$", re.ASCII) _variables_re = re.compile(r"\$\b\w+\b", re.ASCII) def __init__(self, postconf_bin): """Creates a new Postconf instance. Argument: `postconf_bin` : str absolute path to the Postfix postconf binary. """ self._bin = postconf_bin self._val = "" def edit(self, parameter, value): """Set the `parameter`'s value to `value`. Arguments: `parameter` : str the name of a Postfix configuration parameter `value` : str the parameter's new value. """ self._check_parameter(parameter) stderr = Popen( (self._bin, "-e", parameter + "=" + str(value)), stderr=PIPE ).communicate()[1] if stderr: raise VMMError(stderr.strip().decode(), VMM_ERROR) def read(self, parameter, expand_vars=True): """Returns the parameter's value. If expand_vars is True (default), all variables in the value will be expanded: e.g. mydestination: mail.example.com, localhost.example.com, localhost Otherwise the value may contain one or more variables. e.g. mydestination: $myhostname, localhost.$mydomain, localhost Arguments: `parameter` : str the name of a Postfix configuration parameter. `expand_vars` : bool indicates if variables should be expanded or not, default True """ self._check_parameter(parameter) self._val = self._read(parameter) if expand_vars: self._expand_vars() return self._val def _check_parameter(self, parameter): """Check that the `parameter` looks like a configuration parameter. If not, a VMMError will be raised.""" if not self.__class__._parameter_re.match(parameter): raise VMMError( _( "The value '%s' does not look like a valid " "Postfix configuration parameter name." ) % parameter, VMM_ERROR, ) def _expand_vars(self): """Expand the $variables in self._val to their values.""" while True: pvars = set(self.__class__._variables_re.findall(self._val)) if not pvars: break if len(pvars) > 1: self._expand_multi_vars(self._read_multi(pvars)) continue pvars = pvars.pop() self._val = self._val.replace(pvars, self._read(pvars[1:])) def _expand_multi_vars(self, old_new): """Replace all $vars in self._val with their values.""" for old, new in old_new.items(): self._val = self._val.replace("$" + old, new) def _read(self, parameter): """Ask postconf for the value of a single configuration parameter.""" stdout, stderr = Popen( [self._bin, "-h", parameter], stdout=PIPE, stderr=PIPE ).communicate() if stderr: raise VMMError(stderr.strip().decode(), VMM_ERROR) return stdout.strip().decode() def _read_multi(self, parameters): """Ask postconf for multiple configuration parameters. Returns a dict parameter: value items.""" cmd = [self._bin] cmd.extend(parameter[1:] for parameter in parameters) stdout, stderr = Popen(cmd, stdout=PIPE, stderr=PIPE).communicate() if stderr: raise VMMError(stderr.strip().decode(), VMM_ERROR) par_val = {} for line in stdout.decode().splitlines(): par, val = line.split(" = ") par_val[par] = val return par_val
[ 2, 532, 9, 12, 19617, 25, 41002, 12, 23, 532, 9, 12, 198, 2, 15069, 357, 66, 8, 3648, 532, 1946, 11, 35163, 4709, 74, 198, 2, 4091, 27975, 45761, 329, 6082, 1321, 13, 198, 37811, 198, 220, 220, 220, 410, 3020, 13, 2302, 13, 7353, 10414, 198, 220, 220, 220, 220, 27156, 15116, 8728, 4907, 93, 628, 220, 220, 220, 27323, 2848, 1398, 329, 2947, 13049, 338, 1281, 10414, 13, 198, 220, 220, 220, 2947, 10414, 10245, 460, 307, 973, 284, 1100, 4036, 3815, 286, 8398, 198, 220, 220, 220, 10007, 393, 4370, 262, 1988, 286, 257, 8398, 11507, 13, 628, 220, 220, 220, 1281, 10414, 13, 961, 7, 17143, 2357, 8, 4613, 1988, 198, 220, 220, 220, 1281, 10414, 13, 19312, 7, 17143, 2357, 11, 1988, 8, 198, 37811, 198, 198, 11748, 302, 198, 6738, 651, 5239, 1330, 651, 5239, 355, 4808, 198, 6738, 850, 14681, 1330, 8099, 268, 11, 350, 4061, 36, 198, 198, 6738, 410, 3020, 13, 48277, 1330, 569, 12038, 12331, 198, 6738, 410, 3020, 13, 9979, 1187, 1330, 569, 12038, 62, 24908, 628, 198, 4871, 2947, 10414, 25, 198, 220, 220, 220, 37227, 36918, 2848, 1398, 329, 2947, 13049, 338, 1281, 10414, 526, 15931, 628, 220, 220, 220, 11593, 6649, 1747, 834, 796, 5855, 62, 8800, 1600, 45434, 2100, 4943, 198, 220, 220, 220, 4808, 17143, 2357, 62, 260, 796, 302, 13, 5589, 576, 7, 81, 1, 61, 59, 86, 10, 3, 1600, 302, 13, 42643, 3978, 8, 198, 220, 220, 220, 4808, 25641, 2977, 62, 260, 796, 302, 13, 5589, 576, 7, 81, 1, 59, 3, 59, 65, 59, 86, 10, 59, 65, 1600, 302, 13, 42643, 3978, 8, 628, 220, 220, 220, 825, 11593, 15003, 834, 7, 944, 11, 1281, 10414, 62, 8800, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 16719, 274, 257, 649, 2947, 10414, 4554, 13, 628, 220, 220, 220, 220, 220, 220, 220, 45751, 25, 628, 220, 220, 220, 220, 220, 220, 220, 4600, 7353, 10414, 62, 8800, 63, 1058, 965, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4112, 3108, 284, 262, 2947, 13049, 1281, 10414, 13934, 13, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 8800, 796, 1281, 10414, 62, 8800, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 2100, 796, 13538, 628, 220, 220, 220, 825, 4370, 7, 944, 11, 11507, 11, 1988, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 7248, 262, 4600, 17143, 2357, 63, 6, 82, 1988, 284, 4600, 8367, 44646, 628, 220, 220, 220, 220, 220, 220, 220, 20559, 2886, 25, 628, 220, 220, 220, 220, 220, 220, 220, 4600, 17143, 2357, 63, 1058, 965, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 262, 1438, 286, 257, 2947, 13049, 8398, 11507, 198, 220, 220, 220, 220, 220, 220, 220, 4600, 8367, 63, 1058, 965, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 262, 11507, 338, 649, 1988, 13, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 9122, 62, 17143, 2357, 7, 17143, 2357, 8, 198, 220, 220, 220, 220, 220, 220, 220, 336, 1082, 81, 796, 8099, 268, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 357, 944, 13557, 8800, 11, 27444, 68, 1600, 11507, 1343, 366, 2625, 1343, 965, 7, 8367, 36911, 336, 1082, 81, 28, 47, 4061, 36, 198, 220, 220, 220, 220, 220, 220, 220, 6739, 10709, 5344, 3419, 58, 16, 60, 198, 220, 220, 220, 220, 220, 220, 220, 611, 336, 1082, 81, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 569, 12038, 12331, 7, 301, 1082, 81, 13, 36311, 22446, 12501, 1098, 22784, 569, 12038, 62, 24908, 8, 628, 220, 220, 220, 825, 1100, 7, 944, 11, 11507, 11, 4292, 62, 85, 945, 28, 17821, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 35561, 262, 11507, 338, 1988, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1002, 4292, 62, 85, 945, 318, 6407, 357, 12286, 828, 477, 9633, 287, 262, 1988, 481, 307, 198, 220, 220, 220, 220, 220, 220, 220, 9902, 25, 198, 220, 220, 220, 220, 220, 220, 220, 304, 13, 70, 13, 616, 16520, 1883, 25, 6920, 13, 20688, 13, 785, 11, 1957, 4774, 13, 20688, 13, 785, 11, 1957, 4774, 198, 220, 220, 220, 220, 220, 220, 220, 15323, 262, 1988, 743, 3994, 530, 393, 517, 9633, 13, 198, 220, 220, 220, 220, 220, 220, 220, 304, 13, 70, 13, 616, 16520, 1883, 25, 720, 1820, 4774, 3672, 11, 1957, 4774, 48082, 1820, 27830, 11, 1957, 4774, 628, 220, 220, 220, 220, 220, 220, 220, 20559, 2886, 25, 628, 220, 220, 220, 220, 220, 220, 220, 4600, 17143, 2357, 63, 1058, 965, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 262, 1438, 286, 257, 2947, 13049, 8398, 11507, 13, 198, 220, 220, 220, 220, 220, 220, 220, 4600, 11201, 392, 62, 85, 945, 63, 1058, 20512, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9217, 611, 9633, 815, 307, 9902, 393, 407, 11, 4277, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 9122, 62, 17143, 2357, 7, 17143, 2357, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 2100, 796, 2116, 13557, 961, 7, 17143, 2357, 8, 198, 220, 220, 220, 220, 220, 220, 220, 611, 4292, 62, 85, 945, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 11201, 392, 62, 85, 945, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13557, 2100, 628, 220, 220, 220, 825, 4808, 9122, 62, 17143, 2357, 7, 944, 11, 11507, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 9787, 326, 262, 4600, 17143, 2357, 63, 3073, 588, 257, 8398, 11507, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1002, 407, 11, 257, 569, 12038, 12331, 481, 307, 4376, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 2116, 13, 834, 4871, 834, 13557, 17143, 2357, 62, 260, 13, 15699, 7, 17143, 2357, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 569, 12038, 12331, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4808, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 464, 1988, 705, 4, 82, 6, 857, 407, 804, 588, 257, 4938, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6307, 13049, 8398, 11507, 1438, 526, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4064, 11507, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 569, 12038, 62, 24908, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 825, 4808, 11201, 392, 62, 85, 945, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 16870, 392, 262, 720, 25641, 2977, 287, 2116, 13557, 2100, 284, 511, 3815, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 981, 6407, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 279, 85, 945, 796, 900, 7, 944, 13, 834, 4871, 834, 13557, 25641, 2977, 62, 260, 13, 19796, 439, 7, 944, 13557, 2100, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 407, 279, 85, 945, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 79, 85, 945, 8, 1875, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 11201, 392, 62, 41684, 62, 85, 945, 7, 944, 13557, 961, 62, 41684, 7, 79, 85, 945, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 279, 85, 945, 796, 279, 85, 945, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 2100, 796, 2116, 13557, 2100, 13, 33491, 7, 79, 85, 945, 11, 2116, 13557, 961, 7, 79, 85, 945, 58, 16, 47715, 4008, 628, 220, 220, 220, 825, 4808, 11201, 392, 62, 41684, 62, 85, 945, 7, 944, 11, 1468, 62, 3605, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 3041, 5372, 477, 720, 85, 945, 287, 2116, 13557, 2100, 351, 511, 3815, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 329, 1468, 11, 649, 287, 1468, 62, 3605, 13, 23814, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 2100, 796, 2116, 13557, 2100, 13, 33491, 7203, 3, 1, 1343, 1468, 11, 649, 8, 628, 220, 220, 220, 825, 4808, 961, 7, 944, 11, 11507, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 25214, 1281, 10414, 329, 262, 1988, 286, 257, 2060, 8398, 11507, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 14367, 448, 11, 336, 1082, 81, 796, 8099, 268, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 685, 944, 13557, 8800, 11, 27444, 71, 1600, 11507, 4357, 14367, 448, 28, 47, 4061, 36, 11, 336, 1082, 81, 28, 47, 4061, 36, 198, 220, 220, 220, 220, 220, 220, 220, 6739, 10709, 5344, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 611, 336, 1082, 81, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 569, 12038, 12331, 7, 301, 1082, 81, 13, 36311, 22446, 12501, 1098, 22784, 569, 12038, 62, 24908, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 14367, 448, 13, 36311, 22446, 12501, 1098, 3419, 628, 220, 220, 220, 825, 4808, 961, 62, 41684, 7, 944, 11, 10007, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 25214, 1281, 10414, 329, 3294, 8398, 10007, 13, 16409, 257, 8633, 198, 220, 220, 220, 220, 220, 220, 220, 11507, 25, 1988, 3709, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 23991, 796, 685, 944, 13557, 8800, 60, 198, 220, 220, 220, 220, 220, 220, 220, 23991, 13, 2302, 437, 7, 17143, 2357, 58, 16, 47715, 329, 11507, 287, 10007, 8, 198, 220, 220, 220, 220, 220, 220, 220, 14367, 448, 11, 336, 1082, 81, 796, 8099, 268, 7, 28758, 11, 14367, 448, 28, 47, 4061, 36, 11, 336, 1082, 81, 28, 47, 4061, 36, 737, 10709, 5344, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 611, 336, 1082, 81, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 569, 12038, 12331, 7, 301, 1082, 81, 13, 36311, 22446, 12501, 1098, 22784, 569, 12038, 62, 24908, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1582, 62, 2100, 796, 23884, 198, 220, 220, 220, 220, 220, 220, 220, 329, 1627, 287, 14367, 448, 13, 12501, 1098, 22446, 35312, 6615, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1582, 11, 1188, 796, 1627, 13, 35312, 7203, 796, 366, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1582, 62, 2100, 58, 1845, 60, 796, 1188, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 1582, 62, 2100, 198 ]
2.238579
1,970
""" Sixth version, make the code easier and more modifiable """ # Define the main programme from funcs import store_namespace from funcs import load_namespace from funcs import emulate_jmod import os import datetime import time import pandas as pd import numpy as np import matplotlib.pyplot as plt #from multiprocessing import Pool from mpcpy import units from mpcpy import variables from mpcpy import models_mod as models from scipy.optimize import curve_fit from scipy.linalg import expm from numpy.linalg import inv from sklearn.metrics import mean_squared_error, r2_score from statsmodels.graphics.tsaplots import plot_pacf from statsmodels.graphics.tsaplots import plot_acf from Simulator_HP_mod3 import SimHandler if __name__ == "__main__": # Naming conventions for the simulation community = 'ResidentialCommunityUK_rad_2elements' sim_id = 'MinEne' model_id = 'R2CW_HP' bldg_list = load_namespace(os.path.join('file_path_to_folder', 'teaser_bldgs_residential')) bldg_index_start = 0 bldg_index_end = 30 emulate = 0 # Emulate or not? old_sim_param = 1 # Choose initial guesses # Overall options date = '1/1/2017 ' start = '1/1/2017 00:00:00' end = '1/9/2017 00:00:00' train_start = start valid_start = '1/6/2017 00:00:00' train_end = valid_start valid_end = '1/9/2017 00:00:00' meas_sampl = '300' mon = 'jan' folder = 'path_to_file\\results_sysid_new_'+mon # Features to use in training exog = ['weaTDryBul_delay1', 'weaHGloHor_delay1','PowerCompr', 'PowerCompr_delay1', 'T_in_delay13'] target = 'TAir' features_dict = {} exog_list = [] j = 0 for item in exog: exog_list.append(item) ind_exog = item ar = [] for i in range(5): ar.append('T_in_delay'+str(i+1)) features_dict['ARX_lag_'+str(i+1)+'_exog'+str(j)] = exog_list + ar features_dict['ARX_lag_'+str(i+1)+'_'+ind_exog] = [ind_exog] + ar j += 1 # Instantiate Simulator Sim_list = [] i = 0 for bldg in bldg_list[bldg_index_start:bldg_index_end]: i = i+1 Sim = SimHandler(sim_start = start, sim_end = end, meas_sampl = meas_sampl ) Sim.building = bldg+'_'+model_id Sim.fmupath_emu = os.path.join(Sim.simu_path, 'fmus', community, community+'_'+bldg+'_'+bldg+'_Models_'+bldg+'_House_mpc.fmu') Sim.fmupath_ref = os.path.join(Sim.simu_path, 'fmus', community, community+'_'+bldg+'_'+bldg+'_Models_'+bldg+'_House_PI.fmu') Sim.moinfo_emu = (os.path.join(Sim.mod_path, community, bldg,bldg+'_Models',bldg+'_House_mpc.mo'), community+'.'+bldg+'.'+bldg+'_Models.'+bldg+'_House_mpc', {} ) Sim.moinfo_emu_ref = (os.path.join(Sim.mod_path, community, bldg,bldg+'_Models',bldg+'_House_PI.mo'), community+'.'+bldg+'.'+bldg+'_Models.'+bldg+'_House_PI', {} ) if emulate == 1: # Initialise exogenous data sources if i == 1: Sim.update_weather(start, end) index = pd.date_range(start, end, freq = meas_sampl+'S', tz=Sim.weather.tz_name) else: Sim.weather = Sim_list[i-2].weather #Sim.sim_start= '1/1/2017 00:00' Sim.get_control() #Sim.sim_start= start Sim.get_other_input(start,end) Sim.get_constraints(start,end,upd_control=1) Sim.param_file = os.path.join(Sim.simu_path,'csvs','Parameters_R2CW.csv') Sim.get_params() if i > 1: Sim.control = Sim_list[i-2].control store_namespace(os.path.join(folder, 'sysid_control_'+Sim.building+'_'+mon), Sim.control) else: store_namespace(os.path.join(folder, 'sysid_control_'+Sim.building+'_'+mon), Sim.control) # Initialise models Sim.init_models(use_ukf=1, use_fmu_mpc=1, use_fmu_emu=1) # Use for initialising # Add to list of simulations Sim_list.append(Sim) index = pd.date_range(start, end, freq = meas_sampl+'S') train_dict = {} test_dict = {} results_dict = {} for Sim in Sim_list: if emulate == 1: # Emlate to get data emulate_jmod(Sim.emu, Sim.meas_vars_emu, Sim.meas_sampl, start, end) # Handle data print(Sim.emu.display_measurements('Measured')) measurements = Sim.emu.display_measurements('Measured') index = pd.to_datetime(measurements.index) measurements.index = index weather = Sim.weather.display_data().resample(meas_sampl+'S').ffill() #print(weather) weather.index = index df = pd.concat([measurements, weather],axis=1)[start:end] df['PowerCompr'] = df['PowerCompr']/1000.0 df['TAir'] = df['TAir']-273.15 for j in range(1,20): df['T_in_delay'+str(j)] = df['TAir'].shift(periods=j) df['PowerCompr_delay'+str(j)] = df['PowerCompr'].shift(periods=j) df['weaTDryBul_delay'+str(j)] = df['weaTDryBul'].shift(periods=j) df = df.fillna(method='bfill') # Remove the lags from the beginning train_start = datetime.datetime.strptime(start, '%m/%d/%Y %H:%M:%S') + datetime.timedelta(seconds = 10*float(meas_sampl)) # Split the dataset df_train = df[train_start:train_end] df_test = df[valid_start:valid_end] train_dict[bldg] = df_train test_dict[bldg] = df_test store_namespace(os.path.join(folder, 'all_data_'+mon+'_'+Sim.building), df) store_namespace(os.path.join(folder, 'train_data_'+mon+'_'+Sim.building), df_train) store_namespace(os.path.join(folder, 'test_data_'+mon+'_'+Sim.building), df_test) else: df = load_namespace(os.path.join('results_sysid_test_'+mon, 'all_data_'+mon+'_'+Sim.building)) # Remove the lags from the beginning #train_start = start.strftime('%m/%d/%Y %H:%M:%S') train_start = datetime.datetime.strptime(start, '%m/%d/%Y %H:%M:%S') + datetime.timedelta(seconds = 10*float(meas_sampl)) for j in range(1,20): df['T_in_delay'+str(j)] = df['TAir'].shift(periods=j) df['PowerCompr_delay'+str(j)] = df['PowerCompr'].shift(periods=j) df['weaTDryBul_delay'+str(j)] = df['weaTDryBul'].shift(periods=j) df['weaHGloHor_delay'+str(j)] = df['weaHGloHor'].shift(periods=j) df = df.fillna(method='bfill') # Split the dataset df_train = df[train_start:train_end] df_test = df[valid_start:valid_end] train_dict[bldg] = df_train test_dict[bldg] = df_test store_namespace(os.path.join(folder, 'train_data_'+mon+'_'+Sim.building), df_train) store_namespace(os.path.join(folder, 'test_data_'+mon+'_'+Sim.building), df_test) #print(df_train['weaTDryBul']) '''Identify parameters ''' train_data = df_train i = 0 for case in features_dict.keys(): while True: try: features = features_dict[case] feats = features + [target] Sim.init_ARX_model(features, target, train_data) Sim.ARX_model.evaluate() # Make some predictions test_x = df_train[features].values Sim.ARX_model.predict(test_x) preds = Sim.ARX_model.predictions if not os.path.exists(os.path.join(folder,case)): os.makedirs(os.path.join(folder,case)) store_namespace(os.path.join(folder, case, 'sysid_ARXmodel_'+mon+'_'+Sim.building), Sim.ARX_model) store_namespace(os.path.join(folder, case, 'sysid_ARXparams_results_'+mon+'_'+Sim.building), Sim.ARX_model.fit_results.params) store_namespace(os.path.join(folder, case, 'sysid_ARXparams_IDpreds_'+mon+'_'+Sim.building), preds) results_dict[case+'_'+Sim.building] = {} results_dict[case+'_'+Sim.building]['AIC'] = Sim.ARX_model.fit_results.aic results_dict[case+'_'+Sim.building]['BIC'] = Sim.ARX_model.fit_results.bic results_dict[case+'_'+Sim.building]['MSE-total'] = Sim.ARX_model.fit_results.mse_total results_dict[case+'_'+Sim.building]['MSE-model'] = Sim.ARX_model.fit_results.mse_model results_dict[case+'_'+Sim.building]['MSE-resid'] = Sim.ARX_model.fit_results.mse_resid results_dict[case+'_'+Sim.building]['R2-ID'] = Sim.ARX_model.fit_results.rsquared '''Validate''' # Make some predictions test_x = df_test[features].values Sim.ARX_model.predict(test_x) preds = Sim.ARX_model.predictions mse = mean_squared_error(df_test['TAir'].values, preds) rscore = r2_score(df_test['TAir'].values, preds) print('Mean squared error - validation') print(mean_squared_error(df_test['TAir'].values, preds)) print('R^2 score - validation') print(r2_score(df_test['TAir'].values, preds)) results_dict[case+'_'+Sim.building]['MSE-model-valid'] = mse results_dict[case+'_'+Sim.building]['R2-valid'] = rscore store_namespace(os.path.join(folder, case, 'sysid_ARXparams_validpreds_'+mon+'_'+Sim.building), preds) store_namespace(os.path.join(folder, case, 'sysid_ARXparams_validMSE_'+mon+'_'+Sim.building), mse) store_namespace(os.path.join(folder, case, 'sysid_ARXparams_validR2_'+mon+'_'+Sim.building), rscore) break except: print('%%%%%%%%%%%%%%%%%% Failed, trying again! %%%%%%%%%%%%%%%%%%%%%%') continue results_pd = pd.DataFrame.from_dict(results_dict, orient='index') results_pd.to_csv(os.path.join(folder, 'model_selection_all.csv'))
[ 37811, 28980, 2196, 11, 787, 262, 2438, 4577, 290, 517, 953, 16823, 37227, 198, 2, 2896, 500, 262, 1388, 11383, 198, 198, 6738, 1257, 6359, 1330, 3650, 62, 14933, 10223, 198, 6738, 1257, 6359, 1330, 3440, 62, 14933, 10223, 198, 6738, 1257, 6359, 1330, 33836, 62, 73, 4666, 198, 11748, 28686, 198, 11748, 4818, 8079, 198, 11748, 640, 198, 11748, 19798, 292, 355, 279, 67, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 2603, 29487, 8019, 13, 9078, 29487, 355, 458, 83, 198, 2, 6738, 18540, 305, 919, 278, 1330, 19850, 198, 6738, 285, 14751, 9078, 1330, 4991, 198, 6738, 285, 14751, 9078, 1330, 9633, 198, 6738, 285, 14751, 9078, 1330, 4981, 62, 4666, 355, 4981, 198, 198, 6738, 629, 541, 88, 13, 40085, 1096, 1330, 12133, 62, 11147, 198, 6738, 629, 541, 88, 13, 75, 1292, 70, 1330, 1033, 76, 198, 6738, 299, 32152, 13, 75, 1292, 70, 1330, 800, 198, 6738, 1341, 35720, 13, 4164, 10466, 1330, 1612, 62, 16485, 1144, 62, 18224, 11, 374, 17, 62, 26675, 198, 198, 6738, 9756, 27530, 13, 70, 11549, 13, 912, 64, 489, 1747, 1330, 7110, 62, 33587, 69, 198, 6738, 9756, 27530, 13, 70, 11549, 13, 912, 64, 489, 1747, 1330, 7110, 62, 330, 69, 198, 198, 6738, 13942, 62, 14082, 62, 4666, 18, 1330, 3184, 25060, 198, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 220, 220, 198, 220, 220, 220, 220, 198, 220, 220, 220, 1303, 399, 3723, 21396, 329, 262, 18640, 198, 220, 220, 220, 2055, 796, 705, 4965, 35599, 20012, 15039, 62, 6335, 62, 17, 68, 3639, 6, 198, 220, 220, 220, 985, 62, 312, 796, 705, 9452, 36, 710, 6, 198, 220, 220, 220, 2746, 62, 312, 796, 705, 49, 17, 43538, 62, 14082, 6, 198, 220, 220, 220, 275, 335, 70, 62, 4868, 796, 3440, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 10786, 7753, 62, 6978, 62, 1462, 62, 43551, 3256, 705, 660, 6005, 62, 65, 335, 14542, 62, 8154, 498, 6, 4008, 198, 220, 220, 220, 198, 220, 220, 220, 275, 335, 70, 62, 9630, 62, 9688, 796, 657, 198, 220, 220, 220, 275, 335, 70, 62, 9630, 62, 437, 796, 1542, 198, 220, 220, 220, 220, 198, 220, 220, 220, 33836, 796, 657, 1303, 2295, 5039, 393, 407, 30, 198, 220, 220, 220, 1468, 62, 14323, 62, 17143, 796, 352, 1303, 17489, 4238, 44774, 198, 220, 220, 220, 220, 198, 220, 220, 220, 1303, 14674, 3689, 198, 220, 220, 220, 3128, 796, 705, 16, 14, 16, 14, 5539, 705, 198, 220, 220, 220, 923, 796, 705, 16, 14, 16, 14, 5539, 3571, 25, 405, 25, 405, 6, 198, 220, 220, 220, 886, 796, 705, 16, 14, 24, 14, 5539, 3571, 25, 405, 25, 405, 6, 198, 220, 220, 220, 220, 198, 220, 220, 220, 4512, 62, 9688, 796, 923, 198, 220, 220, 220, 4938, 62, 9688, 796, 705, 16, 14, 21, 14, 5539, 3571, 25, 405, 25, 405, 6, 198, 220, 220, 220, 4512, 62, 437, 796, 4938, 62, 9688, 198, 220, 220, 220, 4938, 62, 437, 796, 705, 16, 14, 24, 14, 5539, 3571, 25, 405, 25, 405, 6, 198, 220, 220, 220, 220, 198, 220, 220, 220, 2212, 62, 37687, 489, 796, 705, 6200, 6, 198, 220, 220, 220, 937, 796, 705, 13881, 6, 198, 220, 220, 220, 220, 198, 220, 220, 220, 9483, 796, 705, 6978, 62, 1462, 62, 7753, 6852, 43420, 62, 17597, 312, 62, 3605, 62, 6, 10, 2144, 198, 220, 220, 220, 220, 198, 220, 220, 220, 1303, 17571, 284, 779, 287, 3047, 198, 220, 220, 220, 409, 519, 796, 37250, 732, 64, 21016, 563, 33481, 62, 40850, 16, 3256, 705, 732, 64, 39, 38, 5439, 27991, 62, 40850, 16, 41707, 13434, 5377, 1050, 3256, 705, 13434, 5377, 1050, 62, 40850, 16, 3256, 705, 51, 62, 259, 62, 40850, 1485, 20520, 198, 220, 220, 220, 2496, 796, 705, 5603, 343, 6, 198, 220, 220, 220, 3033, 62, 11600, 796, 23884, 198, 220, 220, 220, 409, 519, 62, 4868, 796, 17635, 198, 220, 220, 220, 220, 198, 220, 220, 220, 474, 796, 657, 198, 220, 220, 220, 329, 2378, 287, 409, 519, 25, 198, 220, 220, 220, 220, 220, 220, 220, 409, 519, 62, 4868, 13, 33295, 7, 9186, 8, 198, 220, 220, 220, 220, 220, 220, 220, 773, 62, 1069, 519, 796, 2378, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 610, 796, 17635, 198, 220, 220, 220, 220, 220, 220, 220, 329, 1312, 287, 2837, 7, 20, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 610, 13, 33295, 10786, 51, 62, 259, 62, 40850, 6, 10, 2536, 7, 72, 10, 16, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3033, 62, 11600, 17816, 1503, 55, 62, 30909, 62, 6, 10, 2536, 7, 72, 10, 16, 47762, 6, 62, 1069, 519, 6, 10, 2536, 7, 73, 15437, 796, 409, 519, 62, 4868, 1343, 610, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3033, 62, 11600, 17816, 1503, 55, 62, 30909, 62, 6, 10, 2536, 7, 72, 10, 16, 47762, 6, 62, 6, 10, 521, 62, 1069, 519, 60, 796, 685, 521, 62, 1069, 519, 60, 1343, 610, 198, 220, 220, 220, 220, 220, 220, 220, 474, 15853, 352, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 1303, 24470, 9386, 13942, 198, 220, 220, 220, 3184, 62, 4868, 796, 17635, 198, 220, 220, 220, 1312, 796, 657, 198, 220, 220, 220, 329, 275, 335, 70, 287, 275, 335, 70, 62, 4868, 58, 65, 335, 70, 62, 9630, 62, 9688, 25, 65, 335, 70, 62, 9630, 62, 437, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 1312, 796, 1312, 10, 16, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 796, 3184, 25060, 7, 14323, 62, 9688, 796, 923, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 985, 62, 437, 796, 886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2212, 62, 37687, 489, 796, 2212, 62, 37687, 489, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 16894, 796, 275, 335, 70, 10, 6, 62, 6, 10, 19849, 62, 312, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 38353, 929, 776, 62, 368, 84, 796, 28686, 13, 6978, 13, 22179, 7, 8890, 13, 14323, 84, 62, 6978, 11, 705, 69, 14664, 3256, 2055, 11, 2055, 10, 6, 62, 6, 10, 65, 335, 70, 10, 6, 62, 6, 10, 65, 335, 70, 10, 6, 62, 5841, 1424, 62, 6, 10, 65, 335, 70, 10, 6, 62, 18102, 62, 3149, 66, 13, 69, 30300, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 38353, 929, 776, 62, 5420, 796, 28686, 13, 6978, 13, 22179, 7, 8890, 13, 14323, 84, 62, 6978, 11, 705, 69, 14664, 3256, 2055, 11, 2055, 10, 6, 62, 6, 10, 65, 335, 70, 10, 6, 62, 6, 10, 65, 335, 70, 10, 6, 62, 5841, 1424, 62, 6, 10, 65, 335, 70, 10, 6, 62, 18102, 62, 11901, 13, 69, 30300, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 5908, 10951, 62, 368, 84, 796, 357, 418, 13, 6978, 13, 22179, 7, 8890, 13, 4666, 62, 6978, 11, 2055, 11, 275, 335, 70, 11, 65, 335, 70, 10, 6, 62, 5841, 1424, 3256, 65, 335, 70, 10, 6, 62, 18102, 62, 3149, 66, 13, 5908, 33809, 220, 2055, 10, 6, 2637, 10, 65, 335, 70, 10, 6, 2637, 10, 65, 335, 70, 10, 6, 62, 5841, 1424, 2637, 10, 65, 335, 70, 10, 6, 62, 18102, 62, 3149, 66, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 23884, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 5908, 10951, 62, 368, 84, 62, 5420, 796, 357, 418, 13, 6978, 13, 22179, 7, 8890, 13, 4666, 62, 6978, 11, 2055, 11, 275, 335, 70, 11, 65, 335, 70, 10, 6, 62, 5841, 1424, 3256, 65, 335, 70, 10, 6, 62, 18102, 62, 11901, 13, 5908, 33809, 220, 220, 2055, 10, 6, 2637, 10, 65, 335, 70, 10, 6, 2637, 10, 65, 335, 70, 10, 6, 62, 5841, 1424, 2637, 10, 65, 335, 70, 10, 6, 62, 18102, 62, 11901, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 23884, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 611, 33836, 6624, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 20768, 786, 409, 27897, 1366, 4237, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1312, 6624, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 19119, 62, 23563, 7, 9688, 11, 886, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6376, 796, 279, 67, 13, 4475, 62, 9521, 7, 9688, 11, 886, 11, 2030, 80, 796, 2212, 62, 37687, 489, 10, 6, 50, 3256, 256, 89, 28, 8890, 13, 23563, 13, 22877, 62, 3672, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 23563, 796, 3184, 62, 4868, 58, 72, 12, 17, 4083, 23563, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8890, 13, 14323, 62, 9688, 28, 705, 16, 14, 16, 14, 5539, 3571, 25, 405, 6, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1136, 62, 13716, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8890, 13, 14323, 62, 9688, 28, 923, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1136, 62, 847, 62, 15414, 7, 9688, 11, 437, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1136, 62, 1102, 2536, 6003, 7, 9688, 11, 437, 11, 929, 67, 62, 13716, 28, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 17143, 62, 7753, 796, 28686, 13, 6978, 13, 22179, 7, 8890, 13, 14323, 84, 62, 6978, 4032, 6359, 14259, 41707, 48944, 62, 49, 17, 43538, 13, 40664, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1136, 62, 37266, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1312, 1875, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 13716, 796, 3184, 62, 4868, 58, 72, 12, 17, 4083, 13716, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 17597, 312, 62, 13716, 62, 6, 10, 8890, 13, 16894, 10, 6, 62, 6, 10, 2144, 828, 3184, 13, 13716, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 17597, 312, 62, 13716, 62, 6, 10, 8890, 13, 16894, 10, 6, 62, 6, 10, 2144, 828, 3184, 13, 13716, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 20768, 786, 4981, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 15003, 62, 27530, 7, 1904, 62, 2724, 69, 28, 16, 11, 779, 62, 69, 30300, 62, 3149, 66, 28, 16, 11, 779, 62, 69, 30300, 62, 368, 84, 28, 16, 8, 1303, 5765, 329, 4238, 1710, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 284, 1351, 286, 27785, 198, 220, 220, 220, 220, 220, 220, 220, 3184, 62, 4868, 13, 33295, 7, 8890, 8, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 198, 220, 220, 220, 6376, 796, 279, 67, 13, 4475, 62, 9521, 7, 9688, 11, 886, 11, 2030, 80, 796, 2212, 62, 37687, 489, 10, 6, 50, 11537, 198, 220, 220, 220, 4512, 62, 11600, 796, 23884, 198, 220, 220, 220, 1332, 62, 11600, 796, 23884, 198, 220, 220, 220, 220, 198, 220, 220, 220, 2482, 62, 11600, 796, 23884, 198, 220, 220, 220, 220, 198, 220, 220, 220, 329, 3184, 287, 3184, 62, 4868, 25, 198, 220, 220, 220, 220, 220, 220, 220, 611, 33836, 6624, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2295, 17660, 220, 284, 651, 1366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 33836, 62, 73, 4666, 7, 8890, 13, 368, 84, 11, 3184, 13, 1326, 292, 62, 85, 945, 62, 368, 84, 11, 3184, 13, 1326, 292, 62, 37687, 489, 11, 923, 11, 886, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 33141, 1366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 8890, 13, 368, 84, 13, 13812, 62, 1326, 5015, 902, 10786, 5308, 34006, 6, 4008, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 13871, 796, 3184, 13, 368, 84, 13, 13812, 62, 1326, 5015, 902, 10786, 5308, 34006, 11537, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6376, 796, 279, 67, 13, 1462, 62, 19608, 8079, 7, 1326, 5015, 902, 13, 9630, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 13871, 13, 9630, 796, 6376, 220, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6193, 796, 3184, 13, 23563, 13, 13812, 62, 7890, 22446, 411, 1403, 7, 1326, 292, 62, 37687, 489, 10, 6, 50, 27691, 487, 359, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 4798, 7, 23563, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6193, 13, 9630, 796, 6376, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 796, 279, 67, 13, 1102, 9246, 26933, 1326, 5015, 902, 11, 6193, 4357, 22704, 28, 16, 38381, 9688, 25, 437, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 13434, 5377, 1050, 20520, 796, 47764, 17816, 13434, 5377, 1050, 20520, 14, 12825, 13, 15, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 5603, 343, 20520, 796, 47764, 17816, 5603, 343, 20520, 12, 27367, 13, 1314, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 329, 474, 287, 2837, 7, 16, 11, 1238, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 51, 62, 259, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 5603, 343, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 13434, 5377, 1050, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 13434, 5377, 1050, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 732, 64, 21016, 563, 33481, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 732, 64, 21016, 563, 33481, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 796, 47764, 13, 20797, 2616, 7, 24396, 11639, 19881, 359, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17220, 262, 300, 3775, 422, 262, 3726, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4512, 62, 9688, 796, 4818, 8079, 13, 19608, 8079, 13, 2536, 457, 524, 7, 9688, 11, 705, 4, 76, 14, 4, 67, 14, 4, 56, 4064, 39, 25, 4, 44, 25, 4, 50, 11537, 1343, 4818, 8079, 13, 16514, 276, 12514, 7, 43012, 796, 838, 9, 22468, 7, 1326, 292, 62, 37687, 489, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 27758, 262, 27039, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 62, 27432, 796, 47764, 58, 27432, 62, 9688, 25, 27432, 62, 437, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 62, 9288, 796, 47764, 58, 12102, 62, 9688, 25, 12102, 62, 437, 60, 198, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4512, 62, 11600, 58, 65, 335, 70, 60, 796, 47764, 62, 27432, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1332, 62, 11600, 58, 65, 335, 70, 60, 796, 47764, 62, 9288, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 439, 62, 7890, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 47764, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 27432, 62, 7890, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 47764, 62, 27432, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 9288, 62, 7890, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 47764, 62, 9288, 8, 628, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 796, 3440, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 10786, 43420, 62, 17597, 312, 62, 9288, 62, 6, 10, 2144, 11, 705, 439, 62, 7890, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17220, 262, 300, 3775, 422, 262, 3726, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 27432, 62, 9688, 796, 923, 13, 2536, 31387, 10786, 4, 76, 14, 4, 67, 14, 4, 56, 4064, 39, 25, 4, 44, 25, 4, 50, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4512, 62, 9688, 796, 4818, 8079, 13, 19608, 8079, 13, 2536, 457, 524, 7, 9688, 11, 705, 4, 76, 14, 4, 67, 14, 4, 56, 4064, 39, 25, 4, 44, 25, 4, 50, 11537, 1343, 4818, 8079, 13, 16514, 276, 12514, 7, 43012, 796, 838, 9, 22468, 7, 1326, 292, 62, 37687, 489, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 329, 474, 287, 2837, 7, 16, 11, 1238, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 51, 62, 259, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 5603, 343, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 13434, 5377, 1050, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 13434, 5377, 1050, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 732, 64, 21016, 563, 33481, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 732, 64, 21016, 563, 33481, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 17816, 732, 64, 39, 38, 5439, 27991, 62, 40850, 6, 10, 2536, 7, 73, 15437, 796, 47764, 17816, 732, 64, 39, 38, 5439, 27991, 6, 4083, 30846, 7, 41007, 82, 28, 73, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 796, 47764, 13, 20797, 2616, 7, 24396, 11639, 19881, 359, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 27758, 262, 27039, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 62, 27432, 796, 47764, 58, 27432, 62, 9688, 25, 27432, 62, 437, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47764, 62, 9288, 796, 47764, 58, 12102, 62, 9688, 25, 12102, 62, 437, 60, 198, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4512, 62, 11600, 58, 65, 335, 70, 60, 796, 47764, 62, 27432, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1332, 62, 11600, 58, 65, 335, 70, 60, 796, 47764, 62, 9288, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 27432, 62, 7890, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 47764, 62, 27432, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 9288, 62, 7890, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 47764, 62, 9288, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 4798, 7, 7568, 62, 27432, 17816, 732, 64, 21016, 563, 33481, 6, 12962, 628, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 705, 7061, 33234, 1958, 10007, 705, 7061, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 4512, 62, 7890, 796, 47764, 62, 27432, 628, 220, 220, 220, 220, 220, 220, 220, 1312, 796, 657, 198, 220, 220, 220, 220, 220, 220, 220, 329, 1339, 287, 3033, 62, 11600, 13, 13083, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 981, 6407, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3033, 796, 3033, 62, 11600, 58, 7442, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 35664, 796, 3033, 1343, 685, 16793, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 15003, 62, 1503, 55, 62, 19849, 7, 40890, 11, 2496, 11, 4512, 62, 7890, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1503, 55, 62, 19849, 13, 49786, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6889, 617, 16277, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1332, 62, 87, 796, 47764, 62, 27432, 58, 40890, 4083, 27160, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1503, 55, 62, 19849, 13, 79, 17407, 7, 9288, 62, 87, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2747, 82, 796, 3184, 13, 1503, 55, 62, 19849, 13, 28764, 9278, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 407, 28686, 13, 6978, 13, 1069, 1023, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 7442, 8, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28686, 13, 76, 4335, 17062, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 7442, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 1339, 11, 705, 17597, 312, 62, 1503, 55, 19849, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 3184, 13, 1503, 55, 62, 19849, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 1339, 11, 705, 17597, 312, 62, 1503, 55, 37266, 62, 43420, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 37266, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 1339, 11, 705, 17597, 312, 62, 1503, 55, 37266, 62, 2389, 28764, 82, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 2747, 82, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 60, 796, 23884, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 32, 2149, 20520, 796, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 18452, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 33, 2149, 20520, 796, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 65, 291, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 44, 5188, 12, 23350, 20520, 796, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 76, 325, 62, 23350, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 44, 5188, 12, 19849, 20520, 796, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 76, 325, 62, 19849, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 44, 5188, 12, 411, 312, 20520, 796, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 76, 325, 62, 411, 312, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 49, 17, 12, 2389, 20520, 796, 3184, 13, 1503, 55, 62, 19849, 13, 11147, 62, 43420, 13, 3808, 421, 1144, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 7061, 7762, 20540, 7061, 6, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6889, 617, 16277, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1332, 62, 87, 796, 47764, 62, 9288, 58, 40890, 4083, 27160, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3184, 13, 1503, 55, 62, 19849, 13, 79, 17407, 7, 9288, 62, 87, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2747, 82, 796, 3184, 13, 1503, 55, 62, 19849, 13, 28764, 9278, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 285, 325, 796, 1612, 62, 16485, 1144, 62, 18224, 7, 7568, 62, 9288, 17816, 5603, 343, 6, 4083, 27160, 11, 2747, 82, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 374, 26675, 796, 374, 17, 62, 26675, 7, 7568, 62, 9288, 17816, 5603, 343, 6, 4083, 27160, 11, 2747, 82, 8, 198, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 5308, 272, 44345, 4049, 532, 21201, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 32604, 62, 16485, 1144, 62, 18224, 7, 7568, 62, 9288, 17816, 5603, 343, 6, 4083, 27160, 11, 2747, 82, 4008, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 49, 61, 17, 4776, 532, 21201, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 81, 17, 62, 26675, 7, 7568, 62, 9288, 17816, 5603, 343, 6, 4083, 27160, 11, 2747, 82, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 44, 5188, 12, 19849, 12, 12102, 20520, 796, 285, 325, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2482, 62, 11600, 58, 7442, 10, 6, 62, 6, 10, 8890, 13, 16894, 7131, 6, 49, 17, 12, 12102, 20520, 796, 374, 26675, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 1339, 11, 705, 17597, 312, 62, 1503, 55, 37266, 62, 12102, 28764, 82, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 2747, 82, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 1339, 11, 705, 17597, 312, 62, 1503, 55, 37266, 62, 12102, 44, 5188, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 285, 325, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3650, 62, 14933, 10223, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 1339, 11, 705, 17597, 312, 62, 1503, 55, 37266, 62, 12102, 49, 17, 62, 6, 10, 2144, 10, 6, 62, 6, 10, 8890, 13, 16894, 828, 374, 26675, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 36917, 36917, 36917, 36917, 16626, 22738, 11, 2111, 757, 0, 4064, 36917, 36917, 36917, 36917, 36917, 4, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 198, 220, 220, 220, 2482, 62, 30094, 796, 279, 67, 13, 6601, 19778, 13, 6738, 62, 11600, 7, 43420, 62, 11600, 11, 11367, 11639, 9630, 11537, 198, 220, 220, 220, 2482, 62, 30094, 13, 1462, 62, 40664, 7, 418, 13, 6978, 13, 22179, 7, 43551, 11, 705, 19849, 62, 49283, 62, 439, 13, 40664, 6, 4008, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 628 ]
1.811902
6,167
# Generated by Django 3.2.3 on 2021-06-02 14:44 from typing import List, Tuple from django.db import migrations, models
[ 2, 2980, 515, 416, 37770, 513, 13, 17, 13, 18, 319, 33448, 12, 3312, 12, 2999, 1478, 25, 2598, 198, 6738, 19720, 1330, 7343, 11, 309, 29291, 198, 198, 6738, 42625, 14208, 13, 9945, 1330, 15720, 602, 11, 4981, 628 ]
3.05
40
# coding: utf-8 # # Copyright 2019 Amazon.com, Inc. or its affiliates. All Rights Reserved. # # Licensed under the Apache License, Version 2.0 (the "License"). You may not use this file # except in compliance with the License. A copy of the License is located at # # http://aws.amazon.com/apache2.0/ # # or in the "license" file accompanying this file. This file is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for # the specific language governing permissions and limitations under the License. # import pprint import re # noqa: F401 import six import typing from enum import Enum if typing.TYPE_CHECKING: from typing import Dict, List, Optional, Union from datetime import datetime from ask_smapi_model.v1.skill.manifest.distribution_countries import DistributionCountriesV1 from ask_smapi_model.v1.skill.manifest.skill_manifest_localized_publishing_information import SkillManifestLocalizedPublishingInformationV1 from ask_smapi_model.v1.skill.manifest.distribution_mode import DistributionModeV1 from ask_smapi_model.v1.skill.manifest.manifest_gadget_support import ManifestGadgetSupportV1 class SkillManifestPublishingInformation(object): """ Defines the structure for publishing information in the skill manifest. :param name: Name of the skill that is displayed to customers in the Alexa app. :type name: (optional) str :param description: Description of the skill&#39;s purpose and feature and how it works. Should describe any prerequisites like hardware or account requirements and detailed steps for the customer to get started. For Flash Briefing skill list the feeds offered within the skill. Use a conversational tone and correct grammar and punctuation. This description displays to customers on the skill detail card in the Alexa app. :type description: (optional) str :param locales: Defines the structure for locale specific publishing information in the skill manifest. :type locales: (optional) dict(str, ask_smapi_model.v1.skill.manifest.skill_manifest_localized_publishing_information.SkillManifestLocalizedPublishingInformation) :param is_available_worldwide: True if the skill should be distributed in all countries where Amazon distributes skill false otherwise. :type is_available_worldwide: (optional) bool :param distribution_mode: :type distribution_mode: (optional) ask_smapi_model.v1.skill.manifest.distribution_mode.DistributionMode :param gadget_support: :type gadget_support: (optional) ask_smapi_model.v1.skill.manifest.manifest_gadget_support.ManifestGadgetSupport :param testing_instructions: Special instructions provided by the developer to test the skill. :type testing_instructions: (optional) str :param category: Category that best describes a skill. Indicates the filter category for the skill in the Alexa App. :type category: (optional) str :param distribution_countries: Selected list of countries provided by the skill owner where Amazon can distribute the skill. :type distribution_countries: (optional) list[ask_smapi_model.v1.skill.manifest.distribution_countries.DistributionCountries] """ deserialized_types = { 'name': 'str', 'description': 'str', 'locales': 'dict(str, ask_smapi_model.v1.skill.manifest.skill_manifest_localized_publishing_information.SkillManifestLocalizedPublishingInformation)', 'is_available_worldwide': 'bool', 'distribution_mode': 'ask_smapi_model.v1.skill.manifest.distribution_mode.DistributionMode', 'gadget_support': 'ask_smapi_model.v1.skill.manifest.manifest_gadget_support.ManifestGadgetSupport', 'testing_instructions': 'str', 'category': 'str', 'distribution_countries': 'list[ask_smapi_model.v1.skill.manifest.distribution_countries.DistributionCountries]' } # type: Dict attribute_map = { 'name': 'name', 'description': 'description', 'locales': 'locales', 'is_available_worldwide': 'isAvailableWorldwide', 'distribution_mode': 'distributionMode', 'gadget_support': 'gadgetSupport', 'testing_instructions': 'testingInstructions', 'category': 'category', 'distribution_countries': 'distributionCountries' } # type: Dict supports_multiple_types = False def __init__(self, name=None, description=None, locales=None, is_available_worldwide=None, distribution_mode=None, gadget_support=None, testing_instructions=None, category=None, distribution_countries=None): # type: (Optional[str], Optional[str], Optional[Dict[str, SkillManifestLocalizedPublishingInformationV1]], Optional[bool], Optional[DistributionModeV1], Optional[ManifestGadgetSupportV1], Optional[str], Optional[str], Optional[List[DistributionCountriesV1]]) -> None """Defines the structure for publishing information in the skill manifest. :param name: Name of the skill that is displayed to customers in the Alexa app. :type name: (optional) str :param description: Description of the skill&#39;s purpose and feature and how it works. Should describe any prerequisites like hardware or account requirements and detailed steps for the customer to get started. For Flash Briefing skill list the feeds offered within the skill. Use a conversational tone and correct grammar and punctuation. This description displays to customers on the skill detail card in the Alexa app. :type description: (optional) str :param locales: Defines the structure for locale specific publishing information in the skill manifest. :type locales: (optional) dict(str, ask_smapi_model.v1.skill.manifest.skill_manifest_localized_publishing_information.SkillManifestLocalizedPublishingInformation) :param is_available_worldwide: True if the skill should be distributed in all countries where Amazon distributes skill false otherwise. :type is_available_worldwide: (optional) bool :param distribution_mode: :type distribution_mode: (optional) ask_smapi_model.v1.skill.manifest.distribution_mode.DistributionMode :param gadget_support: :type gadget_support: (optional) ask_smapi_model.v1.skill.manifest.manifest_gadget_support.ManifestGadgetSupport :param testing_instructions: Special instructions provided by the developer to test the skill. :type testing_instructions: (optional) str :param category: Category that best describes a skill. Indicates the filter category for the skill in the Alexa App. :type category: (optional) str :param distribution_countries: Selected list of countries provided by the skill owner where Amazon can distribute the skill. :type distribution_countries: (optional) list[ask_smapi_model.v1.skill.manifest.distribution_countries.DistributionCountries] """ self.__discriminator_value = None # type: str self.name = name self.description = description self.locales = locales self.is_available_worldwide = is_available_worldwide self.distribution_mode = distribution_mode self.gadget_support = gadget_support self.testing_instructions = testing_instructions self.category = category self.distribution_countries = distribution_countries def to_dict(self): # type: () -> Dict[str, object] """Returns the model properties as a dict""" result = {} # type: Dict for attr, _ in six.iteritems(self.deserialized_types): value = getattr(self, attr) if isinstance(value, list): result[attr] = list(map( lambda x: x.to_dict() if hasattr(x, "to_dict") else x.value if isinstance(x, Enum) else x, value )) elif isinstance(value, Enum): result[attr] = value.value elif hasattr(value, "to_dict"): result[attr] = value.to_dict() elif isinstance(value, dict): result[attr] = dict(map( lambda item: (item[0], item[1].to_dict()) if hasattr(item[1], "to_dict") else (item[0], item[1].value) if isinstance(item[1], Enum) else item, value.items() )) else: result[attr] = value return result def to_str(self): # type: () -> str """Returns the string representation of the model""" return pprint.pformat(self.to_dict()) def __repr__(self): # type: () -> str """For `print` and `pprint`""" return self.to_str() def __eq__(self, other): # type: (object) -> bool """Returns true if both objects are equal""" if not isinstance(other, SkillManifestPublishingInformation): return False return self.__dict__ == other.__dict__ def __ne__(self, other): # type: (object) -> bool """Returns true if both objects are not equal""" return not self == other
[ 2, 19617, 25, 3384, 69, 12, 23, 198, 198, 2, 198, 2, 15069, 13130, 6186, 13, 785, 11, 3457, 13, 393, 663, 29116, 13, 1439, 6923, 33876, 13, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 11074, 921, 743, 407, 779, 428, 2393, 198, 2, 2845, 287, 11846, 351, 262, 13789, 13, 317, 4866, 286, 262, 13789, 318, 5140, 379, 198, 2, 198, 2, 2638, 1378, 8356, 13, 33103, 13, 785, 14, 43073, 17, 13, 15, 14, 198, 2, 198, 2, 393, 287, 262, 366, 43085, 1, 2393, 19249, 428, 2393, 13, 770, 2393, 318, 9387, 319, 281, 366, 1921, 3180, 1, 29809, 1797, 11, 198, 2, 42881, 34764, 11015, 6375, 7102, 49828, 11053, 3963, 15529, 509, 12115, 11, 2035, 4911, 393, 17142, 13, 4091, 262, 13789, 329, 198, 2, 262, 2176, 3303, 15030, 21627, 290, 11247, 739, 262, 13789, 13, 198, 2, 198, 198, 11748, 279, 4798, 198, 11748, 302, 220, 1303, 645, 20402, 25, 376, 21844, 198, 11748, 2237, 198, 11748, 19720, 198, 6738, 33829, 1330, 2039, 388, 628, 198, 361, 19720, 13, 25216, 62, 50084, 2751, 25, 198, 220, 220, 220, 422, 19720, 1330, 360, 713, 11, 7343, 11, 32233, 11, 4479, 198, 220, 220, 220, 422, 4818, 8079, 1330, 4818, 8079, 198, 220, 220, 220, 422, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 9127, 1678, 1330, 27484, 12332, 1678, 53, 16, 198, 220, 220, 220, 422, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 42401, 62, 805, 8409, 62, 12001, 1143, 62, 12984, 20020, 62, 17018, 1330, 16023, 5124, 8409, 14565, 1143, 14876, 20020, 21918, 53, 16, 198, 220, 220, 220, 422, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 14171, 1330, 27484, 19076, 53, 16, 198, 220, 220, 220, 422, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 805, 8409, 62, 70, 324, 1136, 62, 11284, 1330, 36757, 38, 324, 1136, 15514, 53, 16, 628, 198, 4871, 16023, 5124, 8409, 14876, 20020, 21918, 7, 15252, 2599, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 2896, 1127, 262, 4645, 329, 12407, 1321, 287, 262, 5032, 10561, 13, 628, 198, 220, 220, 220, 1058, 17143, 1438, 25, 6530, 286, 262, 5032, 326, 318, 9066, 284, 4297, 287, 262, 34630, 598, 13, 198, 220, 220, 220, 1058, 4906, 1438, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 1058, 17143, 6764, 25, 12489, 286, 262, 5032, 5, 2, 2670, 26, 82, 4007, 290, 3895, 290, 703, 340, 2499, 13, 10358, 6901, 597, 662, 34075, 588, 6890, 393, 1848, 5359, 290, 6496, 4831, 329, 262, 6491, 284, 651, 2067, 13, 1114, 9973, 22821, 278, 5032, 1351, 262, 21318, 4438, 1626, 262, 5032, 13, 5765, 257, 3453, 864, 8216, 290, 3376, 23491, 290, 21025, 2288, 13, 770, 6764, 11298, 284, 4297, 319, 262, 5032, 3703, 2657, 287, 262, 34630, 598, 13, 198, 220, 220, 220, 1058, 4906, 6764, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 1058, 17143, 1957, 274, 25, 2896, 1127, 262, 4645, 329, 36693, 2176, 12407, 1321, 287, 262, 5032, 10561, 13, 198, 220, 220, 220, 1058, 4906, 1957, 274, 25, 357, 25968, 8, 8633, 7, 2536, 11, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 42401, 62, 805, 8409, 62, 12001, 1143, 62, 12984, 20020, 62, 17018, 13, 35040, 5124, 8409, 14565, 1143, 14876, 20020, 21918, 8, 198, 220, 220, 220, 1058, 17143, 318, 62, 15182, 62, 6894, 4421, 25, 6407, 611, 262, 5032, 815, 307, 9387, 287, 477, 2678, 810, 6186, 1233, 7657, 5032, 3991, 4306, 13, 198, 220, 220, 220, 1058, 4906, 318, 62, 15182, 62, 6894, 4421, 25, 357, 25968, 8, 20512, 198, 220, 220, 220, 1058, 17143, 6082, 62, 14171, 25, 220, 198, 220, 220, 220, 1058, 4906, 6082, 62, 14171, 25, 357, 25968, 8, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 14171, 13, 20344, 3890, 19076, 198, 220, 220, 220, 1058, 17143, 42892, 62, 11284, 25, 220, 198, 220, 220, 220, 1058, 4906, 42892, 62, 11284, 25, 357, 25968, 8, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 805, 8409, 62, 70, 324, 1136, 62, 11284, 13, 5124, 8409, 38, 324, 1136, 15514, 198, 220, 220, 220, 1058, 17143, 4856, 62, 259, 7249, 507, 25, 6093, 7729, 2810, 416, 262, 8517, 284, 1332, 262, 5032, 13, 198, 220, 220, 220, 1058, 4906, 4856, 62, 259, 7249, 507, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 1058, 17143, 6536, 25, 21743, 326, 1266, 8477, 257, 5032, 13, 1423, 16856, 262, 8106, 6536, 329, 262, 5032, 287, 262, 34630, 2034, 13, 198, 220, 220, 220, 1058, 4906, 6536, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 1058, 17143, 6082, 62, 9127, 1678, 25, 41344, 1351, 286, 2678, 2810, 416, 262, 5032, 4870, 810, 6186, 460, 14983, 262, 5032, 13, 198, 220, 220, 220, 1058, 4906, 6082, 62, 9127, 1678, 25, 357, 25968, 8, 1351, 58, 2093, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 9127, 1678, 13, 20344, 3890, 12332, 1678, 60, 628, 220, 220, 220, 37227, 198, 220, 220, 220, 748, 48499, 1143, 62, 19199, 796, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 705, 3672, 10354, 705, 2536, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 11213, 10354, 705, 2536, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 17946, 2040, 10354, 705, 11600, 7, 2536, 11, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 42401, 62, 805, 8409, 62, 12001, 1143, 62, 12984, 20020, 62, 17018, 13, 35040, 5124, 8409, 14565, 1143, 14876, 20020, 21918, 8, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 271, 62, 15182, 62, 6894, 4421, 10354, 705, 30388, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 17080, 3890, 62, 14171, 10354, 705, 2093, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 14171, 13, 20344, 3890, 19076, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 70, 324, 1136, 62, 11284, 10354, 705, 2093, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 805, 8409, 62, 70, 324, 1136, 62, 11284, 13, 5124, 8409, 38, 324, 1136, 15514, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 33407, 62, 259, 7249, 507, 10354, 705, 2536, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 22872, 10354, 705, 2536, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 17080, 3890, 62, 9127, 1678, 10354, 705, 4868, 58, 2093, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 9127, 1678, 13, 20344, 3890, 12332, 1678, 49946, 198, 220, 220, 220, 1782, 220, 1303, 2099, 25, 360, 713, 628, 220, 220, 220, 11688, 62, 8899, 796, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 705, 3672, 10354, 705, 3672, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 11213, 10354, 705, 11213, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 17946, 2040, 10354, 705, 17946, 2040, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 271, 62, 15182, 62, 6894, 4421, 10354, 705, 271, 10493, 10603, 4421, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 17080, 3890, 62, 14171, 10354, 705, 17080, 3890, 19076, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 70, 324, 1136, 62, 11284, 10354, 705, 70, 324, 1136, 15514, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 33407, 62, 259, 7249, 507, 10354, 705, 33407, 43993, 507, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 22872, 10354, 705, 22872, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 17080, 3890, 62, 9127, 1678, 10354, 705, 17080, 3890, 12332, 1678, 6, 198, 220, 220, 220, 1782, 220, 1303, 2099, 25, 360, 713, 198, 220, 220, 220, 6971, 62, 48101, 62, 19199, 796, 10352, 628, 220, 220, 220, 825, 11593, 15003, 834, 7, 944, 11, 1438, 28, 14202, 11, 6764, 28, 14202, 11, 1957, 274, 28, 14202, 11, 318, 62, 15182, 62, 6894, 4421, 28, 14202, 11, 6082, 62, 14171, 28, 14202, 11, 42892, 62, 11284, 28, 14202, 11, 4856, 62, 259, 7249, 507, 28, 14202, 11, 6536, 28, 14202, 11, 6082, 62, 9127, 1678, 28, 14202, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2099, 25, 357, 30719, 58, 2536, 4357, 32233, 58, 2536, 4357, 32233, 58, 35, 713, 58, 2536, 11, 16023, 5124, 8409, 14565, 1143, 14876, 20020, 21918, 53, 16, 60, 4357, 32233, 58, 30388, 4357, 32233, 58, 20344, 3890, 19076, 53, 16, 4357, 32233, 58, 5124, 8409, 38, 324, 1136, 15514, 53, 16, 4357, 32233, 58, 2536, 4357, 32233, 58, 2536, 4357, 32233, 58, 8053, 58, 20344, 3890, 12332, 1678, 53, 16, 11907, 8, 4613, 6045, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 7469, 1127, 262, 4645, 329, 12407, 1321, 287, 262, 5032, 10561, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 1438, 25, 6530, 286, 262, 5032, 326, 318, 9066, 284, 4297, 287, 262, 34630, 598, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 1438, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 6764, 25, 12489, 286, 262, 5032, 5, 2, 2670, 26, 82, 4007, 290, 3895, 290, 703, 340, 2499, 13, 10358, 6901, 597, 662, 34075, 588, 6890, 393, 1848, 5359, 290, 6496, 4831, 329, 262, 6491, 284, 651, 2067, 13, 1114, 9973, 22821, 278, 5032, 1351, 262, 21318, 4438, 1626, 262, 5032, 13, 5765, 257, 3453, 864, 8216, 290, 3376, 23491, 290, 21025, 2288, 13, 770, 6764, 11298, 284, 4297, 319, 262, 5032, 3703, 2657, 287, 262, 34630, 598, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 6764, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 1957, 274, 25, 2896, 1127, 262, 4645, 329, 36693, 2176, 12407, 1321, 287, 262, 5032, 10561, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 1957, 274, 25, 357, 25968, 8, 8633, 7, 2536, 11, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 42401, 62, 805, 8409, 62, 12001, 1143, 62, 12984, 20020, 62, 17018, 13, 35040, 5124, 8409, 14565, 1143, 14876, 20020, 21918, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 318, 62, 15182, 62, 6894, 4421, 25, 6407, 611, 262, 5032, 815, 307, 9387, 287, 477, 2678, 810, 6186, 1233, 7657, 5032, 3991, 4306, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 318, 62, 15182, 62, 6894, 4421, 25, 357, 25968, 8, 20512, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 6082, 62, 14171, 25, 220, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 6082, 62, 14171, 25, 357, 25968, 8, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 14171, 13, 20344, 3890, 19076, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 42892, 62, 11284, 25, 220, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 42892, 62, 11284, 25, 357, 25968, 8, 1265, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 805, 8409, 62, 70, 324, 1136, 62, 11284, 13, 5124, 8409, 38, 324, 1136, 15514, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 4856, 62, 259, 7249, 507, 25, 6093, 7729, 2810, 416, 262, 8517, 284, 1332, 262, 5032, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 4856, 62, 259, 7249, 507, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 6536, 25, 21743, 326, 1266, 8477, 257, 5032, 13, 1423, 16856, 262, 8106, 6536, 329, 262, 5032, 287, 262, 34630, 2034, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 6536, 25, 357, 25968, 8, 965, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 17143, 6082, 62, 9127, 1678, 25, 41344, 1351, 286, 2678, 2810, 416, 262, 5032, 4870, 810, 6186, 460, 14983, 262, 5032, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1058, 4906, 6082, 62, 9127, 1678, 25, 357, 25968, 8, 1351, 58, 2093, 62, 5796, 15042, 62, 19849, 13, 85, 16, 13, 42401, 13, 805, 8409, 13, 17080, 3890, 62, 9127, 1678, 13, 20344, 3890, 12332, 1678, 60, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 834, 15410, 3036, 20900, 62, 8367, 796, 6045, 220, 1303, 2099, 25, 965, 628, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 3672, 796, 1438, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 11213, 796, 6764, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 17946, 2040, 796, 1957, 274, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 271, 62, 15182, 62, 6894, 4421, 796, 318, 62, 15182, 62, 6894, 4421, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 17080, 3890, 62, 14171, 796, 6082, 62, 14171, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 70, 324, 1136, 62, 11284, 796, 42892, 62, 11284, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 33407, 62, 259, 7249, 507, 796, 4856, 62, 259, 7249, 507, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 22872, 796, 6536, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 17080, 3890, 62, 9127, 1678, 796, 6082, 62, 9127, 1678, 628, 220, 220, 220, 825, 284, 62, 11600, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2099, 25, 7499, 4613, 360, 713, 58, 2536, 11, 2134, 60, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 35561, 262, 2746, 6608, 355, 257, 8633, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 1255, 796, 23884, 220, 1303, 2099, 25, 360, 713, 628, 220, 220, 220, 220, 220, 220, 220, 329, 708, 81, 11, 4808, 287, 2237, 13, 2676, 23814, 7, 944, 13, 8906, 48499, 1143, 62, 19199, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 796, 651, 35226, 7, 944, 11, 708, 81, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 318, 39098, 7, 8367, 11, 1351, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1255, 58, 35226, 60, 796, 1351, 7, 8899, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 2124, 25, 2124, 13, 1462, 62, 11600, 3419, 611, 468, 35226, 7, 87, 11, 366, 1462, 62, 11600, 4943, 2073, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2124, 13, 8367, 611, 318, 39098, 7, 87, 11, 2039, 388, 8, 2073, 2124, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 318, 39098, 7, 8367, 11, 2039, 388, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1255, 58, 35226, 60, 796, 1988, 13, 8367, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 468, 35226, 7, 8367, 11, 366, 1462, 62, 11600, 1, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1255, 58, 35226, 60, 796, 1988, 13, 1462, 62, 11600, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 318, 39098, 7, 8367, 11, 8633, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1255, 58, 35226, 60, 796, 8633, 7, 8899, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 2378, 25, 357, 9186, 58, 15, 4357, 2378, 58, 16, 4083, 1462, 62, 11600, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 468, 35226, 7, 9186, 58, 16, 4357, 366, 1462, 62, 11600, 4943, 2073, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 357, 9186, 58, 15, 4357, 2378, 58, 16, 4083, 8367, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 318, 39098, 7, 9186, 58, 16, 4357, 2039, 388, 8, 2073, 2378, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 13, 23814, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1255, 58, 35226, 60, 796, 1988, 628, 220, 220, 220, 220, 220, 220, 220, 1441, 1255, 628, 220, 220, 220, 825, 284, 62, 2536, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2099, 25, 7499, 4613, 965, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 35561, 262, 4731, 10552, 286, 262, 2746, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 279, 4798, 13, 79, 18982, 7, 944, 13, 1462, 62, 11600, 28955, 628, 220, 220, 220, 825, 11593, 260, 1050, 834, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2099, 25, 7499, 4613, 965, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 1890, 4600, 4798, 63, 290, 4600, 381, 22272, 63, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 1462, 62, 2536, 3419, 628, 220, 220, 220, 825, 11593, 27363, 834, 7, 944, 11, 584, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2099, 25, 357, 15252, 8, 4613, 20512, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 35561, 2081, 611, 1111, 5563, 389, 4961, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 318, 39098, 7, 847, 11, 16023, 5124, 8409, 14876, 20020, 21918, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 10352, 628, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 834, 11600, 834, 6624, 584, 13, 834, 11600, 834, 628, 220, 220, 220, 825, 11593, 710, 834, 7, 944, 11, 584, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2099, 25, 357, 15252, 8, 4613, 20512, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 35561, 2081, 611, 1111, 5563, 389, 407, 4961, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 407, 2116, 6624, 584, 198 ]
2.85396
3,232
import xquantum as xq import math from qiskit.circuit.library.standard_gates import RYGate from qiskit import QuantumCircuit, execute, Aer, IBMQ # https://algassert.com/quirk#circuit={%22cols%22:[[1,{%22id%22:%22Ryft%22,%22arg%22:%221.982313%22}],[],[{%22id%22:%22Ryft%22,%22arg%22:%221.714144%22},%22%E2%80%A2%22],[],[{%22id%22:%22Ryft%22,%22arg%22:%221.910633%22},%22%E2%97%A6%22],[],[%22Amps2%22],[],[1,1,%22H%22],[%22%E2%80%A2%22,%22X%22,%22%E2%80%A2%22],[{%22id%22:%22Ryft%22,%22arg%22:%22pi/2%22},1,%22%E2%80%A2%22],[%22%E2%80%A2%22,%22X%22,%22%E2%80%A2%22],[%22X%22,%22%E2%80%A2%22,%22%E2%80%A2%22],[1,{%22id%22:%22Ryft%22,%22arg%22:%22pi/3%22},%22%E2%80%A2%22],[%22X%22,%22%E2%80%A2%22,%22%E2%80%A2%22],[{%22id%22:%22Ryft%22,%22arg%22:%22pi/4%22},1,%22%E2%80%A2%22],[%22Z%22,1,%22%E2%80%A2%22],[1,1,%22X%22],[%22%E2%80%A2%22,%22X%22,%22%E2%80%A2%22],[{%22id%22:%22Ryft%22,%22arg%22:%22pi/2+pi%22},1,%22%E2%80%A2%22],[],[%22%E2%80%A2%22,%22X%22,%22%E2%80%A2%22],[%22X%22,%22%E2%80%A2%22,%22%E2%80%A2%22],[1,{%22id%22:%22Ryft%22,%22arg%22:%22pi/3%22},%22%E2%80%A2%22],[%22X%22,%22%E2%80%A2%22,%22%E2%80%A2%22],[{%22id%22:%22Ryft%22,%22arg%22:%22pi/4%22},1,%22%E2%80%A2%22],[1,1,%22X%22],[1,1,%22H%22],[%22Density%22,%22Density%22,%22Density%22]],%22init%22:[0,0,1]} # https://algassert.com/quirk#circuit={%22cols%22:[[1,{%22id%22:%22Ryft%22,%22arg%22:%221.982313%22}],[],[{%22id%22:%22Ryft%22,%22arg%22:%221.714144%22},%22%E2%80%A2%22],[],[{%22id%22:%22Ryft%22,%22arg%22:%221.910633%22},%22%E2%97%A6%22],[],[%22Amps2%22],[],[%22%E2%80%A2%22,%22X%22],[{%22id%22:%22Ryft%22,%22arg%22:%22pi/2%22}],[%22%E2%80%A2%22,%22X%22],[%22X%22,%22%E2%80%A2%22],[1,{%22id%22:%22Ryft%22,%22arg%22:%22pi/3%22}],[%22X%22,%22%E2%80%A2%22],[{%22id%22:%22Ryft%22,%22arg%22:%22pi/4%22}],[%22Amps2%22]]}
[ 11748, 2124, 40972, 388, 355, 2124, 80, 198, 11748, 10688, 198, 6738, 10662, 1984, 270, 13, 21170, 5013, 13, 32016, 13, 20307, 62, 70, 689, 1330, 371, 56, 22628, 198, 6738, 10662, 1984, 270, 1330, 29082, 31560, 5013, 11, 12260, 11, 15781, 11, 19764, 48, 198, 198, 2, 3740, 1378, 14016, 30493, 13, 785, 14, 421, 14232, 2, 21170, 5013, 34758, 4, 1828, 4033, 82, 4, 1828, 25, 30109, 16, 11, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 26115, 13, 4089, 1954, 1485, 4, 1828, 92, 38430, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 26115, 13, 45722, 18444, 4, 1828, 5512, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 26115, 13, 24, 15801, 2091, 4, 1828, 5512, 4, 1828, 4, 36, 17, 4, 5607, 4, 32, 21, 4, 1828, 38430, 38430, 4, 1828, 5840, 862, 17, 4, 1828, 38430, 38430, 16, 11, 16, 11, 4, 1828, 39, 4, 1828, 38430, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 17, 4, 1828, 5512, 16, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 16, 11, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 18, 4, 1828, 5512, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 19, 4, 1828, 5512, 16, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 4, 1828, 57, 4, 1828, 11, 16, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 16, 11, 16, 11, 4, 1828, 55, 4, 1828, 38430, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 17, 10, 14415, 4, 1828, 5512, 16, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 38430, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 16, 11, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 18, 4, 1828, 5512, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 19, 4, 1828, 5512, 16, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 16, 11, 16, 11, 4, 1828, 55, 4, 1828, 38430, 16, 11, 16, 11, 4, 1828, 39, 4, 1828, 38430, 4, 1828, 35, 6377, 4, 1828, 11, 4, 1828, 35, 6377, 4, 1828, 11, 4, 1828, 35, 6377, 4, 1828, 60, 4357, 4, 1828, 15003, 4, 1828, 33250, 15, 11, 15, 11, 16, 48999, 198, 198, 2, 3740, 1378, 14016, 30493, 13, 785, 14, 421, 14232, 2, 21170, 5013, 34758, 4, 1828, 4033, 82, 4, 1828, 25, 30109, 16, 11, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 26115, 13, 4089, 1954, 1485, 4, 1828, 92, 38430, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 26115, 13, 45722, 18444, 4, 1828, 5512, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 26115, 13, 24, 15801, 2091, 4, 1828, 5512, 4, 1828, 4, 36, 17, 4, 5607, 4, 32, 21, 4, 1828, 38430, 38430, 4, 1828, 5840, 862, 17, 4, 1828, 38430, 38430, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 55, 4, 1828, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 17, 4, 1828, 92, 38430, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 11, 4, 1828, 55, 4, 1828, 38430, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 16, 11, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 18, 4, 1828, 92, 38430, 4, 1828, 55, 4, 1828, 11, 4, 1828, 4, 36, 17, 4, 1795, 4, 32, 17, 4, 1828, 38430, 90, 4, 1828, 312, 4, 1828, 25, 4, 1828, 46987, 701, 4, 1828, 11, 4, 1828, 853, 4, 1828, 25, 4, 1828, 14415, 14, 19, 4, 1828, 92, 38430, 4, 1828, 5840, 862, 17, 4, 1828, 11907, 92, 198 ]
1.577601
1,134
from bot.Bot import Bot from bot.api_ai import find_respond import json # change = Change() # jso = { # # "respond": "Bye" # } # result = change.respond(jso) # print(result)
[ 6738, 10214, 13, 20630, 1330, 18579, 198, 6738, 10214, 13, 15042, 62, 1872, 1330, 1064, 62, 5546, 198, 11748, 33918, 628, 198, 198, 2, 1487, 796, 9794, 3419, 198, 2, 474, 568, 796, 1391, 198, 2, 198, 2, 220, 220, 366, 5546, 1298, 366, 3886, 68, 1, 198, 2, 1782, 198, 2, 1255, 796, 1487, 13, 5546, 7, 73, 568, 8, 198, 2, 3601, 7, 20274, 8, 628, 198 ]
2.623188
69
import data_w from data_w import widedata from data_w import* import model_w from model_w import* from model_w import WideCNN #datset=widedata(ligand_path, protein_path,keys,motif_path,affinity_path) dataset = widedata(ligand_path, protein_path,keys,motif_path,affinity_path) train_loader, test_loader = load_splitset(dataset, .2) modelw=WideCNN() trainwide=train_w(modelw,train_loader) torch.save(modelw,'wide.pt') if __name__ == '__main__': print(trainwide[0]) print(trainwide[1])
[ 11748, 1366, 62, 86, 201, 198, 6738, 1366, 62, 86, 1330, 266, 1384, 1045, 201, 198, 6738, 1366, 62, 86, 1330, 9, 201, 198, 11748, 2746, 62, 86, 201, 198, 6738, 2746, 62, 86, 1330, 9, 201, 198, 6738, 2746, 62, 86, 1330, 23399, 18474, 201, 198, 2, 67, 1381, 316, 28, 86, 1384, 1045, 7, 4604, 392, 62, 6978, 11, 7532, 62, 6978, 11, 13083, 11, 27926, 361, 62, 6978, 11, 2001, 6269, 62, 6978, 8, 201, 198, 201, 198, 201, 198, 19608, 292, 316, 796, 266, 1384, 1045, 7, 4604, 392, 62, 6978, 11, 7532, 62, 6978, 11, 13083, 11, 27926, 361, 62, 6978, 11, 2001, 6269, 62, 6978, 8, 201, 198, 27432, 62, 29356, 11, 1332, 62, 29356, 796, 3440, 62, 22018, 896, 316, 7, 19608, 292, 316, 11, 764, 17, 8, 201, 198, 19849, 86, 28, 42559, 18474, 3419, 201, 198, 27432, 4421, 28, 27432, 62, 86, 7, 19849, 86, 11, 27432, 62, 29356, 8, 201, 198, 13165, 354, 13, 21928, 7, 19849, 86, 4032, 4421, 13, 457, 11537, 201, 198, 201, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 201, 198, 220, 220, 3601, 7, 27432, 4421, 58, 15, 12962, 201, 198, 220, 220, 3601, 7, 27432, 4421, 58, 16, 12962, 201, 198, 201, 198, 201, 198, 201, 198, 201, 198, 201, 198, 201, 198, 201, 198, 201, 198 ]
2.317181
227
import math
[ 11748, 10688 ]
5.5
2
from itertools import cycle import sys # from qtpy import QtWidgets, QtCore from PyQt5 import QtWidgets, QtCore if __name__ == "__main__": app = QtWidgets.QApplication(sys.argv) ex = ExampleWindow() ex.show() sys.exit(app.exec_())
[ 6738, 340, 861, 10141, 1330, 6772, 198, 11748, 25064, 198, 198, 2, 422, 10662, 83, 9078, 1330, 33734, 54, 312, 11407, 11, 33734, 14055, 198, 6738, 9485, 48, 83, 20, 1330, 33734, 54, 312, 11407, 11, 33734, 14055, 628, 198, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 220, 220, 220, 220, 198, 220, 220, 220, 598, 796, 33734, 54, 312, 11407, 13, 48, 23416, 7, 17597, 13, 853, 85, 8, 198, 220, 220, 220, 409, 796, 17934, 27703, 3419, 198, 220, 220, 220, 409, 13, 12860, 3419, 198, 220, 220, 220, 25064, 13, 37023, 7, 1324, 13, 18558, 62, 28955, 198 ]
2.428571
105
from os import system
[ 6738, 28686, 1330, 1080, 201, 198, 201, 198 ]
3.125
8
""" Module with tests for Highlight """ #----------------------------------------------------------------------------- # Copyright (c) 2013, the IPython Development Team. # # Distributed under the terms of the Modified BSD License. # # The full license is in the file COPYING.txt, distributed with this software. #----------------------------------------------------------------------------- #----------------------------------------------------------------------------- # Imports #----------------------------------------------------------------------------- from ...tests.base import TestsBase from ..highlight import Highlight2Html, Highlight2Latex from IPython.config import Config import xml #----------------------------------------------------------------------------- # Class #----------------------------------------------------------------------------- highlight2html = Highlight2Html() highlight2latex = Highlight2Latex() c = Config() c.Highlight2Html.default_language='ruby' highlight2html_ruby = Highlight2Html(config=c) class TestHighlight(TestsBase): """Contains test functions for highlight.py""" #Hello world test, magics test, blank string test tests = [ """ #Hello World Example def say(text): print(text) end say('Hello World!') """, """ %%pylab plot(x,y, 'r') """ ] tokens = [ ['Hello World Example', 'say', 'text', 'print', 'def'], ['pylab', 'plot']] def test_highlight2html(self): """highlight2html test""" for index, test in enumerate(self.tests): self._try_highlight(highlight2html, test, self.tokens[index]) def test_highlight2latex(self): """highlight2latex test""" for index, test in enumerate(self.tests): self._try_highlight(highlight2latex, test, self.tokens[index]) def _try_highlight(self, method, test, tokens): """Try highlighting source, look for key tokens""" results = method(test) for token in tokens: assert token in results
[ 37811, 198, 26796, 351, 5254, 329, 3334, 2971, 198, 37811, 198, 198, 2, 10097, 32501, 198, 2, 15069, 357, 66, 8, 2211, 11, 262, 6101, 7535, 7712, 4816, 13, 198, 2, 198, 2, 4307, 6169, 739, 262, 2846, 286, 262, 40499, 347, 10305, 13789, 13, 198, 2, 198, 2, 383, 1336, 5964, 318, 287, 262, 2393, 27975, 45761, 13, 14116, 11, 9387, 351, 428, 3788, 13, 198, 2, 10097, 32501, 198, 198, 2, 10097, 32501, 198, 2, 1846, 3742, 198, 2, 10097, 32501, 198, 198, 6738, 2644, 41989, 13, 8692, 1330, 30307, 14881, 198, 6738, 11485, 8929, 2971, 1330, 3334, 2971, 17, 39, 20369, 11, 3334, 2971, 17, 26302, 87, 198, 6738, 6101, 7535, 13, 11250, 1330, 17056, 198, 11748, 35555, 198, 198, 2, 10097, 32501, 198, 2, 5016, 198, 2, 10097, 32501, 198, 198, 8929, 2971, 17, 6494, 796, 3334, 2971, 17, 39, 20369, 3419, 198, 8929, 2971, 17, 17660, 87, 796, 3334, 2971, 17, 26302, 87, 3419, 198, 66, 796, 17056, 3419, 198, 66, 13, 11922, 2971, 17, 39, 20369, 13, 12286, 62, 16129, 11639, 49137, 6, 198, 8929, 2971, 17, 6494, 62, 49137, 796, 3334, 2971, 17, 39, 20369, 7, 11250, 28, 66, 8, 198, 198, 4871, 6208, 11922, 2971, 7, 51, 3558, 14881, 2599, 198, 220, 220, 220, 37227, 4264, 1299, 1332, 5499, 329, 7238, 13, 9078, 37811, 628, 220, 220, 220, 1303, 15496, 995, 1332, 11, 2153, 873, 1332, 11, 9178, 4731, 1332, 198, 220, 220, 220, 5254, 796, 685, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 15496, 2159, 17934, 628, 220, 220, 220, 220, 220, 220, 220, 825, 910, 7, 5239, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 5239, 8, 628, 220, 220, 220, 220, 220, 220, 220, 886, 628, 220, 220, 220, 220, 220, 220, 220, 910, 10786, 15496, 2159, 0, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 13538, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 43313, 79, 2645, 397, 198, 220, 220, 220, 220, 220, 220, 220, 7110, 7, 87, 11, 88, 11, 705, 81, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 2361, 220, 220, 220, 628, 220, 220, 220, 16326, 796, 685, 198, 220, 220, 220, 220, 220, 220, 220, 37250, 15496, 2159, 17934, 3256, 705, 16706, 3256, 705, 5239, 3256, 705, 4798, 3256, 705, 4299, 6, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 37250, 79, 2645, 397, 3256, 705, 29487, 6, 11907, 628, 198, 220, 220, 220, 825, 1332, 62, 8929, 2971, 17, 6494, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 8929, 2971, 17, 6494, 1332, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 329, 6376, 11, 1332, 287, 27056, 378, 7, 944, 13, 41989, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 28311, 62, 8929, 2971, 7, 8929, 2971, 17, 6494, 11, 1332, 11, 2116, 13, 83, 482, 641, 58, 9630, 12962, 628, 198, 220, 220, 220, 825, 1332, 62, 8929, 2971, 17, 17660, 87, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 8929, 2971, 17, 17660, 87, 1332, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 329, 6376, 11, 1332, 287, 27056, 378, 7, 944, 13, 41989, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 28311, 62, 8929, 2971, 7, 8929, 2971, 17, 17660, 87, 11, 1332, 11, 2116, 13, 83, 482, 641, 58, 9630, 12962, 628, 220, 220, 220, 825, 4808, 28311, 62, 8929, 2971, 7, 944, 11, 2446, 11, 1332, 11, 16326, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 23433, 21292, 2723, 11, 804, 329, 1994, 16326, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 2482, 796, 2446, 7, 9288, 8, 198, 220, 220, 220, 220, 220, 220, 220, 329, 11241, 287, 16326, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 11241, 287, 2482, 198 ]
3.076923
689
"""Here, I'd like to gather utility function / classes related to `pywin32com`. Notice that this library is not library, but recipes for reading codes of `pywin32com`. """ from win32com.client import DispatchEx, CDispatch from win32com.client.selecttlb import EnumTlbs from win32com.client.makepy import GenerateFromTypeLibSpec from win32com import __gen_path__ # print(__gen_path__) # In this folder, the generated object resides. def assure_generation(): """We would like to `generated` pywin32 PowerPoint module. """ if _required_generation(): _gen() assure_generation()
[ 37811, 4342, 11, 314, 1549, 588, 284, 6431, 10361, 2163, 1220, 6097, 3519, 284, 4600, 9078, 5404, 2624, 785, 44646, 220, 198, 26396, 326, 428, 5888, 318, 407, 5888, 11, 475, 14296, 329, 3555, 12416, 286, 4600, 9078, 5404, 2624, 785, 44646, 220, 220, 198, 37811, 220, 198, 198, 6738, 1592, 2624, 785, 13, 16366, 1330, 35934, 3109, 11, 6458, 8802, 963, 198, 6738, 1592, 2624, 785, 13, 16366, 13, 19738, 83, 23160, 1330, 2039, 388, 51, 32133, 198, 6738, 1592, 2624, 785, 13, 16366, 13, 15883, 9078, 1330, 2980, 378, 4863, 6030, 25835, 22882, 198, 6738, 1592, 2624, 785, 1330, 11593, 5235, 62, 6978, 834, 198, 198, 2, 3601, 7, 834, 5235, 62, 6978, 834, 8, 220, 1303, 554, 428, 9483, 11, 262, 7560, 2134, 29076, 13, 220, 198, 198, 4299, 19832, 62, 20158, 33529, 198, 220, 220, 220, 37227, 1135, 561, 588, 284, 4600, 27568, 63, 12972, 5404, 2624, 43563, 8265, 13, 198, 220, 220, 220, 37227, 628, 220, 220, 220, 611, 4808, 35827, 62, 20158, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 4808, 5235, 3419, 198, 198, 562, 495, 62, 20158, 3419, 628 ]
3.223404
188
from selenium import webdriver from time import sleep import os options = webdriver.ChromeOptions() options.add_experimental_option("excludeSwitches", ['enable-automation']) # プラウザ起動(Chrome) driver = webdriver.Chrome(r'chromedriver.exe', chrome_options=options) # chromedriver.exeを使う # リストからURLをひとつづつ処理 print('file:///{}/tmp.png'.format(os.getcwd())) driver.get('file:///{}/tmp.png'.format(os.getcwd())) while True: sleep(1) driver.refresh()
[ 6738, 384, 11925, 1505, 1330, 3992, 26230, 201, 198, 6738, 640, 1330, 3993, 201, 198, 11748, 28686, 201, 198, 201, 198, 25811, 796, 3992, 26230, 13, 1925, 5998, 29046, 3419, 201, 198, 25811, 13, 2860, 62, 23100, 9134, 62, 18076, 7203, 1069, 9152, 10462, 9249, 1600, 37250, 21633, 12, 2306, 296, 341, 6, 12962, 201, 198, 201, 198, 2, 14524, 245, 9263, 16165, 48458, 164, 113, 115, 47947, 243, 171, 120, 230, 1925, 5998, 171, 120, 231, 201, 198, 26230, 796, 3992, 26230, 13, 1925, 5998, 7, 81, 6, 28663, 276, 38291, 13, 13499, 3256, 32030, 62, 25811, 28, 25811, 8, 1303, 15358, 276, 38291, 13, 13499, 31758, 45635, 29557, 201, 198, 201, 198, 2, 220, 12675, 43302, 27370, 36853, 21886, 31758, 2515, 110, 30201, 2515, 97, 2515, 98, 2515, 97, 49035, 99, 49426, 228, 201, 198, 4798, 10786, 7753, 1378, 14, 90, 92, 14, 22065, 13, 11134, 4458, 18982, 7, 418, 13, 1136, 66, 16993, 3419, 4008, 201, 198, 26230, 13, 1136, 10786, 7753, 1378, 14, 90, 92, 14, 22065, 13, 11134, 4458, 18982, 7, 418, 13, 1136, 66, 16993, 3419, 4008, 201, 198, 201, 198, 4514, 6407, 25, 201, 198, 220, 220, 220, 3993, 7, 16, 8, 201, 198, 220, 220, 220, 4639, 13, 5420, 3447, 3419 ]
2.244019
209
# gcode runner import io, sys import socket import time import re import argparse ADDR="192.168.1.18" PORT=23 LAST_SENT="" # Should be ok, error, etc. LAST_RESPONSE="" # Optional [Caution: Unlocked] in response to $X LAST_RESPONSE_MSG="" # Global values set by get_status() STATUS="" MPOS=[0.0, 0.0, 0.0] WPOS=[0.0, 0.0, 0.0] FEEDS=[0.0, 0.0] TIMEOUT_COUNT=0 PASS_TIMEOUT_COUNT=0 # Default response for command timeout is 5 minutes # Get available text with specified timeout in ms #### Main entry #### # Parse command line TARGET_PASSES=1 # Actions to take WITH_HOME=0 WITH_INIT=1 WITH_FILE=0 WITH_POST=1 # Arbitrary init string #INIT_CMD='G0 X500 Y800 F2000 G0 Z0 F200\n' #INIT_CMD='G30 Z2.0\n' #INIT_CMD='G0 Z0\n' INIT_CMD='G0 Z10 X10 Y10 F2000\n' INIT_CMD='G92 Z10 X10 Y10\n' # Input file INPUT_FILE='limit-test1-faster.gcode' # Post-run command POST_CMD='G0 Z10 X10 Y10 F2000\n' # Attempt to read entire gcode file. This may fail on really large files. # Must test with 10's of MB and up. try: ifile = open(INPUT_FILE, 'r') GCode = ifile.readlines() ifile.close() except: print('Failed to open gcode input {0}'.format(INPUT_FILE)) sys.exit(1) # Analyze for comments total_lines = len(GCode) comment_lines = 0 for line in GCode: if line.startswith('('): comment_lines = comment_lines + 1 print('Input file {0} has {1} comment lines, {2} out of {3} active (comments will not be sent)'.format(INPUT_FILE, comment_lines, total_lines - comment_lines, total_lines)) start_run = time.monotonic() line_number = 0 try: print('Attempting connection via {0} at {1}:{2}'.format('TCP', ADDR, PORT)) socket.setdefaulttimeout(60) msock = socket.socket( socket.AF_INET, socket.SOCK_STREAM ) started = time.monotonic() cres = msock.connect( (ADDR, PORT) ) elapsed = time.monotonic() - started print('Connection time:', elapsed) # Flush any greeting, usually Smoothie command shell time.sleep(2) s = get_text(msock, 5000) print('Starting text:', s.strip()) s = get_text(msock, 1000) if s != "": print('Still starting:', s.strip()) start_run = time.monotonic() # Query status - if alarm, send $X to clear and try again #timed_cmd(msock, b'get status\n') # Smoothie will send <status|mpos|wpos>\n[GC:...] in response to ?$G #timed_cmd(msock, b'?$G\n') s = get_text(msock, 1000) if s != "": print('Additional text: {0}'.format(s)) # Supposed to be time in milliseconds - Smoothie interprets it as seconds #timed_cmd(msock, b'G4 P10\n') for rpass in range(1, 1 + TARGET_PASSES): print('starting pass', rpass, 'of', TARGET_PASSES) start_pass = time.monotonic() get_status(msock) # If we interrupt a run, we may get an empty status if STATUS == '': print('Trying status again:') get_status(msock, 6000) # Try again if we timed out if STATUS == 'Timeout': print('Status timeout, trying again:') get_status(msock, 10000) print('Status:', STATUS) if STATUS == 'Alarm': print('Need to clear alarm') timed_cmd(msock, '$X\n') if LAST_RESPONSE != 'ok': print('Did not get ok:', LAST_RESPONSE) sys.exit(1) elif STATUS.startswith('Failed'): # A previous operation failed. Attempt a wait print('A previous operation failed, attempting to clear failure...') timed_cmd(msock, 'M400\n') get_status(msock) print('Response from wait: {0} {1} status: {2}'.format(LAST_RESPONSE, LAST_RESPONSE_MSG, STATUS)) if STATUS != 'Idle': print('Unable to clear failure') sys.exit(1) elif STATUS != 'Idle': print('Status must be idle, got:', STATUS) #sys.exit(1) break PASS_TIMEOUT_COUNT = 0 #get_status(msock) #if STATUS != 'Idle': # print('Non-idle status:', STATUS) # break if WITH_HOME: print('Homing...') timed_cmd(msock, 'G28.2 X0 Y0\n') if LAST_RESPONSE == 'error': break timed_cmd(msock, 'G92 X0 Y0\n') # Wait for motion to complete timed_cmd(msock, 'M400\n') get_status(msock) print('New status after home/reset: {0}\n'.format(STATUS)) if WITH_INIT and rpass == 1: print('Sending init cmd: {0}'.format(INIT_CMD.strip())) timed_cmd(msock, INIT_CMD) timed_cmd(msock, 'M400\n') get_status(msock) print('New status after init: {0}\n'.format(STATUS)) line_number = 1 if WITH_FILE: for line in GCode: if not line.startswith('('): # Smoothie switches on if spindle configured in switch mode for ANY value of S, including 0 if line.startswith('M3'): print('Spindle control: {0}'.format(line.strip())) # FIXME use longer timeout for M400 timed_cmd(msock, line) if LAST_RESPONSE == 'error': print('Exiting, error condition at line {0}'.format(line_number)) sys.exit(1) line_number = line_number + 1 elapsed_pass = time.monotonic() - start_pass print('pass {0} total time {1:.4f}s, timeouts: {2}'.format(rpass, elapsed_pass, PASS_TIMEOUT_COUNT)) if WITH_POST: print('Final pass completed, sending post-run command {0}'.format(POST_CMD)) timed_cmd(msock, POST_CMD) timed_cmd(msock, 'M400\n') get_status(msock) print('New status after post-run cmd: {0}\n'.format(STATUS)) elapsed_run = time.monotonic() - start_run print('Final pass completed in {0:.4f}s, total timeout count: {1}'.format(elapsed_run, TIMEOUT_COUNT)) except OSError as e: print('Exception:', e) print('last cmd:', LAST_SENT, 'line number:', line_number) elapsed_run = time.monotonic() - start_run print('Elapsed time: {0:.4f}s'.format(elapsed_run)) sys.exit(1) msock.close() print('Completed') sys.exit(0)
[ 2, 308, 8189, 17490, 198, 11748, 33245, 11, 25064, 198, 11748, 17802, 198, 11748, 640, 198, 11748, 302, 198, 11748, 1822, 29572, 198, 198, 2885, 7707, 2625, 17477, 13, 14656, 13, 16, 13, 1507, 1, 198, 15490, 28, 1954, 198, 43, 11262, 62, 50, 3525, 33151, 198, 2, 10358, 307, 12876, 11, 4049, 11, 3503, 13, 198, 43, 11262, 62, 19535, 47, 1340, 5188, 33151, 198, 2, 32233, 685, 24334, 1009, 25, 791, 24162, 60, 287, 2882, 284, 720, 55, 198, 43, 11262, 62, 19535, 47, 1340, 5188, 62, 5653, 38, 33151, 198, 198, 2, 8060, 3815, 900, 416, 651, 62, 13376, 3419, 198, 35744, 2937, 33151, 198, 7378, 2640, 41888, 15, 13, 15, 11, 657, 13, 15, 11, 657, 13, 15, 60, 198, 25527, 2640, 41888, 15, 13, 15, 11, 657, 13, 15, 11, 657, 13, 15, 60, 198, 15112, 1961, 50, 41888, 15, 13, 15, 11, 657, 13, 15, 60, 198, 34694, 12425, 62, 34, 28270, 28, 15, 198, 47924, 62, 34694, 12425, 62, 34, 28270, 28, 15, 198, 198, 2, 15161, 2882, 329, 3141, 26827, 318, 642, 2431, 198, 198, 2, 3497, 1695, 2420, 351, 7368, 26827, 287, 13845, 198, 198, 4242, 8774, 5726, 1303, 21017, 198, 198, 2, 2547, 325, 3141, 1627, 198, 51, 46095, 62, 47924, 1546, 28, 16, 198, 198, 2, 24439, 284, 1011, 198, 54, 10554, 62, 39069, 28, 15, 198, 54, 10554, 62, 1268, 2043, 28, 16, 198, 54, 10554, 62, 25664, 28, 15, 198, 54, 10554, 62, 32782, 28, 16, 198, 198, 2, 33619, 11619, 2315, 4731, 198, 2, 1268, 2043, 62, 34, 12740, 11639, 38, 15, 1395, 4059, 575, 7410, 376, 11024, 402, 15, 1168, 15, 376, 2167, 59, 77, 6, 198, 2, 1268, 2043, 62, 34, 12740, 11639, 38, 1270, 1168, 17, 13, 15, 59, 77, 6, 198, 2, 1268, 2043, 62, 34, 12740, 11639, 38, 15, 1168, 15, 59, 77, 6, 198, 1268, 2043, 62, 34, 12740, 11639, 38, 15, 1168, 940, 1395, 940, 575, 940, 376, 11024, 59, 77, 6, 198, 1268, 2043, 62, 34, 12740, 11639, 38, 5892, 1168, 940, 1395, 940, 575, 940, 59, 77, 6, 198, 198, 2, 23412, 2393, 198, 1268, 30076, 62, 25664, 11639, 32374, 12, 9288, 16, 12, 69, 1603, 13, 70, 8189, 6, 198, 198, 2, 2947, 12, 5143, 3141, 198, 32782, 62, 34, 12740, 11639, 38, 15, 1168, 940, 1395, 940, 575, 940, 376, 11024, 59, 77, 6, 198, 198, 2, 25770, 284, 1100, 2104, 308, 8189, 2393, 13, 770, 743, 2038, 319, 1107, 1588, 3696, 13, 198, 2, 12039, 1332, 351, 838, 338, 286, 10771, 290, 510, 13, 198, 28311, 25, 198, 220, 220, 220, 611, 576, 796, 1280, 7, 1268, 30076, 62, 25664, 11, 705, 81, 11537, 198, 220, 220, 220, 402, 10669, 796, 611, 576, 13, 961, 6615, 3419, 198, 220, 220, 220, 611, 576, 13, 19836, 3419, 198, 16341, 25, 198, 220, 220, 220, 3601, 10786, 37, 6255, 284, 1280, 308, 8189, 5128, 1391, 15, 92, 4458, 18982, 7, 1268, 30076, 62, 25664, 4008, 198, 220, 220, 220, 25064, 13, 37023, 7, 16, 8, 198, 198, 2, 16213, 2736, 329, 3651, 198, 23350, 62, 6615, 796, 18896, 7, 38, 10669, 8, 198, 23893, 62, 6615, 796, 657, 198, 1640, 1627, 287, 402, 10669, 25, 198, 220, 220, 220, 611, 1627, 13, 9688, 2032, 342, 10786, 10786, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 2912, 62, 6615, 796, 2912, 62, 6615, 1343, 352, 198, 198, 4798, 10786, 20560, 2393, 1391, 15, 92, 468, 1391, 16, 92, 2912, 3951, 11, 1391, 17, 92, 503, 286, 1391, 18, 92, 4075, 357, 15944, 481, 407, 307, 1908, 8, 4458, 18982, 7, 1268, 30076, 62, 25664, 11, 2912, 62, 6615, 11, 2472, 62, 6615, 532, 2912, 62, 6615, 11, 2472, 62, 6615, 4008, 198, 198, 9688, 62, 5143, 796, 640, 13, 2144, 313, 9229, 3419, 198, 1370, 62, 17618, 796, 657, 198, 28311, 25, 198, 220, 220, 220, 3601, 10786, 37177, 278, 4637, 2884, 1391, 15, 92, 379, 1391, 16, 92, 29164, 17, 92, 4458, 18982, 10786, 4825, 47, 3256, 5984, 7707, 11, 350, 9863, 4008, 198, 220, 220, 220, 17802, 13, 2617, 12286, 48678, 7, 1899, 8, 198, 220, 220, 220, 13845, 735, 796, 17802, 13, 44971, 7, 17802, 13, 8579, 62, 1268, 2767, 11, 17802, 13, 50, 11290, 62, 2257, 32235, 1267, 198, 220, 220, 220, 220, 198, 220, 220, 220, 2067, 796, 640, 13, 2144, 313, 9229, 3419, 198, 220, 220, 220, 269, 411, 796, 13845, 735, 13, 8443, 7, 357, 2885, 7707, 11, 350, 9863, 8, 1267, 198, 220, 220, 220, 42118, 796, 640, 13, 2144, 313, 9229, 3419, 532, 2067, 198, 220, 220, 220, 3601, 10786, 32048, 640, 25, 3256, 42118, 8, 198, 220, 220, 220, 1303, 1610, 1530, 597, 31933, 11, 3221, 37002, 494, 3141, 7582, 198, 220, 220, 220, 640, 13, 42832, 7, 17, 8, 198, 220, 220, 220, 264, 796, 651, 62, 5239, 7, 907, 735, 11, 23336, 8, 198, 220, 220, 220, 3601, 10786, 22851, 2420, 25, 3256, 264, 13, 36311, 28955, 198, 220, 220, 220, 264, 796, 651, 62, 5239, 7, 907, 735, 11, 8576, 8, 198, 220, 220, 220, 611, 264, 14512, 366, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 9590, 3599, 25, 3256, 264, 13, 36311, 28955, 198, 220, 220, 220, 923, 62, 5143, 796, 640, 13, 2144, 313, 9229, 3419, 198, 220, 220, 220, 1303, 43301, 3722, 532, 611, 10436, 11, 3758, 720, 55, 284, 1598, 290, 1949, 757, 198, 220, 220, 220, 1303, 16514, 276, 62, 28758, 7, 907, 735, 11, 275, 6, 1136, 3722, 59, 77, 11537, 198, 220, 220, 220, 1303, 37002, 494, 481, 3758, 1279, 13376, 91, 76, 1930, 91, 86, 1930, 29, 59, 77, 58, 15916, 25, 22345, 287, 2882, 284, 5633, 3, 38, 198, 220, 220, 220, 1303, 16514, 276, 62, 28758, 7, 907, 735, 11, 275, 30960, 3, 38, 59, 77, 11537, 198, 220, 220, 220, 264, 796, 651, 62, 5239, 7, 907, 735, 11, 8576, 8, 198, 220, 220, 220, 611, 264, 14512, 366, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 17699, 2420, 25, 1391, 15, 92, 4458, 18982, 7, 82, 4008, 198, 220, 220, 220, 1303, 8105, 1335, 284, 307, 640, 287, 38694, 532, 37002, 494, 16795, 912, 340, 355, 4201, 198, 220, 220, 220, 1303, 16514, 276, 62, 28758, 7, 907, 735, 11, 275, 6, 38, 19, 350, 940, 59, 77, 11537, 198, 220, 220, 220, 329, 374, 6603, 287, 2837, 7, 16, 11, 352, 1343, 309, 46095, 62, 47924, 1546, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 38690, 1208, 3256, 374, 6603, 11, 705, 1659, 3256, 309, 46095, 62, 47924, 1546, 8, 198, 220, 220, 220, 220, 220, 220, 220, 923, 62, 6603, 796, 640, 13, 2144, 313, 9229, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 11313, 257, 1057, 11, 356, 743, 651, 281, 6565, 3722, 198, 220, 220, 220, 220, 220, 220, 220, 611, 15486, 2937, 6624, 10148, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 51, 14992, 3722, 757, 25, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 11, 39064, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 9993, 757, 611, 356, 28805, 503, 198, 220, 220, 220, 220, 220, 220, 220, 611, 15486, 2937, 6624, 705, 48031, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 19580, 26827, 11, 2111, 757, 25, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 11, 33028, 8, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 19580, 25, 3256, 15486, 2937, 8, 198, 220, 220, 220, 220, 220, 220, 220, 611, 15486, 2937, 6624, 705, 2348, 1670, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 23037, 284, 1598, 10436, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 3, 55, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 41894, 62, 19535, 47, 1340, 5188, 14512, 705, 482, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 11633, 407, 651, 12876, 25, 3256, 41894, 62, 19535, 47, 1340, 5188, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 37023, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 15486, 2937, 13, 9688, 2032, 342, 10786, 37, 6255, 6, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 317, 2180, 4905, 4054, 13, 25770, 257, 4043, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 32, 2180, 4905, 4054, 11, 9361, 284, 1598, 5287, 986, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 44, 7029, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 31077, 422, 4043, 25, 1391, 15, 92, 1391, 16, 92, 3722, 25, 1391, 17, 92, 4458, 18982, 7, 43, 11262, 62, 19535, 47, 1340, 5188, 11, 41894, 62, 19535, 47, 1340, 5188, 62, 5653, 38, 11, 15486, 2937, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 15486, 2937, 14512, 705, 7390, 293, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 3118, 540, 284, 1598, 5287, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 37023, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 15486, 2937, 14512, 705, 7390, 293, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 19580, 1276, 307, 21696, 11, 1392, 25, 3256, 15486, 2937, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17597, 13, 37023, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 198, 220, 220, 220, 220, 220, 220, 220, 41752, 62, 34694, 12425, 62, 34, 28270, 796, 657, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1136, 62, 13376, 7, 907, 735, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 361, 15486, 2937, 14512, 705, 7390, 293, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 220, 220, 220, 3601, 10786, 15419, 12, 312, 293, 3722, 25, 3256, 15486, 2937, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 220, 220, 220, 2270, 198, 220, 220, 220, 220, 220, 220, 220, 611, 13315, 62, 39069, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 39, 3383, 986, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 38, 2078, 13, 17, 1395, 15, 575, 15, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 41894, 62, 19535, 47, 1340, 5188, 6624, 705, 18224, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 38, 5892, 1395, 15, 575, 15, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16314, 329, 6268, 284, 1844, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 44, 7029, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 3791, 3722, 706, 1363, 14, 42503, 25, 1391, 15, 32239, 77, 4458, 18982, 7, 35744, 2937, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 611, 13315, 62, 1268, 2043, 290, 374, 6603, 6624, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 50, 1571, 2315, 23991, 25, 1391, 15, 92, 4458, 18982, 7, 1268, 2043, 62, 34, 12740, 13, 36311, 3419, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 3268, 2043, 62, 34, 12740, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 44, 7029, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 3791, 3722, 706, 2315, 25, 1391, 15, 32239, 77, 4458, 18982, 7, 35744, 2937, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 1627, 62, 17618, 796, 352, 198, 220, 220, 220, 220, 220, 220, 220, 611, 13315, 62, 25664, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 329, 1627, 287, 402, 10669, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 407, 1627, 13, 9688, 2032, 342, 10786, 10786, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 37002, 494, 18225, 319, 611, 599, 42343, 17839, 287, 5078, 4235, 329, 15529, 1988, 286, 311, 11, 1390, 657, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1627, 13, 9688, 2032, 342, 10786, 44, 18, 6, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 4561, 42343, 1630, 25, 1391, 15, 92, 4458, 18982, 7, 1370, 13, 36311, 3419, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 44855, 11682, 779, 2392, 26827, 329, 337, 7029, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 1627, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 41894, 62, 19535, 47, 1340, 5188, 6624, 705, 18224, 10354, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 3109, 1780, 11, 4049, 4006, 379, 1627, 1391, 15, 92, 4458, 18982, 7, 1370, 62, 17618, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 37023, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1627, 62, 17618, 796, 1627, 62, 17618, 1343, 352, 198, 220, 220, 220, 220, 220, 220, 220, 42118, 62, 6603, 796, 640, 13, 2144, 313, 9229, 3419, 532, 923, 62, 6603, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 6603, 1391, 15, 92, 2472, 640, 1391, 16, 25, 13, 19, 69, 92, 82, 11, 640, 5269, 25, 1391, 17, 92, 4458, 18982, 7, 81, 6603, 11, 42118, 62, 6603, 11, 41752, 62, 34694, 12425, 62, 34, 28270, 4008, 198, 220, 220, 220, 611, 13315, 62, 32782, 25, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 19006, 1208, 5668, 11, 7216, 1281, 12, 5143, 3141, 1391, 15, 92, 4458, 18982, 7, 32782, 62, 34, 12740, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 24582, 62, 34, 12740, 8, 198, 220, 220, 220, 220, 220, 220, 220, 28805, 62, 28758, 7, 907, 735, 11, 705, 44, 7029, 59, 77, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 651, 62, 13376, 7, 907, 735, 8, 198, 220, 220, 220, 220, 220, 220, 220, 3601, 10786, 3791, 3722, 706, 1281, 12, 5143, 23991, 25, 1391, 15, 32239, 77, 4458, 18982, 7, 35744, 2937, 4008, 198, 220, 220, 220, 42118, 62, 5143, 796, 640, 13, 2144, 313, 9229, 3419, 532, 923, 62, 5143, 198, 220, 220, 220, 3601, 10786, 19006, 1208, 5668, 287, 1391, 15, 25, 13, 19, 69, 92, 82, 11, 2472, 26827, 954, 25, 1391, 16, 92, 4458, 18982, 7, 417, 28361, 62, 5143, 11, 20460, 12425, 62, 34, 28270, 4008, 198, 16341, 440, 5188, 81, 1472, 355, 304, 25, 198, 220, 220, 220, 3601, 10786, 16922, 25, 3256, 304, 8, 198, 220, 220, 220, 3601, 10786, 12957, 23991, 25, 3256, 41894, 62, 50, 3525, 11, 705, 1370, 1271, 25, 3256, 1627, 62, 17618, 8, 198, 220, 220, 220, 42118, 62, 5143, 796, 640, 13, 2144, 313, 9229, 3419, 532, 923, 62, 5143, 198, 220, 220, 220, 3601, 10786, 9527, 28361, 640, 25, 1391, 15, 25, 13, 19, 69, 92, 82, 4458, 18982, 7, 417, 28361, 62, 5143, 4008, 198, 220, 220, 220, 25064, 13, 37023, 7, 16, 8, 198, 198, 907, 735, 13, 19836, 3419, 198, 4798, 10786, 43768, 11537, 198, 17597, 13, 37023, 7, 15, 8, 198 ]
2.130258
2,948
#4. 定义一个函数,完成以下功能: # 1) 输入两个整型数,例如输入的是3, 5 # 2) 此函数要计算的是3 + 33 + 333 + 3333 + 33333(到5个为止) a, b = eval(input("请输入两个整型数")) print(sum1(a, b))
[ 2, 19, 13, 10263, 106, 248, 20046, 231, 31660, 10310, 103, 49035, 121, 46763, 108, 171, 120, 234, 22522, 234, 22755, 238, 20015, 98, 10310, 233, 27950, 253, 47797, 121, 25, 198, 2, 220, 220, 352, 8, 5525, 122, 241, 17739, 98, 10310, 97, 10310, 103, 46763, 112, 161, 252, 233, 46763, 108, 11, 160, 122, 233, 36685, 224, 164, 122, 241, 17739, 98, 21410, 42468, 18, 11, 642, 198, 2, 220, 220, 362, 8, 10545, 255, 97, 49035, 121, 46763, 108, 17358, 223, 164, 106, 94, 163, 106, 245, 21410, 42468, 18, 1343, 4747, 1343, 23460, 1343, 513, 20370, 1343, 23460, 2091, 7, 26344, 108, 20, 10310, 103, 10310, 118, 29826, 95, 8, 198, 64, 11, 275, 796, 5418, 7, 15414, 7203, 46237, 115, 164, 122, 241, 17739, 98, 10310, 97, 10310, 103, 46763, 112, 161, 252, 233, 46763, 108, 48774, 198, 4798, 7, 16345, 16, 7, 64, 11, 275, 4008, 628, 628, 628, 628, 628, 628, 628, 628 ]
0.99375
160
# test plugin from bot.pluginDespatch import Plugin import re import datetime import logging from models import CapturedUrls from logos.settings import LOGGING logger = logging.getLogger(__name__) logging.config.dictConfig(LOGGING)
[ 2, 1332, 13877, 198, 6738, 10214, 13, 33803, 5960, 17147, 1330, 42636, 198, 11748, 302, 198, 11748, 4818, 8079, 198, 11748, 18931, 198, 6738, 4981, 1330, 6790, 1522, 16692, 7278, 198, 198, 6738, 29645, 13, 33692, 1330, 41605, 38, 2751, 198, 6404, 1362, 796, 18931, 13, 1136, 11187, 1362, 7, 834, 3672, 834, 8, 198, 6404, 2667, 13, 11250, 13, 11600, 16934, 7, 25294, 38, 2751, 8, 628, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 628, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 628, 198 ]
2.435897
117
from django.contrib.auth.models import User from rest_framework import serializers from odata.models import Product, Customer, Category, Shipper, Order, OrderDetail
[ 6738, 42625, 14208, 13, 3642, 822, 13, 18439, 13, 27530, 1330, 11787, 198, 6738, 1334, 62, 30604, 1330, 11389, 11341, 198, 6738, 267, 7890, 13, 27530, 1330, 8721, 11, 22092, 11, 21743, 11, 911, 14710, 11, 8284, 11, 8284, 11242, 603 ]
4
41
#! /usr/bin/env python2 ''' This script converts the Ensembl.dat file to the GO reference file used in the topGO R program. #Example input: ID 1 standard; DNA; HTG; 122678785 BP. XX AC chromosome:CanFam3.1:1:1:122678785:1 XX SV 1.CanFam3.1 XX DT 4-SEP-2018 XX DE Canis lupus familiaris chromosome 1 CanFam3.1 full sequence 1..122678785 DE annotated by Ensembl XX KW . XX OS Canis lupus familiaris (dog) OC Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; OC Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; OC Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; OC Eutheria; Boreoeutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; OC Canis lupus. XX CC This sequence was annotated by Ensembl(www.ensembl.org). Please visit the CC Ensembl or EnsemblGenomes web site, http://www.ensembl.org/ or CC http://www.ensemblgenomes.org/ for more information. XX CC All feature locations are relative to the first (5') base of the sequence CC in this file. The sequence presented is always the forward strand of the CC assembly. Features that lie outside of the sequence contained in this file CC have clonal location coordinates in the format: <clone CC accession>.<version>:<start>..<end> XX CC The /gene indicates a unique id for a gene, /note="transcript_id=..." a CC unique id for a transcript, /protein_id a unique id for a peptide and CC note="exon_id=..." a unique id for an exon. These ids are maintained CC wherever possible between versions. XX CC All the exons and transcripts in Ensembl are confirmed by similarity to CC either protein or cDNA sequences. XX FH Key Location/Qualifiers FT source 1..122678785 FT /organism="Canis lupus familiaris" FT /db_xref="taxon:9615" FT gene 722179..735934 FT /gene=ENSCAFG00000000008.3 FT /locus_tag="TXNL4A" FT /note="thioredoxin like 4A [Source:VGNC FT Symbol;Acc:VGNC:48019]" FT mRNA join(722179..722324,722691..722877,731542..731645, FT 734838..735934) FT /gene="ENSCAFG00000000008.3" FT /standard_name="ENSCAFT00000000009.3" FT CDS join(722725..722877,731542..731645,734838..735009) FT /gene="ENSCAFG00000000008.3" FT /protein_id="ENSCAFP00000000008.3" FT /note="transcript_id=ENSCAFT00000000009.3" FT /db_xref="RefSeq_mRNA_predicted:XM_005615276" FT /db_xref="RefSeq_mRNA_predicted:XM_533363" FT /db_xref="RefSeq_peptide_predicted:XP_005615333" FT /db_xref="RefSeq_peptide_predicted:XP_022263670" FT /db_xref="RefSeq_peptide_predicted:XP_533363" FT /db_xref="Uniprot/SPTREMBL:E2R204" FT /db_xref="EMBL:AAEX03000011" FT /db_xref="GO:0000398" FT /db_xref="GO:0000398" FT /db_xref="GO:0005634" FT /db_xref="GO:0005682" FT /db_xref="GO:0005829" FT /db_xref="GO:0031965" FT /db_xref="GO:0046540" FT /db_xref="GO:0046540" FT /db_xref="GO:0046540" FT /db_xref="GO:0071005" FT /db_xref="VGNC_trans_name:TXNL4A-201" FT /db_xref="Reactome:R-CFA-72163" FT /db_xref="Reactome:R-CFA-72165" FT /db_xref="Reactome:R-CFA-72172" FT /db_xref="Reactome:R-CFA-72203" FT /db_xref="Reactome:R-CFA-8953854" FT /db_xref="UniParc:UPI0000447A0B" FT /translation="MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVL FT YSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINW FT AMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY" FT gene complement(744461..746178) FT /gene=ENSCAFG00000031133.1 FT /locus_tag="HSBP1L1" FT /note="heat shock factor binding protein 1 like 1 FT [Source:VGNC Symbol;Acc:VGNC:53725]" FT mRNA join(complement(746112..746178),complement(744461..744552)) FT /gene="ENSCAFG00000031133.1" FT /standard_name="ENSCAFT00000045122.1" FT CDS join(complement(746112..746178),complement(744461..744552)) FT /gene="ENSCAFG00000031133.1" FT /protein_id="ENSCAFP00000038592.1" FT /note="transcript_id=ENSCAFT00000045122.1" FT /db_xref="RefSeq_mRNA_predicted:XM_003432558" FT /db_xref="RefSeq_peptide_predicted:XP_003432606" FT /db_xref="Uniprot/SPTREMBL:J9NZ72" FT /db_xref="EMBL:AAEX03000011" FT /db_xref="GO:0003714" FT /db_xref="GO:0005634" FT /db_xref="GO:0005737" FT /db_xref="GO:0005829" FT /db_xref="GO:0070370" FT /db_xref="GO:1903507" FT /db_xref="VGNC_trans_name:HSBP1L1-201" FT /db_xref="UniParc:UPI00027479F7" FT /translation="AENLFQELQEHFQALIATLNLRMEEMGSRLEDLQKNVNDLMVQAG FT VEDPVSEQ" FT gene complement(829658..866436) FT /gene=ENSCAFG00000039493.1 FT misc_RNA join(complement(865924..866436),complement(846078..846445), FT complement(841686..841787),complement(829658..829667)) FT /gene="ENSCAFG00000039493.1" FT /db_xref="RNAcentral:URS0000A92009" FT /note="lincRNA" FT /standard_name="ENSCAFT00000053567.1" FT misc_RNA join(complement(865924..866436),complement(846078..846445), FT complement(843054..843163),complement(841759..841787)) FT /gene="ENSCAFG00000039493.1" FT /db_xref="RNAcentral:URS0000A94E9D" FT /note="lincRNA" FT /standard_name="ENSCAFT00000055264.1" FT misc_RNA join(complement(865924..866436),complement(846078..846445), FT complement(845283..845439)) FT /gene="ENSCAFG00000039493.1" FT /db_xref="RNAcentral:URS0000AA5288" FT /note="lincRNA" FT /standard_name="ENSCAFT00000058711.1" FT gene complement(886083..886640) FT /gene=ENSCAFG00000028976.1 FT mRNA complement(886083..886640) FT /gene="ENSCAFG00000028976.1" FT /standard_name="ENSCAFT00000043602.1" FT CDS complement(886083..886640) FT /gene="ENSCAFG00000028976.1" FT /protein_id="ENSCAFP00000039366.1" FT /note="transcript_id=ENSCAFT00000043602.1" FT /db_xref="Uniprot/SPTREMBL:J9P1E2" FT /db_xref="EMBL:AAEX03000016" FT /db_xref="UniParc:UPI000274763D" FT /translation="MWTGWPMGVPEHCTAPAPYTGRSAQGPSPTSGSAPGPPHTHGPPA FT LGIPPRGPLSTQDYPPTWPPAPRTPLMWAPQQPGPPTQATSTEDHPHATPQHPGLPHPH FT PRGPSAPRTPPCGPSHGSPALGTPPCRPLSTKDPLPPPHPKSYGGWFPGSLFRVLPGPQ FT EDSPPNRAADAQSQHLVAFRCF" #Example output: ENSCAFG00000000008 GO:0000398, GO:0000398, GO:0005634, GO:0005682, GO:0005829, GO:0031965, GO:0046540, GO:0046540, GO:0046540, GO:0071005 ENSCAFG00000031133 GO:0003714, GO:0005634, GO:0005737, GO:0005829, GO:0070370, GO:1903507 #command: $ python Ensembl.dat-to-topGO.db.py -i input.table -o output.tab #contact: Dmytro Kryvokhyzha [email protected] ''' ############################# modules ############################# import calls # my custom module ############################# options ############################# parser = calls.CommandLineParser() parser.add_argument('-i', '--input', help = 'name of the input file', type=str, required=True) parser.add_argument('-o', '--output', help = 'name of the output file', type=str, required=True) args = parser.parse_args() ############################# program ############################# geneName = "geneName" dicts = {geneName: []} outfile = open(args.output, 'w') with open(args.input) as datafile: for line in datafile: if line.startswith("FT"): words = line.split() if '/gene="' in words[1]: if dicts[geneName] != []: GOprint = ', '.join(str(e) for e in dicts[geneName]) outfile.write("%s\t%s\n" % (list(dicts.keys())[0], GOprint)) geneName = words[1].split(".")[0].replace('/gene="', '') dicts = {geneName: []} elif '/db_xref="GO' in words[1]: GO = words[1].replace('/db_xref="', '').replace('"', '') dicts[geneName].append(GO) datafile.close() outfile.close() print('Done!') # dicts = {} # keys = range(4) # values = ["Hi", "I", "am", "John"] # for i in keys: # dicts[i] = values[i] # print(dicts)
[ 2, 0, 1220, 14629, 14, 8800, 14, 24330, 21015, 17, 198, 198, 7061, 6, 198, 1212, 4226, 26161, 262, 2039, 4428, 75, 13, 19608, 2393, 284, 262, 10351, 4941, 2393, 973, 287, 262, 1353, 11230, 371, 1430, 13, 198, 198, 2, 16281, 5128, 25, 198, 2389, 220, 220, 352, 220, 220, 220, 3210, 26, 7446, 26, 7154, 38, 26, 1105, 2075, 3695, 41172, 20997, 13, 198, 8051, 198, 2246, 220, 220, 34348, 25, 6090, 37, 321, 18, 13, 16, 25, 16, 25, 16, 25, 1065, 2075, 3695, 41172, 25, 16, 198, 8051, 198, 50, 53, 220, 220, 352, 13, 6090, 37, 321, 18, 13, 16, 198, 8051, 198, 24544, 220, 220, 604, 12, 5188, 47, 12, 7908, 198, 8051, 198, 7206, 220, 220, 1680, 271, 300, 929, 385, 5385, 271, 34348, 352, 1680, 37, 321, 18, 13, 16, 1336, 8379, 352, 492, 1065, 2075, 3695, 41172, 198, 7206, 220, 220, 24708, 515, 416, 2039, 4428, 75, 198, 8051, 198, 42, 54, 220, 220, 764, 198, 8051, 198, 2640, 220, 220, 1680, 271, 300, 929, 385, 5385, 271, 357, 9703, 8, 198, 4503, 220, 220, 412, 2724, 560, 4265, 26, 8670, 396, 71, 482, 756, 64, 26, 3395, 1031, 12162, 26, 412, 388, 316, 1031, 12162, 26, 24207, 729, 544, 26, 1024, 11894, 455, 296, 544, 26, 198, 4503, 220, 220, 609, 585, 1045, 26, 32919, 72, 1045, 26, 4643, 660, 1671, 1045, 26, 18509, 776, 455, 296, 1045, 26, 14318, 455, 12753, 26, 412, 1133, 293, 455, 12753, 26, 198, 4503, 220, 220, 311, 5605, 404, 11471, 70, 4178, 26, 43945, 1662, 316, 2416, 375, 296, 273, 7566, 26, 27351, 2416, 11329, 26, 1703, 8461, 4265, 26, 39502, 9752, 26, 12634, 544, 26, 198, 4503, 220, 220, 412, 12866, 544, 26, 45409, 2577, 12866, 544, 26, 13240, 17053, 1032, 544, 26, 19659, 452, 5799, 26, 1680, 6933, 544, 26, 1680, 31718, 26, 198, 4503, 220, 220, 1680, 271, 300, 929, 385, 13, 198, 8051, 198, 4093, 220, 220, 770, 8379, 373, 24708, 515, 416, 2039, 4428, 75, 7, 2503, 13, 1072, 2022, 75, 13, 2398, 737, 4222, 3187, 262, 198, 4093, 220, 220, 2039, 4428, 75, 393, 2039, 4428, 75, 13746, 2586, 3992, 2524, 11, 2638, 1378, 2503, 13, 1072, 2022, 75, 13, 2398, 14, 393, 198, 4093, 220, 220, 2638, 1378, 2503, 13, 1072, 2022, 75, 5235, 2586, 13, 2398, 14, 329, 517, 1321, 13, 198, 8051, 198, 4093, 220, 220, 1439, 3895, 7064, 389, 3585, 284, 262, 717, 357, 20, 11537, 2779, 286, 262, 8379, 198, 4093, 220, 220, 287, 428, 2393, 13, 220, 383, 8379, 5545, 318, 1464, 262, 2651, 37923, 286, 262, 198, 4093, 220, 220, 10474, 13, 17571, 326, 6486, 2354, 286, 262, 8379, 7763, 287, 428, 2393, 198, 4093, 220, 220, 423, 537, 20996, 4067, 22715, 287, 262, 5794, 25, 1279, 21018, 198, 4093, 220, 220, 1895, 295, 28401, 27, 9641, 31175, 27, 9688, 29, 492, 27, 437, 29, 198, 8051, 198, 4093, 220, 220, 383, 1220, 70, 1734, 9217, 257, 3748, 4686, 329, 257, 9779, 11, 1220, 11295, 2625, 7645, 6519, 62, 312, 28, 9313, 257, 198, 4093, 220, 220, 3748, 4686, 329, 257, 14687, 11, 1220, 48693, 62, 312, 257, 3748, 4686, 329, 257, 34337, 485, 290, 198, 4093, 220, 220, 3465, 2625, 1069, 261, 62, 312, 28, 9313, 257, 3748, 4686, 329, 281, 409, 261, 13, 2312, 220, 2340, 389, 9456, 198, 4093, 220, 220, 14530, 1744, 1022, 6300, 13, 198, 8051, 198, 4093, 220, 220, 1439, 262, 409, 684, 290, 29351, 287, 2039, 4428, 75, 389, 4999, 416, 26789, 284, 198, 4093, 220, 220, 2035, 7532, 393, 269, 28886, 16311, 13, 198, 8051, 198, 44602, 220, 220, 7383, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 13397, 14, 46181, 13350, 198, 9792, 220, 220, 2723, 220, 220, 220, 220, 220, 220, 220, 220, 220, 352, 492, 1065, 2075, 3695, 41172, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9971, 1042, 2625, 6090, 271, 300, 929, 385, 5385, 271, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 19290, 261, 25, 4846, 1314, 1, 198, 9792, 220, 220, 9779, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 767, 1828, 21738, 492, 22, 30743, 2682, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 28, 1677, 6173, 8579, 38, 8269, 25257, 13, 18, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 75, 10901, 62, 12985, 2625, 29551, 32572, 19, 32, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 400, 72, 1850, 39366, 588, 604, 32, 685, 7416, 25, 43490, 7792, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 38357, 26, 17320, 25, 43490, 7792, 25, 2780, 30484, 30866, 198, 9792, 220, 220, 47227, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 22, 1828, 21738, 492, 22, 22047, 1731, 11, 22, 1828, 49541, 492, 22, 23815, 3324, 11, 4790, 1314, 3682, 492, 4790, 1433, 2231, 11, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 767, 28978, 2548, 492, 22, 30743, 2682, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 8269, 25257, 13, 18, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 20307, 62, 3672, 2625, 1677, 6173, 8579, 51, 8269, 28694, 13, 18, 1, 198, 9792, 220, 220, 327, 5258, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 22, 24403, 1495, 492, 22, 23815, 3324, 11, 4790, 1314, 3682, 492, 4790, 1433, 2231, 11, 22, 28978, 2548, 492, 22, 2327, 28694, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 8269, 25257, 13, 18, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 48693, 62, 312, 2625, 1677, 6173, 17449, 8269, 25257, 13, 18, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 7645, 6519, 62, 312, 28, 1677, 6173, 8579, 51, 8269, 28694, 13, 18, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 76, 27204, 62, 28764, 5722, 25, 37643, 62, 405, 3980, 1314, 27988, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 76, 27204, 62, 28764, 5722, 25, 37643, 62, 44994, 35447, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 431, 457, 485, 62, 28764, 5722, 25, 27481, 62, 405, 3980, 1314, 20370, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 431, 457, 485, 62, 28764, 5722, 25, 27481, 62, 44087, 2075, 2623, 2154, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 431, 457, 485, 62, 28764, 5722, 25, 27481, 62, 44994, 35447, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3118, 541, 10599, 14, 4303, 51, 40726, 9148, 25, 36, 17, 49, 18638, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3620, 9148, 25, 3838, 6369, 3070, 2388, 1157, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 2388, 31952, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 2388, 31952, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 3980, 2682, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 20, 43950, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 3365, 1959, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 11245, 45271, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 22914, 2996, 1821, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 22914, 2996, 1821, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 22914, 2996, 1821, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 25816, 3064, 20, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 43490, 7792, 62, 7645, 62, 3672, 25, 29551, 32572, 19, 32, 12, 1264, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3041, 529, 462, 25, 49, 12, 34, 7708, 12, 4761, 24136, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3041, 529, 462, 25, 49, 12, 34, 7708, 12, 4761, 20986, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3041, 529, 462, 25, 49, 12, 34, 7708, 12, 4761, 23628, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3041, 529, 462, 25, 49, 12, 34, 7708, 12, 4761, 22416, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3041, 529, 462, 25, 49, 12, 34, 7708, 12, 23, 3865, 2548, 4051, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3118, 72, 47, 5605, 25, 8577, 40, 2388, 34825, 32, 15, 33, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 41519, 2625, 5653, 56, 5805, 47, 6581, 39, 10503, 54, 48, 8898, 48, 32, 4146, 5188, 1961, 49, 53, 53, 53, 4663, 30386, 10227, 54, 6322, 4825, 33907, 44, 39345, 43, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 575, 50, 3539, 36, 42, 53, 29132, 7708, 12861, 45448, 8898, 12709, 53, 20456, 46888, 26708, 30943, 6322, 4177, 15996, 5777, 10913, 46888, 39, 3955, 2389, 43, 19555, 38, 6144, 46888, 1268, 54, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3001, 1961, 42, 48, 3620, 2389, 3978, 2767, 53, 38162, 38, 14175, 10761, 8763, 53, 53, 4303, 42, 35, 56, 2257, 31159, 18276, 1, 198, 9792, 220, 220, 9779, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 22, 2598, 40652, 492, 22, 3510, 23188, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 28, 1677, 6173, 8579, 38, 10535, 36244, 2091, 13, 16, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 75, 10901, 62, 12985, 2625, 7998, 20866, 16, 43, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 25080, 6380, 5766, 12765, 7532, 352, 588, 352, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 685, 7416, 25, 43490, 7792, 38357, 26, 17320, 25, 43490, 7792, 25, 46096, 1495, 30866, 198, 9792, 220, 220, 47227, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 785, 26908, 7, 22, 3510, 14686, 492, 22, 3510, 23188, 828, 785, 26908, 7, 22, 2598, 40652, 492, 4524, 2231, 4309, 4008, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 36244, 2091, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 20307, 62, 3672, 2625, 1677, 6173, 8579, 51, 10535, 2231, 18376, 13, 16, 1, 198, 9792, 220, 220, 327, 5258, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 785, 26908, 7, 22, 3510, 14686, 492, 22, 3510, 23188, 828, 785, 26908, 7, 22, 2598, 40652, 492, 4524, 2231, 4309, 4008, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 36244, 2091, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 48693, 62, 312, 2625, 1677, 6173, 17449, 10535, 2548, 45839, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 7645, 6519, 62, 312, 28, 1677, 6173, 8579, 51, 10535, 2231, 18376, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 76, 27204, 62, 28764, 5722, 25, 37643, 62, 405, 2682, 26582, 3365, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 8134, 4653, 80, 62, 431, 457, 485, 62, 28764, 5722, 25, 27481, 62, 405, 2682, 2624, 33206, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3118, 541, 10599, 14, 4303, 51, 40726, 9148, 25, 41, 24, 37371, 4761, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3620, 9148, 25, 3838, 6369, 3070, 2388, 1157, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 2718, 1415, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 3980, 2682, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 3553, 2718, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 830, 3365, 1959, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 405, 2154, 20167, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 11230, 25, 1129, 3070, 35378, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 43490, 7792, 62, 7645, 62, 3672, 25, 7998, 20866, 16, 43, 16, 12, 1264, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3118, 72, 47, 5605, 25, 8577, 40, 830, 1983, 31714, 37, 22, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 41519, 2625, 32, 1677, 43, 37, 48, 3698, 48, 36, 29567, 48, 1847, 40, 1404, 43, 32572, 49, 11682, 3620, 14313, 7836, 1961, 43, 48, 42, 27159, 8575, 31288, 53, 48, 4760, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 569, 1961, 47, 53, 5188, 48, 1, 198, 9792, 220, 220, 9779, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 23, 1959, 38431, 492, 4521, 2414, 2623, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 28, 1677, 6173, 8579, 38, 10535, 2670, 43134, 13, 16, 198, 9792, 220, 220, 12747, 62, 27204, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 785, 26908, 7, 23, 36445, 1731, 492, 4521, 2414, 2623, 828, 785, 26908, 7, 5705, 1899, 3695, 492, 5705, 2414, 2231, 828, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 5705, 1433, 4521, 492, 5705, 1558, 5774, 828, 785, 26908, 7, 23, 1959, 38431, 492, 23, 1959, 28933, 4008, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 2670, 43134, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 27204, 31463, 25, 4261, 50, 2388, 32, 24, 10531, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 75, 1939, 27204, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 20307, 62, 3672, 2625, 1677, 6173, 8579, 51, 10535, 44465, 3134, 13, 16, 1, 198, 9792, 220, 220, 12747, 62, 27204, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 785, 26908, 7, 23, 36445, 1731, 492, 4521, 2414, 2623, 828, 785, 26908, 7, 5705, 1899, 3695, 492, 5705, 2414, 2231, 828, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 5705, 1270, 4051, 492, 23, 3559, 24136, 828, 785, 26908, 7, 5705, 1558, 3270, 492, 5705, 1558, 5774, 4008, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 2670, 43134, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 27204, 31463, 25, 4261, 50, 2388, 32, 5824, 36, 24, 35, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 75, 1939, 27204, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 20307, 62, 3672, 2625, 1677, 6173, 8579, 51, 10535, 2816, 18897, 13, 16, 1, 198, 9792, 220, 220, 12747, 62, 27204, 220, 220, 220, 220, 220, 220, 220, 4654, 7, 785, 26908, 7, 23, 36445, 1731, 492, 4521, 2414, 2623, 828, 785, 26908, 7, 5705, 1899, 3695, 492, 5705, 2414, 2231, 828, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 23, 2231, 30290, 492, 23, 34229, 2670, 4008, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 2670, 43134, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 27204, 31463, 25, 4261, 50, 2388, 3838, 20, 25270, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 75, 1939, 27204, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 20307, 62, 3672, 2625, 1677, 6173, 8579, 51, 10535, 44617, 1157, 13, 16, 1, 198, 9792, 220, 220, 9779, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 3459, 1899, 5999, 492, 3459, 2791, 1821, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 28, 1677, 6173, 8579, 38, 10535, 27693, 4304, 13, 16, 198, 9792, 220, 220, 47227, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 3459, 1899, 5999, 492, 3459, 2791, 1821, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 27693, 4304, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 20307, 62, 3672, 2625, 1677, 6173, 8579, 51, 10535, 3559, 31418, 13, 16, 1, 198, 9792, 220, 220, 327, 5258, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16829, 7, 3459, 1899, 5999, 492, 3459, 2791, 1821, 8, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 70, 1734, 2625, 1677, 6173, 8579, 38, 10535, 27693, 4304, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 48693, 62, 312, 2625, 1677, 6173, 17449, 10535, 2670, 32459, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 11295, 2625, 7645, 6519, 62, 312, 28, 1677, 6173, 8579, 51, 10535, 3559, 31418, 13, 16, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3118, 541, 10599, 14, 4303, 51, 40726, 9148, 25, 41, 24, 47, 16, 36, 17, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3620, 9148, 25, 3838, 6369, 3070, 2388, 1433, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 9945, 62, 87, 5420, 2625, 3118, 72, 47, 5605, 25, 8577, 40, 830, 1983, 2857, 5066, 35, 1, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1220, 41519, 2625, 14326, 51, 33191, 5868, 38, 8859, 42413, 4177, 2969, 2969, 56, 51, 10761, 4090, 48, 38, 3705, 47, 4694, 14313, 2969, 38, 10246, 39, 4221, 16960, 4537, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 17370, 4061, 4805, 38, 6489, 2257, 48, 35, 56, 10246, 34551, 10246, 2969, 14181, 6489, 14326, 2969, 48, 48, 6968, 10246, 51, 48, 1404, 2257, 1961, 39, 11909, 1404, 47, 48, 39, 6968, 43, 11909, 11909, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4810, 38, 3705, 2969, 49, 7250, 5662, 38, 3705, 39, 38, 4303, 1847, 38, 7250, 5662, 49, 6489, 2257, 42, 6322, 43, 10246, 11909, 40492, 23060, 11190, 54, 5837, 38, 8634, 10913, 47468, 6968, 47, 48, 198, 9792, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 8392, 4303, 13137, 3861, 26853, 48, 50, 48, 6581, 53, 8579, 7397, 37, 1, 628, 198, 2, 16281, 5072, 25, 198, 198, 1677, 6173, 8579, 38, 8269, 25257, 197, 11230, 25, 2388, 31952, 11, 10351, 25, 2388, 31952, 11, 10351, 25, 830, 3980, 2682, 11, 10351, 25, 830, 20, 43950, 11, 10351, 25, 830, 3365, 1959, 11, 10351, 25, 11245, 45271, 11, 10351, 25, 22914, 2996, 1821, 11, 10351, 25, 22914, 2996, 1821, 11, 10351, 25, 22914, 2996, 1821, 11, 10351, 25, 25816, 3064, 20, 198, 1677, 6173, 8579, 38, 10535, 36244, 2091, 197, 11230, 25, 830, 2718, 1415, 11, 10351, 25, 830, 3980, 2682, 11, 10351, 25, 830, 3553, 2718, 11, 10351, 25, 830, 3365, 1959, 11, 10351, 25, 405, 2154, 20167, 11, 10351, 25, 1129, 3070, 35378, 628, 198, 2, 21812, 25, 198, 198, 3, 21015, 2039, 4428, 75, 13, 19608, 12, 1462, 12, 4852, 11230, 13, 9945, 13, 9078, 532, 72, 5128, 13, 11487, 532, 78, 5072, 13, 8658, 198, 198, 2, 32057, 25, 198, 198, 35, 1820, 23528, 41662, 85, 482, 12114, 89, 3099, 288, 1820, 23528, 13, 74, 563, 85, 482, 12114, 89, 3099, 31, 1990, 672, 952, 13, 12496, 198, 198, 7061, 6, 628, 198, 14468, 7804, 4242, 2, 13103, 1303, 14468, 7804, 4242, 198, 198, 11748, 3848, 1303, 616, 2183, 8265, 198, 198, 14468, 7804, 4242, 2, 3689, 1303, 14468, 7804, 4242, 198, 198, 48610, 796, 3848, 13, 21575, 13949, 46677, 3419, 198, 48610, 13, 2860, 62, 49140, 10786, 12, 72, 3256, 705, 438, 15414, 3256, 1037, 796, 705, 3672, 286, 262, 5128, 2393, 3256, 2099, 28, 2536, 11, 2672, 28, 17821, 8, 198, 48610, 13, 2860, 62, 49140, 10786, 12, 78, 3256, 705, 438, 22915, 3256, 1037, 796, 705, 3672, 286, 262, 5072, 2393, 3256, 2099, 28, 2536, 11, 2672, 28, 17821, 8, 198, 22046, 796, 30751, 13, 29572, 62, 22046, 3419, 198, 198, 14468, 7804, 4242, 2, 1430, 1303, 14468, 7804, 4242, 198, 198, 70, 1734, 5376, 796, 366, 70, 1734, 5376, 1, 198, 11600, 82, 796, 1391, 70, 1734, 5376, 25, 17635, 92, 198, 198, 448, 7753, 796, 1280, 7, 22046, 13, 22915, 11, 705, 86, 11537, 198, 198, 4480, 1280, 7, 22046, 13, 15414, 8, 355, 1366, 7753, 25, 198, 220, 329, 1627, 287, 1366, 7753, 25, 198, 220, 220, 220, 611, 1627, 13, 9688, 2032, 342, 7203, 9792, 1, 2599, 198, 220, 220, 220, 220, 220, 2456, 796, 1627, 13, 35312, 3419, 198, 220, 220, 220, 220, 220, 611, 31051, 70, 1734, 2625, 6, 287, 2456, 58, 16, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 611, 8633, 82, 58, 70, 1734, 5376, 60, 14512, 685, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10351, 4798, 796, 46083, 45302, 22179, 7, 2536, 7, 68, 8, 329, 304, 287, 8633, 82, 58, 70, 1734, 5376, 12962, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 503, 7753, 13, 13564, 7203, 4, 82, 59, 83, 4, 82, 59, 77, 1, 4064, 357, 4868, 7, 11600, 82, 13, 13083, 28955, 58, 15, 4357, 10351, 4798, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 9779, 5376, 796, 2456, 58, 16, 4083, 35312, 7203, 19570, 58, 15, 4083, 33491, 10786, 14, 70, 1734, 2625, 3256, 10148, 8, 198, 220, 220, 220, 220, 220, 220, 220, 8633, 82, 796, 1391, 70, 1734, 5376, 25, 17635, 92, 198, 220, 220, 220, 220, 220, 1288, 361, 31051, 9945, 62, 87, 5420, 2625, 11230, 6, 287, 2456, 58, 16, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 10351, 796, 2456, 58, 16, 4083, 33491, 10786, 14, 9945, 62, 87, 5420, 2625, 3256, 10148, 737, 33491, 10786, 1, 3256, 10148, 8, 198, 220, 220, 220, 220, 220, 220, 220, 8633, 82, 58, 70, 1734, 5376, 4083, 33295, 7, 11230, 8, 198, 198, 7890, 7753, 13, 19836, 3419, 198, 448, 7753, 13, 19836, 3419, 198, 198, 4798, 10786, 45677, 0, 11537, 198, 2, 8633, 82, 796, 23884, 198, 2, 8251, 796, 2837, 7, 19, 8, 198, 2, 3815, 796, 14631, 17250, 1600, 366, 40, 1600, 366, 321, 1600, 366, 7554, 8973, 198, 2, 329, 1312, 287, 8251, 25, 198, 2, 220, 220, 220, 220, 220, 220, 220, 220, 8633, 82, 58, 72, 60, 796, 3815, 58, 72, 60, 198, 2, 3601, 7, 11600, 82, 8 ]
1.818611
5,083
import os import numpy as np import scipy.spatial as scsp import scipy.linalg as scli
[ 11748, 28686, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 629, 541, 88, 13, 2777, 34961, 355, 629, 2777, 198, 11748, 629, 541, 88, 13, 75, 1292, 70, 355, 264, 44506, 628, 628, 628, 628, 628 ]
2.638889
36
import json
[ 11748, 33918, 198 ]
4
3
# Copyright 2013 Mirantis, Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); you may # not use this file except in compliance with the License. You may obtain # a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, WITHOUT # WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the # License for the specific language governing permissions and limitations # under the License. import unittest2 from mock import patch, MagicMock from sqlalchemy import create_engine from sqlalchemy.orm import sessionmaker from fuel_plugin.ostf_adapter import config from fuel_plugin.ostf_adapter.nose_plugin.nose_discovery import discovery from fuel_plugin.ostf_adapter.storage import models from fuel_plugin.ostf_adapter import mixins TEST_PATH = 'fuel_plugin/testing/fixture/dummy_tests'
[ 2, 220, 220, 220, 15069, 2211, 7381, 20836, 11, 3457, 13, 198, 2, 198, 2, 220, 220, 220, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 345, 743, 198, 2, 220, 220, 220, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789, 13, 921, 743, 7330, 198, 2, 220, 220, 220, 257, 4866, 286, 262, 13789, 379, 198, 2, 198, 2, 220, 220, 220, 220, 220, 220, 220, 220, 2638, 1378, 2503, 13, 43073, 13, 2398, 14, 677, 4541, 14, 43, 2149, 24290, 12, 17, 13, 15, 198, 2, 198, 2, 220, 220, 220, 17486, 2672, 416, 9723, 1099, 393, 4987, 284, 287, 3597, 11, 3788, 198, 2, 220, 220, 220, 9387, 739, 262, 13789, 318, 9387, 319, 281, 366, 1921, 3180, 1, 29809, 1797, 11, 42881, 198, 2, 220, 220, 220, 34764, 11015, 6375, 7102, 49828, 11053, 3963, 15529, 509, 12115, 11, 2035, 4911, 393, 17142, 13, 4091, 262, 198, 2, 220, 220, 220, 13789, 329, 262, 2176, 3303, 15030, 21627, 290, 11247, 198, 2, 220, 220, 220, 739, 262, 13789, 13, 628, 198, 11748, 555, 715, 395, 17, 198, 6738, 15290, 1330, 8529, 11, 6139, 44, 735, 198, 6738, 44161, 282, 26599, 1330, 2251, 62, 18392, 198, 6738, 44161, 282, 26599, 13, 579, 1330, 6246, 10297, 198, 198, 6738, 5252, 62, 33803, 13, 455, 69, 62, 324, 3429, 1330, 4566, 198, 6738, 5252, 62, 33803, 13, 455, 69, 62, 324, 3429, 13, 77, 577, 62, 33803, 13, 77, 577, 62, 67, 40821, 1330, 9412, 198, 6738, 5252, 62, 33803, 13, 455, 69, 62, 324, 3429, 13, 35350, 1330, 4981, 198, 6738, 5252, 62, 33803, 13, 455, 69, 62, 324, 3429, 1330, 5022, 1040, 198, 198, 51, 6465, 62, 34219, 796, 705, 25802, 62, 33803, 14, 33407, 14, 69, 9602, 14, 67, 13513, 62, 41989, 6, 628 ]
3.300654
306
from CHECLabPy.core.io import TIOReader from TargetCalibSB.pedestal import PedestalTargetCalib import fitsio from tqdm import tqdm from matplotlib import pyplot as plt import numpy as np if __name__ == '__main__': main()
[ 6738, 5870, 2943, 17822, 20519, 13, 7295, 13, 952, 1330, 31598, 1581, 1329, 263, 198, 6738, 12744, 9771, 571, 16811, 13, 9124, 395, 282, 1330, 13457, 395, 282, 21745, 9771, 571, 198, 11748, 11414, 952, 198, 6738, 256, 80, 36020, 1330, 256, 80, 36020, 198, 6738, 2603, 29487, 8019, 1330, 12972, 29487, 355, 458, 83, 198, 11748, 299, 32152, 355, 45941, 628, 198, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 1388, 3419, 198 ]
2.814815
81
import pandas as pd import numpy as np import xgboost as xgb import lightgbm as lgb import pyarrow as pa import pyarrow.parquet as pq from sklearn.model_selection import train_test_split import argparse from scipy.special import erfinv from scipy.sparse import csr_matrix from sklearn.preprocessing import StandardScaler from utils import * X, X_test, _ = read_train_test_data() # drop label encoding lbl_cols = [col for col in X.columns if "_labelencod" in col] X.drop(lbl_cols, axis=1, inplace=True) X_test.drop(lbl_cols, axis=1, inplace=True) # nan index train_nan_idx = csr_matrix((np.isnan(X)).astype(int)) test_nan_idx = csr_matrix((np.isnan(X_test)).astype(int)) X = X.fillna(X.median())#X.fillna(X.median()) # X.fillna(0) X = X.replace(np.inf, 99999.999) X = X.replace(-np.inf, -99999.999) X = X.values X_test = X_test.fillna(X_test.median())#X_test.fillna(X_test.median()) X_test = X_test.replace(np.inf, 9999.999) X_test = X_test.replace(-np.inf, -9999.999) X_test = X_test.values train_size = X.shape[0] print("scale data") scaler = StandardScaler()#StandardScaler() # GaussRankScaler() X_all = scaler.fit_transform(np.r_[X, X_test]) del X, X_test; gc.collect() # X = pd.DataFrame(X_all[:train_size,:]) X = pd.DataFrame(X_all[:train_size,:] * np.array((train_nan_idx.todense()==0).astype(int))) del train_nan_idx print("Done scaling train data...") # X_test = pd.DataFrame(X_all[train_size:,:]) X_test = pd.DataFrame(X_all[train_size:,:] * np.array((test_nan_idx.todense()==0).astype(int))) print("Done scaling test data...") # del X_all; gc.collect() del X_all, test_nan_idx;gc.collect() X_test = X_test.values X = X.values y = pd.read_csv("../input/train.csv")["deal_probability"].values oof_sgd(X, X_test, y, "stacking_elasticnet") ### no oof features X, X_test, _ = read_train_test_data_all() # drop label encoding lbl_cols = [col for col in X.columns if "_labelencod" in col or "oof_" in col] X.drop(lbl_cols, axis=1, inplace=True) X_test.drop(lbl_cols, axis=1, inplace=True) # nan index train_nan_idx = csr_matrix((np.isnan(X)).astype(int)) test_nan_idx = csr_matrix((np.isnan(X_test)).astype(int)) X = X.fillna(X.median())#X.fillna(X.median()) # X.fillna(0) X = X.replace(np.inf, 99999.999) X = X.replace(-np.inf, -99999.999) X = X.values X_test = X_test.fillna(X_test.median())#X_test.fillna(X_test.median()) X_test = X_test.replace(np.inf, 9999.999) X_test = X_test.replace(-np.inf, -9999.999) X_test = X_test.values train_size = X.shape[0] print("scale data") scaler = StandardScaler()#StandardScaler() # GaussRankScaler() X_all = scaler.fit_transform(np.r_[X, X_test]) del X, X_test; gc.collect() # X = pd.DataFrame(X_all[:train_size,:]) X = pd.DataFrame(X_all[:train_size,:] * np.array((train_nan_idx.todense()==0).astype(int))) del train_nan_idx print("Done scaling train data...") # X_test = pd.DataFrame(X_all[train_size:,:]) X_test = pd.DataFrame(X_all[train_size:,:] * np.array((test_nan_idx.todense()==0).astype(int))) print("Done scaling test data...") # del X_all; gc.collect() del X_all, test_nan_idx;gc.collect() X_test = X_test.values X = X.values y = pd.read_csv("../input/train.csv")["deal_probability"].values oof_sgd(X, X_test, y, "stacking_elasticnet_nooof")
[ 11748, 19798, 292, 355, 279, 67, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 2124, 70, 39521, 355, 2124, 22296, 198, 11748, 1657, 70, 20475, 355, 300, 22296, 198, 11748, 12972, 6018, 355, 14187, 198, 11748, 12972, 6018, 13, 1845, 21108, 355, 279, 80, 198, 6738, 1341, 35720, 13, 19849, 62, 49283, 1330, 4512, 62, 9288, 62, 35312, 198, 11748, 1822, 29572, 198, 6738, 629, 541, 88, 13, 20887, 1330, 1931, 15643, 85, 198, 6738, 629, 541, 88, 13, 82, 29572, 1330, 269, 27891, 62, 6759, 8609, 198, 6738, 1341, 35720, 13, 3866, 36948, 1330, 8997, 3351, 36213, 198, 6738, 3384, 4487, 1330, 1635, 628, 198, 55, 11, 1395, 62, 9288, 11, 4808, 796, 1100, 62, 27432, 62, 9288, 62, 7890, 3419, 198, 2, 4268, 6167, 21004, 198, 75, 2436, 62, 4033, 82, 796, 685, 4033, 329, 951, 287, 1395, 13, 28665, 82, 611, 45434, 18242, 12685, 375, 1, 287, 951, 60, 198, 55, 13, 14781, 7, 75, 2436, 62, 4033, 82, 11, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 55, 62, 9288, 13, 14781, 7, 75, 2436, 62, 4033, 82, 11, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 198, 2, 15709, 6376, 198, 27432, 62, 12647, 62, 312, 87, 796, 269, 27891, 62, 6759, 8609, 19510, 37659, 13, 271, 12647, 7, 55, 29720, 459, 2981, 7, 600, 4008, 198, 9288, 62, 12647, 62, 312, 87, 796, 269, 27891, 62, 6759, 8609, 19510, 37659, 13, 271, 12647, 7, 55, 62, 9288, 29720, 459, 2981, 7, 600, 4008, 198, 55, 796, 1395, 13, 20797, 2616, 7, 55, 13, 1150, 666, 28955, 2, 55, 13, 20797, 2616, 7, 55, 13, 1150, 666, 28955, 1303, 1395, 13, 20797, 2616, 7, 15, 8, 198, 55, 796, 1395, 13, 33491, 7, 37659, 13, 10745, 11, 860, 24214, 13, 17032, 8, 198, 55, 796, 1395, 13, 33491, 32590, 37659, 13, 10745, 11, 532, 2079, 17032, 13, 17032, 8, 198, 55, 796, 1395, 13, 27160, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 20797, 2616, 7, 55, 62, 9288, 13, 1150, 666, 28955, 2, 55, 62, 9288, 13, 20797, 2616, 7, 55, 62, 9288, 13, 1150, 666, 28955, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 33491, 7, 37659, 13, 10745, 11, 860, 17032, 13, 17032, 8, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 33491, 32590, 37659, 13, 10745, 11, 532, 24214, 13, 17032, 8, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 27160, 198, 27432, 62, 7857, 796, 1395, 13, 43358, 58, 15, 60, 628, 198, 4798, 7203, 9888, 1366, 4943, 198, 1416, 36213, 796, 8997, 3351, 36213, 3419, 2, 23615, 3351, 36213, 3419, 1303, 12822, 1046, 27520, 3351, 36213, 3419, 198, 55, 62, 439, 796, 16578, 263, 13, 11147, 62, 35636, 7, 37659, 13, 81, 62, 58, 55, 11, 1395, 62, 9288, 12962, 198, 12381, 1395, 11, 1395, 62, 9288, 26, 308, 66, 13, 33327, 3419, 198, 2, 1395, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 25, 27432, 62, 7857, 11, 25, 12962, 198, 55, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 25, 27432, 62, 7857, 11, 47715, 1635, 45941, 13, 18747, 19510, 27432, 62, 12647, 62, 312, 87, 13, 83, 375, 1072, 3419, 855, 15, 737, 459, 2981, 7, 600, 22305, 198, 12381, 4512, 62, 12647, 62, 312, 87, 198, 4798, 7203, 45677, 20796, 4512, 1366, 9313, 8, 198, 2, 1395, 62, 9288, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 27432, 62, 7857, 45299, 25, 12962, 198, 55, 62, 9288, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 27432, 62, 7857, 45299, 47715, 1635, 45941, 13, 18747, 19510, 9288, 62, 12647, 62, 312, 87, 13, 83, 375, 1072, 3419, 855, 15, 737, 459, 2981, 7, 600, 22305, 198, 4798, 7203, 45677, 20796, 1332, 1366, 9313, 8, 198, 2, 1619, 1395, 62, 439, 26, 308, 66, 13, 33327, 3419, 198, 12381, 1395, 62, 439, 11, 1332, 62, 12647, 62, 312, 87, 26, 36484, 13, 33327, 3419, 628, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 27160, 198, 55, 796, 1395, 13, 27160, 198, 88, 796, 279, 67, 13, 961, 62, 40664, 7203, 40720, 15414, 14, 27432, 13, 40664, 4943, 14692, 31769, 62, 1676, 65, 1799, 1, 4083, 27160, 198, 198, 37711, 62, 82, 21287, 7, 55, 11, 1395, 62, 9288, 11, 331, 11, 366, 301, 5430, 62, 417, 3477, 3262, 4943, 198, 198, 21017, 645, 267, 1659, 3033, 198, 55, 11, 1395, 62, 9288, 11, 4808, 796, 1100, 62, 27432, 62, 9288, 62, 7890, 62, 439, 3419, 198, 2, 4268, 6167, 21004, 198, 75, 2436, 62, 4033, 82, 796, 685, 4033, 329, 951, 287, 1395, 13, 28665, 82, 611, 45434, 18242, 12685, 375, 1, 287, 951, 393, 366, 37711, 62, 1, 287, 951, 60, 198, 55, 13, 14781, 7, 75, 2436, 62, 4033, 82, 11, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 55, 62, 9288, 13, 14781, 7, 75, 2436, 62, 4033, 82, 11, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 198, 2, 15709, 6376, 198, 27432, 62, 12647, 62, 312, 87, 796, 269, 27891, 62, 6759, 8609, 19510, 37659, 13, 271, 12647, 7, 55, 29720, 459, 2981, 7, 600, 4008, 198, 9288, 62, 12647, 62, 312, 87, 796, 269, 27891, 62, 6759, 8609, 19510, 37659, 13, 271, 12647, 7, 55, 62, 9288, 29720, 459, 2981, 7, 600, 4008, 198, 55, 796, 1395, 13, 20797, 2616, 7, 55, 13, 1150, 666, 28955, 2, 55, 13, 20797, 2616, 7, 55, 13, 1150, 666, 28955, 1303, 1395, 13, 20797, 2616, 7, 15, 8, 198, 55, 796, 1395, 13, 33491, 7, 37659, 13, 10745, 11, 860, 24214, 13, 17032, 8, 198, 55, 796, 1395, 13, 33491, 32590, 37659, 13, 10745, 11, 532, 2079, 17032, 13, 17032, 8, 198, 55, 796, 1395, 13, 27160, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 20797, 2616, 7, 55, 62, 9288, 13, 1150, 666, 28955, 2, 55, 62, 9288, 13, 20797, 2616, 7, 55, 62, 9288, 13, 1150, 666, 28955, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 33491, 7, 37659, 13, 10745, 11, 860, 17032, 13, 17032, 8, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 33491, 32590, 37659, 13, 10745, 11, 532, 24214, 13, 17032, 8, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 27160, 198, 27432, 62, 7857, 796, 1395, 13, 43358, 58, 15, 60, 628, 198, 4798, 7203, 9888, 1366, 4943, 198, 1416, 36213, 796, 8997, 3351, 36213, 3419, 2, 23615, 3351, 36213, 3419, 1303, 12822, 1046, 27520, 3351, 36213, 3419, 198, 55, 62, 439, 796, 16578, 263, 13, 11147, 62, 35636, 7, 37659, 13, 81, 62, 58, 55, 11, 1395, 62, 9288, 12962, 198, 12381, 1395, 11, 1395, 62, 9288, 26, 308, 66, 13, 33327, 3419, 198, 2, 1395, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 25, 27432, 62, 7857, 11, 25, 12962, 198, 55, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 25, 27432, 62, 7857, 11, 47715, 1635, 45941, 13, 18747, 19510, 27432, 62, 12647, 62, 312, 87, 13, 83, 375, 1072, 3419, 855, 15, 737, 459, 2981, 7, 600, 22305, 198, 12381, 4512, 62, 12647, 62, 312, 87, 198, 4798, 7203, 45677, 20796, 4512, 1366, 9313, 8, 198, 2, 1395, 62, 9288, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 27432, 62, 7857, 45299, 25, 12962, 198, 55, 62, 9288, 796, 279, 67, 13, 6601, 19778, 7, 55, 62, 439, 58, 27432, 62, 7857, 45299, 47715, 1635, 45941, 13, 18747, 19510, 9288, 62, 12647, 62, 312, 87, 13, 83, 375, 1072, 3419, 855, 15, 737, 459, 2981, 7, 600, 22305, 198, 4798, 7203, 45677, 20796, 1332, 1366, 9313, 8, 198, 2, 1619, 1395, 62, 439, 26, 308, 66, 13, 33327, 3419, 198, 12381, 1395, 62, 439, 11, 1332, 62, 12647, 62, 312, 87, 26, 36484, 13, 33327, 3419, 628, 198, 55, 62, 9288, 796, 1395, 62, 9288, 13, 27160, 198, 55, 796, 1395, 13, 27160, 198, 88, 796, 279, 67, 13, 961, 62, 40664, 7203, 40720, 15414, 14, 27432, 13, 40664, 4943, 14692, 31769, 62, 1676, 65, 1799, 1, 4083, 27160, 198, 198, 37711, 62, 82, 21287, 7, 55, 11, 1395, 62, 9288, 11, 331, 11, 366, 301, 5430, 62, 417, 3477, 3262, 62, 77, 2238, 1659, 4943, 198 ]
2.324891
1,382
argo["salinity"].sel(level=10).plot.line()
[ 9448, 14692, 21680, 6269, 1, 4083, 741, 7, 5715, 28, 940, 737, 29487, 13, 1370, 3419 ]
2.625
16
import numpy as np import matplotlib.pyplot as plt from skimage import io import cv2 # 参考記事:https://qiita.com/haru1843/items/00de955790d3a22a217b img = io.imread("./dataset/images/imori_256x256.png") gray_img = cv2.cvtColor(img, cv2.COLOR_RGB2GRAY) th = getThreshold(gray_img) binary_img = gray2binary(gray_img, th) plt.figure(figsize=(12, 4)) plt.subplot(1, 3, 1) plt.title("input") plt.imshow(img) plt.subplot(1, 3, 2) plt.title("gray") plt.imshow(gray_img, cmap='gray') plt.subplot(1, 3, 3) plt.title("binary") plt.imshow(binary_img, cmap="gray") plt.show()
[ 11748, 299, 32152, 355, 45941, 198, 11748, 2603, 29487, 8019, 13, 9078, 29487, 355, 458, 83, 198, 6738, 1341, 9060, 1330, 33245, 198, 11748, 269, 85, 17, 628, 198, 2, 10263, 237, 224, 32003, 225, 164, 101, 246, 12859, 233, 171, 120, 248, 5450, 1378, 40603, 5350, 13, 785, 14, 9869, 84, 1507, 3559, 14, 23814, 14, 405, 2934, 24, 2816, 37750, 67, 18, 64, 1828, 64, 24591, 65, 628, 198, 198, 9600, 796, 33245, 13, 320, 961, 7, 1911, 14, 19608, 292, 316, 14, 17566, 14, 320, 10145, 62, 11645, 87, 11645, 13, 11134, 4943, 198, 44605, 62, 9600, 796, 269, 85, 17, 13, 33967, 83, 10258, 7, 9600, 11, 269, 85, 17, 13, 46786, 62, 36982, 17, 38, 30631, 8, 198, 400, 796, 651, 817, 10126, 7, 44605, 62, 9600, 8, 198, 39491, 62, 9600, 796, 12768, 17, 39491, 7, 44605, 62, 9600, 11, 294, 8, 198, 198, 489, 83, 13, 26875, 7, 5647, 7857, 16193, 1065, 11, 604, 4008, 198, 489, 83, 13, 7266, 29487, 7, 16, 11, 513, 11, 352, 8, 198, 489, 83, 13, 7839, 7203, 15414, 4943, 198, 489, 83, 13, 320, 12860, 7, 9600, 8, 198, 489, 83, 13, 7266, 29487, 7, 16, 11, 513, 11, 362, 8, 198, 489, 83, 13, 7839, 7203, 44605, 4943, 198, 489, 83, 13, 320, 12860, 7, 44605, 62, 9600, 11, 269, 8899, 11639, 44605, 11537, 198, 489, 83, 13, 7266, 29487, 7, 16, 11, 513, 11, 513, 8, 198, 489, 83, 13, 7839, 7203, 39491, 4943, 198, 489, 83, 13, 320, 12860, 7, 39491, 62, 9600, 11, 269, 8899, 2625, 44605, 4943, 198, 489, 83, 13, 12860, 3419, 198 ]
2.076923
273
from sqlite3 import Row from pydantic import BaseModel
[ 6738, 44161, 578, 18, 1330, 11314, 198, 198, 6738, 279, 5173, 5109, 1330, 7308, 17633, 628, 198 ]
3.411765
17
from .boxloss import * from .focalloss import * from .multitaskloss import *
[ 6738, 764, 3524, 22462, 1330, 1635, 198, 6738, 764, 69, 420, 439, 793, 1330, 1635, 198, 6738, 764, 16680, 270, 2093, 22462, 1330, 1635, 198 ]
3.08
25
import os import time import numpy as np import pandas as pd from sklearn.linear_model import LinearRegression from sklearn.model_selection import cross_val_score import sys sys.path.append('..') from utils import calHarDist DATA_DIR = '../datasets' for filename in ['modified_train.csv']: print('reading training data from %s ...' % filename) df = pd.read_csv(os.path.join(DATA_DIR, filename)) c = df.corr().abs() print(c) y = df['DURATION'] # df['displacement'] = df.apply(lambda row : calHarDist(row['ORIGIN_LAT'], row['ORIGIN_LNG'], row['CUT_OFF_LAT'], row['CUT_OFF_LNG']), axis = 1) df.drop(['TRIP_ID','TIMESTAMP','DATE', 'END_TIME', 'ORIGIN_CALL', 'ORIGIN_STAND', 'DURATION'], axis=1, inplace=True) # values = {'ORIGIN_CALL': -1, 'ORIGIN_STAND': -1} # df = df.fillna(value=values) X = np.array(df, dtype=np.float) # th1 = np.percentile(df['displacement'], [99.9])[0] # relevant_rows = (df['displacement'] < th1) # df.drop(['displacement'], axis=1, inplace=True) # X = df.loc[relevant_rows] # y = y.loc[relevant_rows] t0 = time.time() reg = LinearRegression().fit(X, y) print(reg.score(X, y)) print('Done in %.1f sec.' % (time.time() - t0)) df = pd.read_csv(os.path.join(DATA_DIR, filename.replace('train', 'test'))) ids = df['TRIP_ID'] df.drop(['TRIP_ID','TIMESTAMP','DATE', 'END_TIME', 'ORIGIN_CALL', 'ORIGIN_STAND'], axis=1, inplace=True) # values = {'ORIGIN_CALL': -1, 'ORIGIN_STAND': -1} # df = df.fillna(value=values) X_tst = np.array(df, dtype=np.float) y_pred = reg.predict(X_tst) submission = pd.DataFrame(ids, columns=['TRIP_ID']) submission['TRAVEL_TIME'] = y_pred submission.to_csv('../datasets/my_submission.csv', index=False)
[ 11748, 28686, 198, 11748, 640, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 19798, 292, 355, 279, 67, 198, 6738, 1341, 35720, 13, 29127, 62, 19849, 1330, 44800, 8081, 2234, 198, 6738, 1341, 35720, 13, 19849, 62, 49283, 1330, 3272, 62, 2100, 62, 26675, 198, 11748, 25064, 198, 17597, 13, 6978, 13, 33295, 10786, 492, 11537, 198, 6738, 3384, 4487, 1330, 2386, 13587, 20344, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 198, 26947, 62, 34720, 796, 705, 40720, 19608, 292, 1039, 6, 198, 198, 1640, 29472, 287, 37250, 41771, 62, 27432, 13, 40664, 6, 5974, 198, 220, 220, 220, 3601, 10786, 25782, 3047, 1366, 422, 4064, 82, 2644, 6, 4064, 29472, 8, 198, 220, 220, 220, 47764, 796, 279, 67, 13, 961, 62, 40664, 7, 418, 13, 6978, 13, 22179, 7, 26947, 62, 34720, 11, 29472, 4008, 198, 220, 220, 220, 269, 796, 47764, 13, 10215, 81, 22446, 8937, 3419, 198, 220, 220, 220, 3601, 7, 66, 8, 198, 220, 220, 220, 331, 796, 47764, 17816, 35, 4261, 6234, 20520, 198, 220, 220, 220, 1303, 47764, 17816, 6381, 489, 5592, 20520, 796, 47764, 13, 39014, 7, 50033, 5752, 1058, 2386, 13587, 20344, 7, 808, 17816, 1581, 3528, 1268, 62, 43, 1404, 6, 4357, 5752, 17816, 1581, 3528, 1268, 62, 43, 10503, 6, 4357, 5752, 17816, 34, 3843, 62, 27977, 62, 43, 1404, 6, 4357, 5752, 17816, 34, 3843, 62, 27977, 62, 43, 10503, 20520, 828, 16488, 796, 352, 8, 198, 220, 220, 220, 47764, 13, 14781, 7, 17816, 5446, 4061, 62, 2389, 41707, 51, 3955, 6465, 23518, 41707, 35, 6158, 3256, 705, 10619, 62, 34694, 3256, 705, 1581, 3528, 1268, 62, 34, 7036, 3256, 705, 1581, 3528, 1268, 62, 2257, 6981, 3256, 705, 35, 4261, 6234, 6, 4357, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 220, 220, 220, 1303, 3815, 796, 1391, 6, 1581, 3528, 1268, 62, 34, 7036, 10354, 532, 16, 11, 705, 1581, 3528, 1268, 62, 2257, 6981, 10354, 532, 16, 92, 198, 220, 220, 220, 1303, 47764, 796, 47764, 13, 20797, 2616, 7, 8367, 28, 27160, 8, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 198, 220, 220, 220, 1395, 796, 45941, 13, 18747, 7, 7568, 11, 288, 4906, 28, 37659, 13, 22468, 8, 198, 220, 220, 220, 1303, 294, 16, 796, 45941, 13, 25067, 576, 7, 7568, 17816, 6381, 489, 5592, 6, 4357, 685, 2079, 13, 24, 12962, 58, 15, 60, 198, 220, 220, 220, 1303, 5981, 62, 8516, 796, 357, 7568, 17816, 6381, 489, 5592, 20520, 1279, 294, 16, 8, 198, 220, 220, 220, 1303, 47764, 13, 14781, 7, 17816, 6381, 489, 5592, 6, 4357, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 220, 220, 220, 1303, 1395, 796, 47764, 13, 17946, 58, 49659, 62, 8516, 60, 198, 220, 220, 220, 1303, 331, 796, 331, 13, 17946, 58, 49659, 62, 8516, 60, 198, 220, 220, 220, 256, 15, 796, 640, 13, 2435, 3419, 198, 220, 220, 220, 842, 796, 44800, 8081, 2234, 22446, 11147, 7, 55, 11, 331, 8, 198, 220, 220, 220, 3601, 7, 2301, 13, 26675, 7, 55, 11, 331, 4008, 198, 220, 220, 220, 3601, 10786, 45677, 287, 4064, 13, 16, 69, 792, 2637, 4064, 357, 2435, 13, 2435, 3419, 532, 256, 15, 4008, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 198, 220, 220, 220, 220, 198, 220, 220, 220, 47764, 796, 279, 67, 13, 961, 62, 40664, 7, 418, 13, 6978, 13, 22179, 7, 26947, 62, 34720, 11, 29472, 13, 33491, 10786, 27432, 3256, 705, 9288, 6, 22305, 628, 220, 220, 220, 220, 2340, 796, 47764, 17816, 5446, 4061, 62, 2389, 20520, 198, 220, 220, 220, 47764, 13, 14781, 7, 17816, 5446, 4061, 62, 2389, 41707, 51, 3955, 6465, 23518, 41707, 35, 6158, 3256, 705, 10619, 62, 34694, 3256, 705, 1581, 3528, 1268, 62, 34, 7036, 3256, 705, 1581, 3528, 1268, 62, 2257, 6981, 6, 4357, 16488, 28, 16, 11, 287, 5372, 28, 17821, 8, 198, 220, 220, 220, 1303, 3815, 796, 1391, 6, 1581, 3528, 1268, 62, 34, 7036, 10354, 532, 16, 11, 705, 1581, 3528, 1268, 62, 2257, 6981, 10354, 532, 16, 92, 198, 220, 220, 220, 1303, 47764, 796, 47764, 13, 20797, 2616, 7, 8367, 28, 27160, 8, 198, 220, 220, 220, 1395, 62, 83, 301, 796, 45941, 13, 18747, 7, 7568, 11, 288, 4906, 28, 37659, 13, 22468, 8, 198, 220, 220, 220, 331, 62, 28764, 796, 842, 13, 79, 17407, 7, 55, 62, 83, 301, 8, 198, 220, 220, 220, 220, 198, 220, 220, 220, 14498, 796, 279, 67, 13, 6601, 19778, 7, 2340, 11, 15180, 28, 17816, 5446, 4061, 62, 2389, 6, 12962, 198, 220, 220, 220, 14498, 17816, 51, 3861, 18697, 62, 34694, 20520, 796, 331, 62, 28764, 198, 220, 220, 220, 14498, 13, 1462, 62, 40664, 10786, 40720, 19608, 292, 1039, 14, 1820, 62, 7266, 3411, 13, 40664, 3256, 6376, 28, 25101, 8, 628 ]
2.213235
816
#!/usr/bin/env python3 # -*- coding: utf-8 -*- """ Created on Tue Jun 15 14:01:24 2021 @author: liang """ ''' AWS personalize model ''' import boto3 import json import os class PersonalizePredictHandler(): """ """
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 18, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 37811, 198, 41972, 319, 30030, 7653, 1315, 1478, 25, 486, 25, 1731, 33448, 198, 198, 31, 9800, 25, 7649, 648, 198, 37811, 198, 198, 7061, 6, 198, 12298, 50, 2614, 1096, 2746, 198, 7061, 6, 198, 11748, 275, 2069, 18, 198, 11748, 33918, 198, 11748, 28686, 198, 198, 4871, 15644, 1096, 47, 17407, 25060, 33529, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 37227 ]
2.516854
89
# Copyright 2016 Bridgewater Associates # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """ .. module: security_monkey.alerters.custom_alerter :platform: Unix .. version:: $$VERSION$$ .. moduleauthor:: Bridgewater OSS <[email protected]> """ from security_monkey import app alerter_registry = []
[ 2, 220, 220, 220, 220, 15069, 1584, 48218, 29306, 198, 2, 198, 2, 220, 220, 220, 220, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 220, 220, 220, 220, 345, 743, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789, 13, 198, 2, 220, 220, 220, 220, 921, 743, 7330, 257, 4866, 286, 262, 13789, 379, 198, 2, 198, 2, 220, 220, 220, 220, 220, 220, 220, 220, 2638, 1378, 2503, 13, 43073, 13, 2398, 14, 677, 4541, 14, 43, 2149, 24290, 12, 17, 13, 15, 198, 2, 198, 2, 220, 220, 220, 220, 17486, 2672, 416, 9723, 1099, 393, 4987, 284, 287, 3597, 11, 3788, 198, 2, 220, 220, 220, 220, 9387, 739, 262, 13789, 318, 9387, 319, 281, 366, 1921, 3180, 1, 29809, 1797, 11, 198, 2, 220, 220, 220, 220, 42881, 34764, 11015, 6375, 7102, 49828, 11053, 3963, 15529, 509, 12115, 11, 2035, 4911, 393, 17142, 13, 198, 2, 220, 220, 220, 220, 4091, 262, 13789, 329, 262, 2176, 3303, 15030, 21627, 290, 198, 2, 220, 220, 220, 220, 11247, 739, 262, 13789, 13, 198, 37811, 198, 492, 8265, 25, 2324, 62, 49572, 13, 36213, 1010, 13, 23144, 62, 36213, 353, 198, 220, 220, 220, 1058, 24254, 25, 33501, 198, 198, 492, 2196, 3712, 32382, 43717, 13702, 198, 492, 8265, 9800, 3712, 48218, 440, 5432, 1279, 44813, 1668, 31, 65, 7050, 13, 785, 29, 628, 198, 37811, 198, 6738, 2324, 62, 49572, 1330, 598, 198, 198, 36213, 353, 62, 2301, 4592, 796, 17635, 628, 628 ]
3.290698
258
import cloudmesh cloudmesh.shell("help") print cloudmesh.version()
[ 11748, 6279, 76, 5069, 198, 17721, 76, 5069, 13, 29149, 7203, 16794, 4943, 198, 4798, 6279, 76, 5069, 13, 9641, 3419, 628 ]
3.090909
22
import json import numpy as np import torch from torch import nn
[ 11748, 33918, 198, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 28034, 198, 6738, 28034, 1330, 299, 77, 198 ]
3.473684
19
# # PySNMP MIB module Juniper-IKE-MIB (http://snmplabs.com/pysmi) # ASN.1 source file:///Users/davwang4/Dev/mibs.snmplabs.com/asn1/Juniper-IKE-MIB # Produced by pysmi-0.3.4 at Mon Apr 29 19:52:12 2019 # On host DAVWANG4-M-1475 platform Darwin version 18.5.0 by user davwang4 # Using Python version 3.7.3 (default, Mar 27 2019, 09:23:15) # ObjectIdentifier, OctetString, Integer = mibBuilder.importSymbols("ASN1", "ObjectIdentifier", "OctetString", "Integer") NamedValues, = mibBuilder.importSymbols("ASN1-ENUMERATION", "NamedValues") ValueSizeConstraint, SingleValueConstraint, ValueRangeConstraint, ConstraintsIntersection, ConstraintsUnion = mibBuilder.importSymbols("ASN1-REFINEMENT", "ValueSizeConstraint", "SingleValueConstraint", "ValueRangeConstraint", "ConstraintsIntersection", "ConstraintsUnion") juniMibs, = mibBuilder.importSymbols("Juniper-MIBs", "juniMibs") NotificationGroup, ObjectGroup, ModuleCompliance = mibBuilder.importSymbols("SNMPv2-CONF", "NotificationGroup", "ObjectGroup", "ModuleCompliance") ObjectIdentity, Counter32, Bits, Integer32, ModuleIdentity, NotificationType, MibIdentifier, Gauge32, MibScalar, MibTable, MibTableRow, MibTableColumn, IpAddress, iso, Counter64, Unsigned32, TimeTicks = mibBuilder.importSymbols("SNMPv2-SMI", "ObjectIdentity", "Counter32", "Bits", "Integer32", "ModuleIdentity", "NotificationType", "MibIdentifier", "Gauge32", "MibScalar", "MibTable", "MibTableRow", "MibTableColumn", "IpAddress", "iso", "Counter64", "Unsigned32", "TimeTicks") TextualConvention, DisplayString, RowStatus = mibBuilder.importSymbols("SNMPv2-TC", "TextualConvention", "DisplayString", "RowStatus") juniIkeMIB = ModuleIdentity((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71)) juniIkeMIB.setRevisions(('2005-11-22 16:15', '2004-01-23 15:12', '2004-04-06 22:26',)) if mibBuilder.loadTexts: juniIkeMIB.setLastUpdated('200404062226Z') if mibBuilder.loadTexts: juniIkeMIB.setOrganization('Juniper Networks, Inc.') juniIkeObjects = MibIdentifier((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1)) juniIke = MibIdentifier((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1)) juniIkePolicyRuleTable = MibTable((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1), ) if mibBuilder.loadTexts: juniIkePolicyRuleTable.setStatus('obsolete') juniIkePolicyRuleEntry = MibTableRow((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1), ).setIndexNames((0, "Juniper-IKE-MIB", "juniIkePolicyRulePriority")) if mibBuilder.loadTexts: juniIkePolicyRuleEntry.setStatus('obsolete') juniIkePolicyRulePriority = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 1), Integer32().subtype(subtypeSpec=ValueRangeConstraint(1, 10000))) if mibBuilder.loadTexts: juniIkePolicyRulePriority.setStatus('obsolete') juniIkePolicyRuleAuthMethod = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 2), JuniIkeAuthenticationMethod().clone('preSharedKeys')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleAuthMethod.setStatus('obsolete') juniIkePolicyRuleEncryptMethod = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 3), JuniIkeEncryptionMethod().clone('tripleDes')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleEncryptMethod.setStatus('obsolete') juniIkePolicyRulePfsGroup = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 4), JuniIkeGroup().clone('group2')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRulePfsGroup.setStatus('obsolete') juniIkePolicyRuleHashMethod = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 5), JuniIkeHashMethod().clone('sha')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleHashMethod.setStatus('obsolete') juniIkePolicyRuleLifetime = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 6), Integer32().subtype(subtypeSpec=ValueRangeConstraint(60, 86400)).clone(28800)).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleLifetime.setStatus('obsolete') juniIkePolicyRuleNegotiationMode = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 7), JuniIkeNegotiationMode().clone('aggressive')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleNegotiationMode.setStatus('obsolete') juniIkePolicyRuleRowStatus = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 1, 1, 8), RowStatus()).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleRowStatus.setStatus('obsolete') juniIkePolicyRuleV2Table = MibTable((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6), ) if mibBuilder.loadTexts: juniIkePolicyRuleV2Table.setStatus('current') juniIkePolicyRuleV2Entry = MibTableRow((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1), ).setIndexNames((0, "Juniper-IKE-MIB", "juniIkePolicyRuleV2Priority")) if mibBuilder.loadTexts: juniIkePolicyRuleV2Entry.setStatus('current') juniIkePolicyRuleV2Priority = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 1), Integer32().subtype(subtypeSpec=ValueRangeConstraint(1, 10000))) if mibBuilder.loadTexts: juniIkePolicyRuleV2Priority.setStatus('current') juniIkePolicyRuleV2AuthMethod = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 2), JuniIkeAuthenticationMethod().clone('preSharedKeys')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2AuthMethod.setStatus('current') juniIkePolicyRuleV2EncryptMethod = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 3), JuniIkeEncryptionMethod().clone('tripleDes')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2EncryptMethod.setStatus('current') juniIkePolicyRuleV2PfsGroup = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 4), JuniIkeGroup().clone('group2')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2PfsGroup.setStatus('current') juniIkePolicyRuleV2HashMethod = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 5), JuniIkeHashMethod().clone('sha')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2HashMethod.setStatus('current') juniIkePolicyRuleV2Lifetime = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 6), Integer32().subtype(subtypeSpec=ValueRangeConstraint(60, 86400)).clone(28800)).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2Lifetime.setStatus('current') juniIkePolicyRuleV2NegotiationMode = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 7), JuniIkeNegotiationV2Mode().clone('aggressiveNotAllowed')).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2NegotiationMode.setStatus('current') juniIkePolicyRuleV2IpAddress = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 8), IpAddress()).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2IpAddress.setStatus('current') juniIkePolicyRuleV2RouterIndex = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 9), Unsigned32()).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2RouterIndex.setStatus('current') juniIkePolicyRuleV2RowStatus = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 6, 1, 10), RowStatus()).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkePolicyRuleV2RowStatus.setStatus('current') juniIkeIpv4PresharedKeyTable = MibTable((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2), ) if mibBuilder.loadTexts: juniIkeIpv4PresharedKeyTable.setStatus('current') juniIkeIpv4PresharedKeyEntry = MibTableRow((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2, 1), ).setIndexNames((0, "Juniper-IKE-MIB", "juniIkeIpv4PresharedRemoteIpAddr"), (0, "Juniper-IKE-MIB", "juniIkeIpv4PresharedRouterIdx")) if mibBuilder.loadTexts: juniIkeIpv4PresharedKeyEntry.setStatus('current') juniIkeIpv4PresharedRemoteIpAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2, 1, 1), IpAddress()) if mibBuilder.loadTexts: juniIkeIpv4PresharedRemoteIpAddr.setStatus('current') juniIkeIpv4PresharedRouterIdx = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2, 1, 2), Unsigned32()) if mibBuilder.loadTexts: juniIkeIpv4PresharedRouterIdx.setStatus('current') juniIkeIpv4PresharedKeyStr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2, 1, 3), DisplayString().subtype(subtypeSpec=ValueSizeConstraint(0, 200))).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkeIpv4PresharedKeyStr.setStatus('current') juniIkeIpv4PresharedMaskedKeyStr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2, 1, 4), OctetString().subtype(subtypeSpec=ValueSizeConstraint(0, 300))).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkeIpv4PresharedMaskedKeyStr.setStatus('current') juniIkeIpv4PresharedKeyRowStatus = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 2, 1, 5), RowStatus()).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkeIpv4PresharedKeyRowStatus.setStatus('current') juniIkeFqdnPresharedKeyTable = MibTable((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3), ) if mibBuilder.loadTexts: juniIkeFqdnPresharedKeyTable.setStatus('current') juniIkeFqdnPresharedKeyEntry = MibTableRow((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3, 1), ).setIndexNames((0, "Juniper-IKE-MIB", "juniIkeFqdnPresharedRemote"), (0, "Juniper-IKE-MIB", "juniIkeFqdnPresharedRouterIndex")) if mibBuilder.loadTexts: juniIkeFqdnPresharedKeyEntry.setStatus('current') juniIkeFqdnPresharedRemote = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3, 1, 1), DisplayString().subtype(subtypeSpec=ValueSizeConstraint(0, 80))) if mibBuilder.loadTexts: juniIkeFqdnPresharedRemote.setStatus('current') juniIkeFqdnPresharedRouterIndex = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3, 1, 2), Unsigned32()) if mibBuilder.loadTexts: juniIkeFqdnPresharedRouterIndex.setStatus('current') juniIkeFqdnPresharedKeyStr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3, 1, 3), DisplayString().subtype(subtypeSpec=ValueSizeConstraint(0, 200))).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkeFqdnPresharedKeyStr.setStatus('current') juniIkeFqdnPresharedMaskedKeyStr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3, 1, 4), OctetString().subtype(subtypeSpec=ValueSizeConstraint(0, 300))).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkeFqdnPresharedMaskedKeyStr.setStatus('current') juniIkeFqdnPresharedKeyRowStatus = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 3, 1, 5), RowStatus()).setMaxAccess("readcreate") if mibBuilder.loadTexts: juniIkeFqdnPresharedKeyRowStatus.setStatus('current') juniIkeSaTable = MibTable((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4), ) if mibBuilder.loadTexts: juniIkeSaTable.setStatus('obsolete') juniIkeSaEntry = MibTableRow((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1), ).setIndexNames((0, "Juniper-IKE-MIB", "juniIkeSaRemoteIpAddr"), (0, "Juniper-IKE-MIB", "juniIkeSaLocalIpAddr"), (0, "Juniper-IKE-MIB", "juniIkeSaRouterIndex"), (0, "Juniper-IKE-MIB", "juniIkeSaDirection")) if mibBuilder.loadTexts: juniIkeSaEntry.setStatus('obsolete') juniIkeSaRemoteIpAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1, 1), IpAddress()) if mibBuilder.loadTexts: juniIkeSaRemoteIpAddr.setStatus('obsolete') juniIkeSaLocalIpAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1, 2), IpAddress()) if mibBuilder.loadTexts: juniIkeSaLocalIpAddr.setStatus('obsolete') juniIkeSaRouterIndex = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1, 3), Unsigned32()) if mibBuilder.loadTexts: juniIkeSaRouterIndex.setStatus('obsolete') juniIkeSaDirection = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1, 4), JuniIpsecPhase1SaDirection()) if mibBuilder.loadTexts: juniIkeSaDirection.setStatus('obsolete') juniIkeSaState = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1, 5), JuniIpsecPhase1SaState()).setMaxAccess("readonly") if mibBuilder.loadTexts: juniIkeSaState.setStatus('obsolete') juniIkeSaRemaining = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 4, 1, 6), Unsigned32().subtype(subtypeSpec=ValueRangeConstraint(0, 86400))).setUnits('seconds').setMaxAccess("readonly") if mibBuilder.loadTexts: juniIkeSaRemaining.setStatus('obsolete') juniIkeSa2Table = MibTable((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5), ) if mibBuilder.loadTexts: juniIkeSa2Table.setStatus('current') juniIkeSa2Entry = MibTableRow((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1), ).setIndexNames((0, "Juniper-IKE-MIB", "juniIkeSa2RemoteIpAddr"), (0, "Juniper-IKE-MIB", "juniIkeSaRemotePort"), (0, "Juniper-IKE-MIB", "juniIkeSa2LocalIpAddr"), (0, "Juniper-IKE-MIB", "juniIkeSaLocalPort"), (0, "Juniper-IKE-MIB", "juniIkeSa2RouterIndex"), (0, "Juniper-IKE-MIB", "juniIkeSa2Direction"), (0, "Juniper-IKE-MIB", "juniIkeSaNegotiationDone")) if mibBuilder.loadTexts: juniIkeSa2Entry.setStatus('current') juniIkeSa2RemoteIpAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 1), IpAddress()) if mibBuilder.loadTexts: juniIkeSa2RemoteIpAddr.setStatus('current') juniIkeSaRemotePort = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 2), Unsigned32()) if mibBuilder.loadTexts: juniIkeSaRemotePort.setStatus('current') juniIkeSa2LocalIpAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 3), IpAddress()) if mibBuilder.loadTexts: juniIkeSa2LocalIpAddr.setStatus('current') juniIkeSaLocalPort = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 4), Unsigned32()) if mibBuilder.loadTexts: juniIkeSaLocalPort.setStatus('current') juniIkeSa2RouterIndex = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 5), Unsigned32()) if mibBuilder.loadTexts: juniIkeSa2RouterIndex.setStatus('current') juniIkeSa2Direction = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 6), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(0, 1))).clone(namedValues=NamedValues(("responder", 0), ("initiator", 1)))) if mibBuilder.loadTexts: juniIkeSa2Direction.setStatus('current') juniIkeSaNegotiationDone = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 7), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(0, 1))).clone(namedValues=NamedValues(("negotiationNotDone", 0), ("negotiationDone", 1)))) if mibBuilder.loadTexts: juniIkeSaNegotiationDone.setStatus('current') juniIkeSa2State = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 8), JuniIpsecPhase1SaState()).setMaxAccess("readonly") if mibBuilder.loadTexts: juniIkeSa2State.setStatus('current') juniIkeSa2Remaining = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 9), Unsigned32().subtype(subtypeSpec=ValueRangeConstraint(0, 86400))).setUnits('seconds').setMaxAccess("readonly") if mibBuilder.loadTexts: juniIkeSa2Remaining.setStatus('current') juniRemoteCookie = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 10), OctetString().subtype(subtypeSpec=ValueSizeConstraint(0, 8))).setMaxAccess("readonly") if mibBuilder.loadTexts: juniRemoteCookie.setStatus('current') juniLocalCookie = MibTableColumn((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 1, 1, 5, 1, 11), OctetString().subtype(subtypeSpec=ValueSizeConstraint(0, 8))).setMaxAccess("readonly") if mibBuilder.loadTexts: juniLocalCookie.setStatus('current') juniIkeMIBConformance = MibIdentifier((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2)) juniIkeMIBCompliances = MibIdentifier((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 1)) juniIkeMIBGroups = MibIdentifier((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2)) juniIkeCompliance = ModuleCompliance((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 1, 1)).setObjects(("Juniper-IKE-MIB", "juniIkePolicyRuleGroup"), ("Juniper-IKE-MIB", "juniIkeIpv4PreSharedKeyGroup"), ("Juniper-IKE-MIB", "juniIkeFqdnPreSharedKeyGroup"), ("Juniper-IKE-MIB", "juniIkeSaGroup")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeCompliance = juniIkeCompliance.setStatus('obsolete') juniIkeCompliance2 = ModuleCompliance((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 1, 2)).setObjects(("Juniper-IKE-MIB", "juniIkePolicyRuleGroup"), ("Juniper-IKE-MIB", "juniIkeIpv4PreSharedKeyGroup"), ("Juniper-IKE-MIB", "juniIkeFqdnPreSharedKeyGroup"), ("Juniper-IKE-MIB", "juniIkeSa2Group")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeCompliance2 = juniIkeCompliance2.setStatus('obsolete') juniIkeCompliance3 = ModuleCompliance((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 1, 3)).setObjects(("Juniper-IKE-MIB", "juniIkePolicyRuleV2Group"), ("Juniper-IKE-MIB", "juniIkeIpv4PreSharedKeyGroup"), ("Juniper-IKE-MIB", "juniIkeFqdnPreSharedKeyGroup"), ("Juniper-IKE-MIB", "juniIkeSa2Group")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeCompliance3 = juniIkeCompliance3.setStatus('current') juniIkePolicyRuleGroup = ObjectGroup((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2, 1)).setObjects(("Juniper-IKE-MIB", "juniIkePolicyRuleAuthMethod"), ("Juniper-IKE-MIB", "juniIkePolicyRuleEncryptMethod"), ("Juniper-IKE-MIB", "juniIkePolicyRulePfsGroup"), ("Juniper-IKE-MIB", "juniIkePolicyRuleHashMethod"), ("Juniper-IKE-MIB", "juniIkePolicyRuleLifetime"), ("Juniper-IKE-MIB", "juniIkePolicyRuleNegotiationMode"), ("Juniper-IKE-MIB", "juniIkePolicyRuleRowStatus")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkePolicyRuleGroup = juniIkePolicyRuleGroup.setStatus('obsolete') juniIkeIpv4PreSharedKeyGroup = ObjectGroup((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2, 2)).setObjects(("Juniper-IKE-MIB", "juniIkeIpv4PresharedKeyStr"), ("Juniper-IKE-MIB", "juniIkeIpv4PresharedMaskedKeyStr"), ("Juniper-IKE-MIB", "juniIkeIpv4PresharedKeyRowStatus")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeIpv4PreSharedKeyGroup = juniIkeIpv4PreSharedKeyGroup.setStatus('current') juniIkeFqdnPreSharedKeyGroup = ObjectGroup((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2, 3)).setObjects(("Juniper-IKE-MIB", "juniIkeFqdnPresharedKeyStr"), ("Juniper-IKE-MIB", "juniIkeFqdnPresharedMaskedKeyStr"), ("Juniper-IKE-MIB", "juniIkeFqdnPresharedKeyRowStatus")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeFqdnPreSharedKeyGroup = juniIkeFqdnPreSharedKeyGroup.setStatus('current') juniIkeSaGroup = ObjectGroup((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2, 4)).setObjects(("Juniper-IKE-MIB", "juniIkeSaState"), ("Juniper-IKE-MIB", "juniIkeSaRemaining")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeSaGroup = juniIkeSaGroup.setStatus('obsolete') juniIkeSa2Group = ObjectGroup((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2, 5)).setObjects(("Juniper-IKE-MIB", "juniIkeSa2State"), ("Juniper-IKE-MIB", "juniIkeSa2Remaining"), ("Juniper-IKE-MIB", "juniRemoteCookie"), ("Juniper-IKE-MIB", "juniLocalCookie")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkeSa2Group = juniIkeSa2Group.setStatus('current') juniIkePolicyRuleV2Group = ObjectGroup((1, 3, 6, 1, 4, 1, 4874, 2, 2, 71, 2, 2, 6)).setObjects(("Juniper-IKE-MIB", "juniIkePolicyRuleV2AuthMethod"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2EncryptMethod"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2PfsGroup"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2HashMethod"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2Lifetime"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2NegotiationMode"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2IpAddress"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2RouterIndex"), ("Juniper-IKE-MIB", "juniIkePolicyRuleV2RowStatus")) if getattr(mibBuilder, 'version', (0, 0, 0)) > (4, 4, 0): juniIkePolicyRuleV2Group = juniIkePolicyRuleV2Group.setStatus('current') mibBuilder.exportSymbols("Juniper-IKE-MIB", juniIkeSaRemaining=juniIkeSaRemaining, juniIkePolicyRuleV2Priority=juniIkePolicyRuleV2Priority, juniIkePolicyRuleV2AuthMethod=juniIkePolicyRuleV2AuthMethod, juniIkeSaRemotePort=juniIkeSaRemotePort, juniIkeSa2Group=juniIkeSa2Group, juniIkeSaNegotiationDone=juniIkeSaNegotiationDone, juniIkeSa2RemoteIpAddr=juniIkeSa2RemoteIpAddr, juniIkeSa2Entry=juniIkeSa2Entry, juniIkeFqdnPresharedKeyEntry=juniIkeFqdnPresharedKeyEntry, juniIkeSaState=juniIkeSaState, juniIkeSa2RouterIndex=juniIkeSa2RouterIndex, juniIkeIpv4PresharedRemoteIpAddr=juniIkeIpv4PresharedRemoteIpAddr, juniIkeSaLocalPort=juniIkeSaLocalPort, juniIkePolicyRuleLifetime=juniIkePolicyRuleLifetime, juniIkeMIB=juniIkeMIB, juniIkeSaEntry=juniIkeSaEntry, juniIkePolicyRuleEntry=juniIkePolicyRuleEntry, juniIkePolicyRuleTable=juniIkePolicyRuleTable, juniIkeSa2State=juniIkeSa2State, juniIkePolicyRuleV2PfsGroup=juniIkePolicyRuleV2PfsGroup, juniIkeCompliance3=juniIkeCompliance3, juniIkePolicyRuleV2IpAddress=juniIkePolicyRuleV2IpAddress, juniIkePolicyRuleAuthMethod=juniIkePolicyRuleAuthMethod, juniIkeSaGroup=juniIkeSaGroup, JuniIkeGroup=JuniIkeGroup, juniIkeSaLocalIpAddr=juniIkeSaLocalIpAddr, juniIkeSaRemoteIpAddr=juniIkeSaRemoteIpAddr, juniIkePolicyRuleHashMethod=juniIkePolicyRuleHashMethod, juniIkeIpv4PreSharedKeyGroup=juniIkeIpv4PreSharedKeyGroup, juniIkePolicyRuleV2HashMethod=juniIkePolicyRuleV2HashMethod, juniIke=juniIke, juniIkePolicyRuleV2RouterIndex=juniIkePolicyRuleV2RouterIndex, juniIkeFqdnPresharedKeyRowStatus=juniIkeFqdnPresharedKeyRowStatus, juniIkeSa2Table=juniIkeSa2Table, juniIkeSa2Direction=juniIkeSa2Direction, JuniIkeEncryptionMethod=JuniIkeEncryptionMethod, juniIkeIpv4PresharedMaskedKeyStr=juniIkeIpv4PresharedMaskedKeyStr, juniIkeSaTable=juniIkeSaTable, JuniIkeHashMethod=JuniIkeHashMethod, JuniIpsecPhase1SaState=JuniIpsecPhase1SaState, juniIkePolicyRuleV2NegotiationMode=juniIkePolicyRuleV2NegotiationMode, juniIkeFqdnPresharedRemote=juniIkeFqdnPresharedRemote, juniIkeMIBCompliances=juniIkeMIBCompliances, juniIkeMIBConformance=juniIkeMIBConformance, juniIkeSa2Remaining=juniIkeSa2Remaining, juniLocalCookie=juniLocalCookie, juniIkeSaRouterIndex=juniIkeSaRouterIndex, juniIkeFqdnPreSharedKeyGroup=juniIkeFqdnPreSharedKeyGroup, juniIkeIpv4PresharedKeyRowStatus=juniIkeIpv4PresharedKeyRowStatus, juniIkePolicyRulePriority=juniIkePolicyRulePriority, JuniIkeNegotiationV2Mode=JuniIkeNegotiationV2Mode, juniIkeSaDirection=juniIkeSaDirection, juniIkePolicyRuleV2Lifetime=juniIkePolicyRuleV2Lifetime, juniIkePolicyRuleGroup=juniIkePolicyRuleGroup, juniIkePolicyRuleV2Entry=juniIkePolicyRuleV2Entry, juniIkeFqdnPresharedKeyStr=juniIkeFqdnPresharedKeyStr, juniIkeFqdnPresharedMaskedKeyStr=juniIkeFqdnPresharedMaskedKeyStr, juniIkeCompliance=juniIkeCompliance, JuniIpsecPhase1SaDirection=JuniIpsecPhase1SaDirection, juniIkeSa2LocalIpAddr=juniIkeSa2LocalIpAddr, juniIkePolicyRuleV2Group=juniIkePolicyRuleV2Group, juniIkeIpv4PresharedRouterIdx=juniIkeIpv4PresharedRouterIdx, juniIkePolicyRuleV2RowStatus=juniIkePolicyRuleV2RowStatus, juniRemoteCookie=juniRemoteCookie, PYSNMP_MODULE_ID=juniIkeMIB, juniIkePolicyRuleNegotiationMode=juniIkePolicyRuleNegotiationMode, juniIkePolicyRuleEncryptMethod=juniIkePolicyRuleEncryptMethod, juniIkeIpv4PresharedKeyEntry=juniIkeIpv4PresharedKeyEntry, JuniIkeAuthenticationMethod=JuniIkeAuthenticationMethod, juniIkePolicyRuleV2Table=juniIkePolicyRuleV2Table, juniIkeFqdnPresharedKeyTable=juniIkeFqdnPresharedKeyTable, juniIkeMIBGroups=juniIkeMIBGroups, juniIkeIpv4PresharedKeyStr=juniIkeIpv4PresharedKeyStr, juniIkeFqdnPresharedRouterIndex=juniIkeFqdnPresharedRouterIndex, juniIkeIpv4PresharedKeyTable=juniIkeIpv4PresharedKeyTable, juniIkeCompliance2=juniIkeCompliance2, juniIkePolicyRulePfsGroup=juniIkePolicyRulePfsGroup, juniIkeObjects=juniIkeObjects, JuniIkeNegotiationMode=JuniIkeNegotiationMode, juniIkePolicyRuleRowStatus=juniIkePolicyRuleRowStatus, juniIkePolicyRuleV2EncryptMethod=juniIkePolicyRuleV2EncryptMethod)
[ 2, 198, 2, 9485, 15571, 7378, 337, 9865, 8265, 7653, 9346, 12, 40, 7336, 12, 8895, 33, 357, 4023, 1378, 16184, 76, 489, 8937, 13, 785, 14, 79, 893, 11632, 8, 198, 2, 7054, 45, 13, 16, 2723, 2393, 1378, 14, 14490, 14, 67, 615, 47562, 19, 14, 13603, 14, 76, 571, 82, 13, 16184, 76, 489, 8937, 13, 785, 14, 292, 77, 16, 14, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 198, 2, 21522, 771, 416, 279, 893, 11632, 12, 15, 13, 18, 13, 19, 379, 2892, 2758, 2808, 678, 25, 4309, 25, 1065, 13130, 198, 2, 1550, 2583, 42274, 54, 15567, 19, 12, 44, 12, 1415, 2425, 3859, 21450, 2196, 1248, 13, 20, 13, 15, 416, 2836, 288, 615, 47562, 19, 198, 2, 8554, 11361, 2196, 513, 13, 22, 13, 18, 357, 12286, 11, 1526, 2681, 13130, 11, 7769, 25, 1954, 25, 1314, 8, 220, 198, 2, 198, 10267, 33234, 7483, 11, 2556, 316, 10100, 11, 34142, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 1921, 45, 16, 1600, 366, 10267, 33234, 7483, 1600, 366, 12349, 316, 10100, 1600, 366, 46541, 4943, 198, 45, 2434, 40161, 11, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 1921, 45, 16, 12, 1677, 5883, 1137, 6234, 1600, 366, 45, 2434, 40161, 4943, 198, 11395, 10699, 3103, 2536, 2913, 11, 14206, 11395, 3103, 2536, 2913, 11, 11052, 17257, 3103, 2536, 2913, 11, 1482, 2536, 6003, 9492, 5458, 11, 1482, 2536, 6003, 38176, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 1921, 45, 16, 12, 2200, 20032, 12529, 1600, 366, 11395, 10699, 3103, 2536, 2913, 1600, 366, 28008, 11395, 3103, 2536, 2913, 1600, 366, 11395, 17257, 3103, 2536, 2913, 1600, 366, 3103, 2536, 6003, 9492, 5458, 1600, 366, 3103, 2536, 6003, 38176, 4943, 198, 29741, 72, 44, 571, 82, 11, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 22396, 9346, 12, 8895, 37000, 1600, 366, 29741, 72, 44, 571, 82, 4943, 198, 3673, 2649, 13247, 11, 9515, 13247, 11, 19937, 38143, 3610, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 15571, 7378, 85, 17, 12, 10943, 37, 1600, 366, 3673, 2649, 13247, 1600, 366, 10267, 13247, 1600, 366, 26796, 38143, 3610, 4943, 198, 10267, 7390, 26858, 11, 15034, 2624, 11, 44733, 11, 34142, 2624, 11, 19937, 7390, 26858, 11, 42808, 6030, 11, 337, 571, 33234, 7483, 11, 35094, 469, 2624, 11, 337, 571, 3351, 282, 283, 11, 337, 571, 10962, 11, 337, 571, 10962, 25166, 11, 337, 571, 10962, 39470, 11, 314, 79, 20231, 11, 47279, 11, 15034, 2414, 11, 791, 32696, 2624, 11, 3862, 51, 3378, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 15571, 7378, 85, 17, 12, 50, 8895, 1600, 366, 10267, 7390, 26858, 1600, 366, 31694, 2624, 1600, 366, 33, 896, 1600, 366, 46541, 2624, 1600, 366, 26796, 7390, 26858, 1600, 366, 3673, 2649, 6030, 1600, 366, 44, 571, 33234, 7483, 1600, 366, 38, 559, 469, 2624, 1600, 366, 44, 571, 3351, 282, 283, 1600, 366, 44, 571, 10962, 1600, 366, 44, 571, 10962, 25166, 1600, 366, 44, 571, 10962, 39470, 1600, 366, 40, 79, 20231, 1600, 366, 26786, 1600, 366, 31694, 2414, 1600, 366, 3118, 32696, 2624, 1600, 366, 7575, 51, 3378, 4943, 198, 8206, 723, 3103, 4018, 11, 16531, 10100, 11, 11314, 19580, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 15571, 7378, 85, 17, 12, 4825, 1600, 366, 8206, 723, 3103, 4018, 1600, 366, 23114, 10100, 1600, 366, 25166, 19580, 4943, 198, 29741, 72, 40, 365, 8895, 33, 796, 19937, 7390, 26858, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 4008, 198, 29741, 72, 40, 365, 8895, 33, 13, 2617, 18009, 3279, 7, 10786, 14315, 12, 1157, 12, 1828, 1467, 25, 1314, 3256, 705, 15724, 12, 486, 12, 1954, 1315, 25, 1065, 3256, 705, 15724, 12, 3023, 12, 3312, 2534, 25, 2075, 3256, 4008, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 8895, 33, 13, 2617, 5956, 17354, 10786, 2167, 1821, 29703, 1828, 2075, 57, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 8895, 33, 13, 2617, 26121, 1634, 10786, 22396, 9346, 27862, 11, 3457, 2637, 8, 198, 198, 29741, 72, 40, 365, 10267, 82, 796, 337, 571, 33234, 7483, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 4008, 198, 29741, 72, 40, 365, 796, 337, 571, 33234, 7483, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 4008, 198, 29741, 72, 40, 365, 36727, 31929, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 10962, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 22442, 414, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 30150, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 22442, 414, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 352, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 16, 11, 33028, 22305, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 22442, 414, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 30515, 17410, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 362, 828, 7653, 72, 40, 365, 47649, 3299, 17410, 22446, 21018, 10786, 3866, 2484, 1144, 40729, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 30515, 17410, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 27195, 6012, 17410, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 513, 828, 7653, 72, 40, 365, 27195, 13168, 17410, 22446, 21018, 10786, 28461, 1154, 5960, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 27195, 6012, 17410, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 47, 9501, 13247, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 604, 828, 7653, 72, 40, 365, 13247, 22446, 21018, 10786, 8094, 17, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 47, 9501, 13247, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 26257, 17410, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 642, 828, 7653, 72, 40, 365, 26257, 17410, 22446, 21018, 10786, 26270, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 26257, 17410, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 43, 361, 8079, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 718, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 1899, 11, 807, 2414, 405, 29720, 21018, 7, 2078, 7410, 29720, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 43, 361, 8079, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 32863, 21236, 19076, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 767, 828, 7653, 72, 40, 365, 32863, 21236, 19076, 22446, 21018, 10786, 49639, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 32863, 21236, 19076, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 25166, 19580, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 352, 11, 352, 11, 807, 828, 11314, 19580, 3419, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 25166, 19580, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 10962, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 22442, 414, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 30150, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 22442, 414, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 352, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 16, 11, 33028, 22305, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 22442, 414, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 30515, 17410, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 362, 828, 7653, 72, 40, 365, 47649, 3299, 17410, 22446, 21018, 10786, 3866, 2484, 1144, 40729, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 30515, 17410, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 27195, 6012, 17410, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 513, 828, 7653, 72, 40, 365, 27195, 13168, 17410, 22446, 21018, 10786, 28461, 1154, 5960, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 27195, 6012, 17410, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 47, 9501, 13247, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 604, 828, 7653, 72, 40, 365, 13247, 22446, 21018, 10786, 8094, 17, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 47, 9501, 13247, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 26257, 17410, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 642, 828, 7653, 72, 40, 365, 26257, 17410, 22446, 21018, 10786, 26270, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 26257, 17410, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 43, 361, 8079, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 718, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 1899, 11, 807, 2414, 405, 29720, 21018, 7, 2078, 7410, 29720, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 43, 361, 8079, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 32863, 21236, 19076, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 767, 828, 7653, 72, 40, 365, 32863, 21236, 53, 17, 19076, 22446, 21018, 10786, 49639, 3673, 3237, 6972, 11537, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 32863, 21236, 19076, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 40, 79, 20231, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 807, 828, 314, 79, 20231, 3419, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 40, 79, 20231, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 49, 39605, 15732, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 860, 828, 791, 32696, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 49, 39605, 15732, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 25166, 19580, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 718, 11, 352, 11, 838, 828, 11314, 19580, 3419, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 36727, 31929, 53, 17, 25166, 19580, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 10962, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 36510, 40, 79, 4550, 81, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 49, 39605, 7390, 87, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 30150, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 36510, 40, 79, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 11, 352, 11, 352, 828, 314, 79, 20231, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 36510, 40, 79, 4550, 81, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 49, 39605, 7390, 87, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 11, 352, 11, 362, 828, 791, 32696, 2624, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 49, 39605, 7390, 87, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 13290, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 11, 352, 11, 513, 828, 16531, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 939, 4008, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 13290, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 45195, 276, 9218, 13290, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 11, 352, 11, 604, 828, 2556, 316, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 5867, 4008, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 45195, 276, 9218, 13290, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 25166, 19580, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 362, 11, 352, 11, 642, 828, 11314, 19580, 3419, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 25166, 19580, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 10962, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 36510, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 49, 39605, 15732, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 30150, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 36510, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 11, 352, 11, 352, 828, 16531, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 4019, 22305, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 36510, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 49, 39605, 15732, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 11, 352, 11, 362, 828, 791, 32696, 2624, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 49, 39605, 15732, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 13290, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 11, 352, 11, 513, 828, 16531, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 939, 4008, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 13290, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 45195, 276, 9218, 13290, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 11, 352, 11, 604, 828, 2556, 316, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 5867, 4008, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 45195, 276, 9218, 13290, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 25166, 19580, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 513, 11, 352, 11, 642, 828, 11314, 19580, 3419, 737, 2617, 11518, 15457, 7203, 961, 17953, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 25166, 19580, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 10962, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 36510, 40, 79, 4550, 81, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 14565, 40, 79, 4550, 81, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 49, 39605, 15732, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 35, 4154, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 30150, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 36510, 40, 79, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 11, 352, 828, 314, 79, 20231, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 36510, 40, 79, 4550, 81, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 14565, 40, 79, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 11, 362, 828, 314, 79, 20231, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 14565, 40, 79, 4550, 81, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 49, 39605, 15732, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 11, 513, 828, 791, 32696, 2624, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 49, 39605, 15732, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 35, 4154, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 11, 604, 828, 7653, 72, 40, 79, 2363, 35645, 16, 33890, 35, 4154, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 35, 4154, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 9012, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 11, 642, 828, 7653, 72, 40, 79, 2363, 35645, 16, 33890, 9012, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 9012, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 8413, 1397, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 604, 11, 352, 11, 718, 828, 791, 32696, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 15, 11, 807, 2414, 405, 4008, 737, 2617, 3118, 896, 10786, 43012, 27691, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 8413, 1397, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 17, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 10962, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 36510, 40, 79, 4550, 81, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 36510, 13924, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 14565, 40, 79, 4550, 81, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 14565, 13924, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 49, 39605, 15732, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 35, 4154, 12340, 357, 15, 11, 366, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 32863, 21236, 45677, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 30150, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 36510, 40, 79, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 352, 828, 314, 79, 20231, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 36510, 40, 79, 4550, 81, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 36510, 13924, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 362, 828, 791, 32696, 2624, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 36510, 13924, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 14565, 40, 79, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 513, 828, 314, 79, 20231, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 14565, 40, 79, 4550, 81, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 14565, 13924, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 604, 828, 791, 32696, 2624, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 14565, 13924, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 49, 39605, 15732, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 642, 828, 791, 32696, 2624, 28955, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 49, 39605, 15732, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 35, 4154, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 718, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 15, 11, 352, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 5546, 263, 1600, 657, 828, 5855, 259, 8846, 1352, 1600, 352, 35514, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 35, 4154, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 32863, 21236, 45677, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 767, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 15, 11, 352, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 12480, 21236, 3673, 45677, 1600, 657, 828, 5855, 12480, 21236, 45677, 1600, 352, 35514, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 32863, 21236, 45677, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 9012, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 807, 828, 7653, 72, 40, 79, 2363, 35645, 16, 33890, 9012, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 9012, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 17, 8413, 1397, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 860, 828, 791, 32696, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 15, 11, 807, 2414, 405, 4008, 737, 2617, 3118, 896, 10786, 43012, 27691, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 40, 365, 33890, 17, 8413, 1397, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 36510, 34, 18055, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 838, 828, 2556, 316, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 807, 4008, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 36510, 34, 18055, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 14565, 34, 18055, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 352, 11, 352, 11, 642, 11, 352, 11, 1367, 828, 2556, 316, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 15, 11, 807, 4008, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 10891, 72, 14565, 34, 18055, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 8895, 2749, 261, 10367, 796, 337, 571, 33234, 7483, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 4008, 198, 29741, 72, 40, 365, 8895, 2749, 6316, 16097, 796, 337, 571, 33234, 7483, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 352, 4008, 198, 29741, 72, 40, 365, 8895, 40469, 14459, 796, 337, 571, 33234, 7483, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 4008, 198, 29741, 72, 40, 365, 38143, 3610, 796, 19937, 38143, 3610, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 352, 11, 352, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 13247, 48774, 198, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 38143, 3610, 796, 10891, 72, 40, 365, 38143, 3610, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 38143, 3610, 17, 796, 19937, 38143, 3610, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 352, 11, 362, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 13247, 48774, 198, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 38143, 3610, 17, 796, 10891, 72, 40, 365, 38143, 3610, 17, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 38143, 3610, 18, 796, 19937, 38143, 3610, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 352, 11, 513, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 13247, 48774, 198, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 38143, 3610, 18, 796, 10891, 72, 40, 365, 38143, 3610, 18, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 13247, 796, 9515, 13247, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 11, 352, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 30515, 17410, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 27195, 6012, 17410, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 47, 9501, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 26257, 17410, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 43, 361, 8079, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 32863, 21236, 19076, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 25166, 19580, 48774, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 36727, 31929, 13247, 796, 10891, 72, 40, 365, 36727, 31929, 13247, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 796, 9515, 13247, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 11, 362, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 13290, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 45195, 276, 9218, 13290, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 25166, 19580, 48774, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 796, 10891, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 796, 9515, 13247, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 11, 513, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 13290, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 45195, 276, 9218, 13290, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 25166, 19580, 48774, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 796, 10891, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 33890, 13247, 796, 9515, 13247, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 11, 604, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 9012, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 8413, 1397, 48774, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 33890, 13247, 796, 10891, 72, 40, 365, 33890, 13247, 13, 2617, 19580, 10786, 672, 23869, 11537, 198, 29741, 72, 40, 365, 33890, 17, 13247, 796, 9515, 13247, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 11, 642, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 9012, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 33890, 17, 8413, 1397, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 36510, 34, 18055, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 14565, 34, 18055, 48774, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 33890, 17, 13247, 796, 10891, 72, 40, 365, 33890, 17, 13247, 13, 2617, 19580, 10786, 14421, 11537, 198, 29741, 72, 40, 365, 36727, 31929, 53, 17, 13247, 796, 9515, 13247, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 4764, 4524, 11, 362, 11, 362, 11, 9166, 11, 362, 11, 362, 11, 718, 29720, 2617, 10267, 82, 7, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 30515, 17410, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 27195, 6012, 17410, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 47, 9501, 13247, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 26257, 17410, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 43, 361, 8079, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 32863, 21236, 19076, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 40, 79, 20231, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 49, 39605, 15732, 12340, 5855, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 366, 29741, 72, 40, 365, 36727, 31929, 53, 17, 25166, 19580, 48774, 198, 361, 651, 35226, 7, 76, 571, 32875, 11, 705, 9641, 3256, 357, 15, 11, 657, 11, 657, 4008, 1875, 357, 19, 11, 604, 11, 657, 2599, 198, 220, 220, 220, 10891, 72, 40, 365, 36727, 31929, 53, 17, 13247, 796, 10891, 72, 40, 365, 36727, 31929, 53, 17, 13247, 13, 2617, 19580, 10786, 14421, 11537, 198, 76, 571, 32875, 13, 39344, 13940, 2022, 10220, 7203, 22396, 9346, 12, 40, 7336, 12, 8895, 33, 1600, 10891, 72, 40, 365, 33890, 8413, 1397, 28, 29741, 72, 40, 365, 33890, 8413, 1397, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 22442, 414, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 22442, 414, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 30515, 17410, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 30515, 17410, 11, 10891, 72, 40, 365, 33890, 36510, 13924, 28, 29741, 72, 40, 365, 33890, 36510, 13924, 11, 10891, 72, 40, 365, 33890, 17, 13247, 28, 29741, 72, 40, 365, 33890, 17, 13247, 11, 10891, 72, 40, 365, 33890, 32863, 21236, 45677, 28, 29741, 72, 40, 365, 33890, 32863, 21236, 45677, 11, 10891, 72, 40, 365, 33890, 17, 36510, 40, 79, 4550, 81, 28, 29741, 72, 40, 365, 33890, 17, 36510, 40, 79, 4550, 81, 11, 10891, 72, 40, 365, 33890, 17, 30150, 28, 29741, 72, 40, 365, 33890, 17, 30150, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 30150, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 30150, 11, 10891, 72, 40, 365, 33890, 9012, 28, 29741, 72, 40, 365, 33890, 9012, 11, 10891, 72, 40, 365, 33890, 17, 49, 39605, 15732, 28, 29741, 72, 40, 365, 33890, 17, 49, 39605, 15732, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 36510, 40, 79, 4550, 81, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 36510, 40, 79, 4550, 81, 11, 10891, 72, 40, 365, 33890, 14565, 13924, 28, 29741, 72, 40, 365, 33890, 14565, 13924, 11, 10891, 72, 40, 365, 36727, 31929, 43, 361, 8079, 28, 29741, 72, 40, 365, 36727, 31929, 43, 361, 8079, 11, 10891, 72, 40, 365, 8895, 33, 28, 29741, 72, 40, 365, 8895, 33, 11, 10891, 72, 40, 365, 33890, 30150, 28, 29741, 72, 40, 365, 33890, 30150, 11, 10891, 72, 40, 365, 36727, 31929, 30150, 28, 29741, 72, 40, 365, 36727, 31929, 30150, 11, 10891, 72, 40, 365, 36727, 31929, 10962, 28, 29741, 72, 40, 365, 36727, 31929, 10962, 11, 10891, 72, 40, 365, 33890, 17, 9012, 28, 29741, 72, 40, 365, 33890, 17, 9012, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 47, 9501, 13247, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 47, 9501, 13247, 11, 10891, 72, 40, 365, 38143, 3610, 18, 28, 29741, 72, 40, 365, 38143, 3610, 18, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 40, 79, 20231, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 40, 79, 20231, 11, 10891, 72, 40, 365, 36727, 31929, 30515, 17410, 28, 29741, 72, 40, 365, 36727, 31929, 30515, 17410, 11, 10891, 72, 40, 365, 33890, 13247, 28, 29741, 72, 40, 365, 33890, 13247, 11, 7653, 72, 40, 365, 13247, 28, 22396, 72, 40, 365, 13247, 11, 10891, 72, 40, 365, 33890, 14565, 40, 79, 4550, 81, 28, 29741, 72, 40, 365, 33890, 14565, 40, 79, 4550, 81, 11, 10891, 72, 40, 365, 33890, 36510, 40, 79, 4550, 81, 28, 29741, 72, 40, 365, 33890, 36510, 40, 79, 4550, 81, 11, 10891, 72, 40, 365, 36727, 31929, 26257, 17410, 28, 29741, 72, 40, 365, 36727, 31929, 26257, 17410, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 6719, 2484, 1144, 9218, 13247, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 26257, 17410, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 26257, 17410, 11, 10891, 72, 40, 365, 28, 29741, 72, 40, 365, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 49, 39605, 15732, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 49, 39605, 15732, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 25166, 19580, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 25166, 19580, 11, 10891, 72, 40, 365, 33890, 17, 10962, 28, 29741, 72, 40, 365, 33890, 17, 10962, 11, 10891, 72, 40, 365, 33890, 17, 35, 4154, 28, 29741, 72, 40, 365, 33890, 17, 35, 4154, 11, 7653, 72, 40, 365, 27195, 13168, 17410, 28, 22396, 72, 40, 365, 27195, 13168, 17410, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 45195, 276, 9218, 13290, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 45195, 276, 9218, 13290, 11, 10891, 72, 40, 365, 33890, 10962, 28, 29741, 72, 40, 365, 33890, 10962, 11, 7653, 72, 40, 365, 26257, 17410, 28, 22396, 72, 40, 365, 26257, 17410, 11, 7653, 72, 40, 79, 2363, 35645, 16, 33890, 9012, 28, 22396, 72, 40, 79, 2363, 35645, 16, 33890, 9012, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 32863, 21236, 19076, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 32863, 21236, 19076, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 36510, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 36510, 11, 10891, 72, 40, 365, 8895, 2749, 6316, 16097, 28, 29741, 72, 40, 365, 8895, 2749, 6316, 16097, 11, 10891, 72, 40, 365, 8895, 2749, 261, 10367, 28, 29741, 72, 40, 365, 8895, 2749, 261, 10367, 11, 10891, 72, 40, 365, 33890, 17, 8413, 1397, 28, 29741, 72, 40, 365, 33890, 17, 8413, 1397, 11, 10891, 72, 14565, 34, 18055, 28, 29741, 72, 14565, 34, 18055, 11, 10891, 72, 40, 365, 33890, 49, 39605, 15732, 28, 29741, 72, 40, 365, 33890, 49, 39605, 15732, 11, 10891, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 28, 29741, 72, 40, 365, 37, 80, 32656, 6719, 2484, 1144, 9218, 13247, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 25166, 19580, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 25166, 19580, 11, 10891, 72, 40, 365, 36727, 31929, 22442, 414, 28, 29741, 72, 40, 365, 36727, 31929, 22442, 414, 11, 7653, 72, 40, 365, 32863, 21236, 53, 17, 19076, 28, 22396, 72, 40, 365, 32863, 21236, 53, 17, 19076, 11, 10891, 72, 40, 365, 33890, 35, 4154, 28, 29741, 72, 40, 365, 33890, 35, 4154, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 43, 361, 8079, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 43, 361, 8079, 11, 10891, 72, 40, 365, 36727, 31929, 13247, 28, 29741, 72, 40, 365, 36727, 31929, 13247, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 30150, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 30150, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 13290, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 13290, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 45195, 276, 9218, 13290, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 45195, 276, 9218, 13290, 11, 10891, 72, 40, 365, 38143, 3610, 28, 29741, 72, 40, 365, 38143, 3610, 11, 7653, 72, 40, 79, 2363, 35645, 16, 33890, 35, 4154, 28, 22396, 72, 40, 79, 2363, 35645, 16, 33890, 35, 4154, 11, 10891, 72, 40, 365, 33890, 17, 14565, 40, 79, 4550, 81, 28, 29741, 72, 40, 365, 33890, 17, 14565, 40, 79, 4550, 81, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 13247, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 13247, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 49, 39605, 7390, 87, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 49, 39605, 7390, 87, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 25166, 19580, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 25166, 19580, 11, 10891, 72, 36510, 34, 18055, 28, 29741, 72, 36510, 34, 18055, 11, 350, 56, 15571, 7378, 62, 33365, 24212, 62, 2389, 28, 29741, 72, 40, 365, 8895, 33, 11, 10891, 72, 40, 365, 36727, 31929, 32863, 21236, 19076, 28, 29741, 72, 40, 365, 36727, 31929, 32863, 21236, 19076, 11, 10891, 72, 40, 365, 36727, 31929, 27195, 6012, 17410, 28, 29741, 72, 40, 365, 36727, 31929, 27195, 6012, 17410, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 30150, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 30150, 11, 7653, 72, 40, 365, 47649, 3299, 17410, 28, 22396, 72, 40, 365, 47649, 3299, 17410, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 10962, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 10962, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 10962, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 9218, 10962, 11, 10891, 72, 40, 365, 8895, 40469, 14459, 28, 29741, 72, 40, 365, 8895, 40469, 14459, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 13290, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 13290, 11, 10891, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 49, 39605, 15732, 28, 29741, 72, 40, 365, 37, 80, 32656, 47, 3447, 1144, 49, 39605, 15732, 11, 10891, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 10962, 28, 29741, 72, 40, 365, 40, 79, 85, 19, 47, 3447, 1144, 9218, 10962, 11, 10891, 72, 40, 365, 38143, 3610, 17, 28, 29741, 72, 40, 365, 38143, 3610, 17, 11, 10891, 72, 40, 365, 36727, 31929, 47, 9501, 13247, 28, 29741, 72, 40, 365, 36727, 31929, 47, 9501, 13247, 11, 10891, 72, 40, 365, 10267, 82, 28, 29741, 72, 40, 365, 10267, 82, 11, 7653, 72, 40, 365, 32863, 21236, 19076, 28, 22396, 72, 40, 365, 32863, 21236, 19076, 11, 10891, 72, 40, 365, 36727, 31929, 25166, 19580, 28, 29741, 72, 40, 365, 36727, 31929, 25166, 19580, 11, 10891, 72, 40, 365, 36727, 31929, 53, 17, 27195, 6012, 17410, 28, 29741, 72, 40, 365, 36727, 31929, 53, 17, 27195, 6012, 17410, 8, 198 ]
2.381318
9,774
# Based on CreateQuadGeometry example import simpl import simplpy as d3d import simpl_helpers as sh import simpl_test_dirs as sd if __name__ == '__main__': CreateQuadGeometryTest()
[ 2, 13403, 319, 13610, 4507, 324, 10082, 15748, 1672, 198, 198, 11748, 7106, 198, 11748, 7106, 9078, 355, 288, 18, 67, 198, 11748, 7106, 62, 16794, 364, 355, 427, 198, 11748, 7106, 62, 9288, 62, 15908, 82, 355, 45647, 198, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 13610, 4507, 324, 10082, 15748, 14402, 3419, 198 ]
3.032787
61
""" PDF Enlarge =========== Scale the contents of a PDF document 2x. - Split each page into two parts along the perpendicular axis (e.g. one A4 page into two A5 pages). - Scale each split part 2 times (e.g. A5 -> A4) - Merge scaled parts into a new PDF document. """ import sys def main() -> int: """Console script entry point function.""" print('PDF Enlarge') return 0 if __name__ == '__main__': sys.exit(main())
[ 37811, 198, 20456, 2039, 11664, 198, 2559, 18604, 198, 198, 29990, 262, 10154, 286, 257, 12960, 3188, 362, 87, 13, 198, 198, 12, 27758, 1123, 2443, 656, 734, 3354, 1863, 262, 47190, 16488, 357, 68, 13, 70, 13, 530, 198, 220, 317, 19, 2443, 656, 734, 317, 20, 5468, 737, 198, 12, 21589, 1123, 6626, 636, 362, 1661, 357, 68, 13, 70, 13, 317, 20, 4613, 317, 19, 8, 198, 12, 39407, 27464, 3354, 656, 257, 649, 12960, 3188, 13, 198, 37811, 198, 198, 11748, 25064, 628, 198, 4299, 1388, 3419, 4613, 493, 25, 198, 220, 220, 220, 37227, 47581, 4226, 5726, 966, 2163, 526, 15931, 198, 220, 220, 220, 3601, 10786, 20456, 2039, 11664, 11537, 198, 220, 220, 220, 1441, 657, 628, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 25064, 13, 37023, 7, 12417, 28955, 198 ]
3.027586
145
# Copyright (C) 2011-2012 Canonical Services Ltd # # Permission is hereby granted, free of charge, to any person obtaining # a copy of this software and associated documentation files (the # "Software"), to deal in the Software without restriction, including # without limitation the rights to use, copy, modify, merge, publish, # distribute, sublicense, and/or sell copies of the Software, and to # permit persons to whom the Software is furnished to do so, subject to # the following conditions: # # The above copyright notice and this permission notice shall be # included in all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, # EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF # MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. # IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY # CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, # TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE # SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. from twisted.internet.protocol import ( DatagramProtocol, Factory) from twisted.protocols.basic import LineReceiver class StatsDServerProtocol(DatagramProtocol): """A Twisted-based implementation of the StatsD server. Data is received via UDP for local aggregation and then sent to a Graphite server via TCP. """ def datagramReceived(self, data, (host, port)): """Process received data and store it locally.""" if data == self.monitor_message: # Send the expected response to the # monitoring agent. return self.transport.write( self.monitor_response, (host, port)) return self.transport.reactor.callLater( 0, self.processor.process, data) class StatsDTCPServerProtocol(LineReceiver): """A Twisted-based implementation of the StatsD server over TCP. Data is received via TCP for local aggregation and then sent to a Graphite server via TCP. """ def lineReceived(self, data): """Process received data and store it locally.""" if data == self.monitor_message: # Send the expected response to the # monitoring agent. return self.transport.write(self.monitor_response) return self.transport.reactor.callLater( 0, self.processor.process, data)
[ 2, 15069, 357, 34, 8, 2813, 12, 6999, 19507, 605, 6168, 12052, 198, 2, 198, 2, 2448, 3411, 318, 29376, 7520, 11, 1479, 286, 3877, 11, 284, 597, 1048, 16727, 198, 2, 257, 4866, 286, 428, 3788, 290, 3917, 10314, 3696, 357, 1169, 198, 2, 366, 25423, 12340, 284, 1730, 287, 262, 10442, 1231, 17504, 11, 1390, 198, 2, 1231, 17385, 262, 2489, 284, 779, 11, 4866, 11, 13096, 11, 20121, 11, 7715, 11, 198, 2, 14983, 11, 850, 43085, 11, 290, 14, 273, 3677, 9088, 286, 262, 10442, 11, 290, 284, 198, 2, 8749, 6506, 284, 4150, 262, 10442, 318, 30760, 284, 466, 523, 11, 2426, 284, 198, 2, 262, 1708, 3403, 25, 198, 2, 198, 2, 383, 2029, 6634, 4003, 290, 428, 7170, 4003, 2236, 307, 198, 2, 3017, 287, 477, 9088, 393, 8904, 16690, 286, 262, 10442, 13, 198, 2, 198, 2, 3336, 47466, 3180, 36592, 2389, 1961, 366, 1921, 3180, 1600, 42881, 34764, 56, 3963, 15529, 509, 12115, 11, 198, 2, 7788, 32761, 6375, 8959, 49094, 11, 47783, 2751, 21728, 5626, 40880, 5390, 3336, 34764, 11015, 3963, 198, 2, 34482, 3398, 1565, 5603, 25382, 11, 376, 46144, 7473, 317, 16652, 2149, 37232, 33079, 48933, 5357, 44521, 1268, 10913, 2751, 12529, 13, 198, 2, 3268, 8005, 49261, 50163, 3336, 37195, 20673, 6375, 27975, 38162, 9947, 367, 15173, 4877, 9348, 43031, 19146, 7473, 15529, 198, 2, 47666, 3955, 11, 29506, 25552, 6375, 25401, 43031, 25382, 11, 7655, 2767, 16879, 3268, 3537, 40282, 3963, 27342, 10659, 11, 198, 2, 309, 9863, 6375, 25401, 54, 24352, 11, 5923, 1797, 2751, 16034, 11, 16289, 3963, 6375, 3268, 7102, 45, 24565, 13315, 3336, 198, 2, 47466, 6375, 3336, 23210, 6375, 25401, 5550, 1847, 20754, 3268, 3336, 47466, 13, 198, 198, 6738, 19074, 13, 37675, 13, 11235, 4668, 1330, 357, 198, 220, 220, 220, 16092, 6713, 19703, 4668, 11, 19239, 8, 198, 6738, 19074, 13, 11235, 4668, 82, 13, 35487, 1330, 6910, 3041, 39729, 628, 198, 4871, 20595, 5258, 18497, 19703, 4668, 7, 27354, 6713, 19703, 4668, 2599, 198, 220, 220, 220, 37227, 32, 40006, 12, 3106, 7822, 286, 262, 20595, 35, 4382, 13, 628, 220, 220, 220, 6060, 318, 2722, 2884, 36428, 329, 1957, 46500, 290, 788, 1908, 284, 257, 29681, 578, 198, 220, 220, 220, 4382, 2884, 23633, 13, 198, 220, 220, 220, 37227, 628, 220, 220, 220, 825, 4818, 6713, 3041, 6471, 7, 944, 11, 1366, 11, 357, 4774, 11, 2493, 8, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 18709, 2722, 1366, 290, 3650, 340, 15726, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 611, 1366, 6624, 2116, 13, 41143, 62, 20500, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16290, 262, 2938, 2882, 284, 262, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9904, 5797, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 7645, 634, 13, 13564, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 41143, 62, 26209, 11, 357, 4774, 11, 2493, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 7645, 634, 13, 260, 11218, 13, 13345, 18602, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 657, 11, 2116, 13, 41341, 13, 14681, 11, 1366, 8, 628, 198, 4871, 20595, 35, 4825, 3705, 18497, 19703, 4668, 7, 13949, 3041, 39729, 2599, 198, 220, 220, 220, 37227, 32, 40006, 12, 3106, 7822, 286, 262, 20595, 35, 4382, 625, 23633, 13, 628, 220, 220, 220, 6060, 318, 2722, 2884, 23633, 329, 1957, 46500, 290, 788, 1908, 284, 257, 29681, 578, 198, 220, 220, 220, 4382, 2884, 23633, 13, 198, 220, 220, 220, 37227, 628, 220, 220, 220, 825, 1627, 3041, 6471, 7, 944, 11, 1366, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 18709, 2722, 1366, 290, 3650, 340, 15726, 526, 15931, 198, 220, 220, 220, 220, 220, 220, 220, 611, 1366, 6624, 2116, 13, 41143, 62, 20500, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16290, 262, 2938, 2882, 284, 262, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9904, 5797, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 7645, 634, 13, 13564, 7, 944, 13, 41143, 62, 26209, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 7645, 634, 13, 260, 11218, 13, 13345, 18602, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 657, 11, 2116, 13, 41341, 13, 14681, 11, 1366, 8, 628 ]
3.159178
779
from __future__ import print_function # -*- coding: utf-8 -*- from six.moves import range from acq4.util import Qt import acq4.pyqtgraph as pg #import acq4.pyqtgraph.TreeWidget as TreeWidget import acq4.util.flowchart.EventDetection as FCEventDetection import acq4.util.debug as debug
[ 6738, 11593, 37443, 834, 1330, 3601, 62, 8818, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 198, 6738, 2237, 13, 76, 5241, 1330, 2837, 198, 198, 6738, 936, 80, 19, 13, 22602, 1330, 33734, 198, 11748, 936, 80, 19, 13, 9078, 80, 25297, 1470, 355, 23241, 198, 2, 11748, 936, 80, 19, 13, 9078, 80, 25297, 1470, 13, 27660, 38300, 355, 12200, 38300, 198, 11748, 936, 80, 19, 13, 22602, 13, 11125, 40926, 13, 9237, 11242, 3213, 355, 376, 5222, 1151, 11242, 3213, 198, 11748, 936, 80, 19, 13, 22602, 13, 24442, 355, 14257, 198 ]
2.813725
102
from shakenfist.client import apiclient from shakenfist_ci import base
[ 6738, 27821, 69, 396, 13, 16366, 1330, 2471, 291, 75, 1153, 198, 198, 6738, 27821, 69, 396, 62, 979, 1330, 2779, 628 ]
3.318182
22
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import models, migrations
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 6738, 11593, 37443, 834, 1330, 28000, 1098, 62, 17201, 874, 198, 198, 6738, 42625, 14208, 13, 9945, 1330, 4981, 11, 15720, 602, 628 ]
2.891892
37
# -*- coding: utf-8 -*- # Lint as: python3 # Copyright 2020 Google Inc. All Rights Reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """The deployments command group for the Apigee CLI.""" from __future__ import absolute_import from __future__ import division from __future__ import unicode_literals from googlecloudsdk.calliope import base class Deployments(base.Group): """Manage deployments of Apigee API proxies in runtime environments.""" detailed_help = { "DESCRIPTION": """ {description} `{command}` contains commands for enumerating and checking the status of deployments of proxies to runtime environments. """, "EXAMPLES": """ To list all deployments for the active Cloud Platform project, run: $ {command} list To list all deployments in a particular environment of a particular Apigee organization, run: $ {command} list --environment=ENVIRONMENT --organization=ORG_NAME To get the status of a specific deployment as a JSON object, run: $ {command} describe --api=API_NAME --environment=ENVIRONMENT --format=json """, }
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 1303, 406, 600, 355, 25, 21015, 18, 198, 2, 15069, 12131, 3012, 3457, 13, 1439, 6923, 33876, 13, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 345, 743, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789, 13, 198, 2, 921, 743, 7330, 257, 4866, 286, 262, 13789, 379, 198, 2, 198, 2, 220, 220, 220, 2638, 1378, 2503, 13, 43073, 13, 2398, 14, 677, 4541, 14, 43, 2149, 24290, 12, 17, 13, 15, 198, 2, 198, 2, 17486, 2672, 416, 9723, 1099, 393, 4987, 284, 287, 3597, 11, 3788, 198, 2, 9387, 739, 262, 13789, 318, 9387, 319, 281, 366, 1921, 3180, 1, 29809, 1797, 11, 198, 2, 42881, 34764, 11015, 6375, 7102, 49828, 11053, 3963, 15529, 509, 12115, 11, 2035, 4911, 393, 17142, 13, 198, 2, 4091, 262, 13789, 329, 262, 2176, 3303, 15030, 21627, 290, 198, 2, 11247, 739, 262, 13789, 13, 198, 37811, 464, 40854, 3141, 1448, 329, 262, 5949, 328, 1453, 43749, 526, 15931, 198, 198, 6738, 11593, 37443, 834, 1330, 4112, 62, 11748, 198, 6738, 11593, 37443, 834, 1330, 7297, 198, 6738, 11593, 37443, 834, 1330, 28000, 1098, 62, 17201, 874, 198, 198, 6738, 23645, 17721, 21282, 74, 13, 13345, 72, 3008, 1330, 2779, 628, 198, 4871, 34706, 902, 7, 8692, 13, 13247, 2599, 198, 220, 37227, 5124, 496, 40854, 286, 5949, 328, 1453, 7824, 41775, 287, 19124, 12493, 526, 15931, 628, 220, 6496, 62, 16794, 796, 1391, 198, 220, 220, 220, 220, 220, 366, 30910, 40165, 1298, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 11213, 92, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4600, 90, 21812, 92, 63, 4909, 9729, 329, 27056, 803, 290, 10627, 262, 3722, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 286, 40854, 286, 41775, 284, 19124, 12493, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 13538, 1600, 198, 220, 220, 220, 220, 220, 366, 6369, 2390, 6489, 1546, 1298, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1675, 1351, 477, 40854, 329, 262, 4075, 10130, 19193, 1628, 11, 1057, 25, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 720, 1391, 21812, 92, 1351, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1675, 1351, 477, 40854, 287, 257, 1948, 2858, 286, 257, 1948, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5949, 328, 1453, 4009, 11, 1057, 25, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 720, 1391, 21812, 92, 1351, 1377, 38986, 28, 1677, 53, 4663, 1340, 10979, 1377, 9971, 1634, 28, 1581, 38, 62, 20608, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1675, 651, 262, 3722, 286, 257, 2176, 14833, 355, 257, 19449, 2134, 11, 1057, 25, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 720, 1391, 21812, 92, 6901, 1377, 15042, 28, 17614, 62, 20608, 1377, 38986, 28, 1677, 53, 4663, 1340, 10979, 1377, 18982, 28, 17752, 198, 220, 220, 220, 220, 220, 13538, 1600, 198, 220, 1782, 628 ]
3.133087
541
import math def code(radius: int = 15, num_sides: int = 7) -> str: """ Example G-code module, regular polygon. Please simulate first, before milling. """ result = ["G90"] for i in range(num_sides): x = radius - radius * math.cos(2 * math.pi * i / num_sides) y = radius * math.sin(2 * math.pi * i / num_sides) result.append("G0 X%0.2f Y%0.2f" % ( x, y )) result.append("G0 X0 Y0") return '\n'.join(result)
[ 11748, 10688, 628, 198, 4299, 2438, 7, 42172, 25, 493, 796, 1315, 11, 997, 62, 82, 1460, 25, 493, 796, 767, 8, 4613, 965, 25, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 17934, 402, 12, 8189, 8265, 11, 3218, 7514, 14520, 13, 628, 220, 220, 220, 4222, 29308, 717, 11, 878, 3939, 278, 13, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 1255, 796, 14631, 38, 3829, 8973, 628, 220, 220, 220, 329, 1312, 287, 2837, 7, 22510, 62, 82, 1460, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 2124, 796, 16874, 532, 16874, 1635, 10688, 13, 6966, 7, 17, 1635, 10688, 13, 14415, 1635, 1312, 1220, 997, 62, 82, 1460, 8, 198, 220, 220, 220, 220, 220, 220, 220, 331, 796, 16874, 1635, 10688, 13, 31369, 7, 17, 1635, 10688, 13, 14415, 1635, 1312, 1220, 997, 62, 82, 1460, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1255, 13, 33295, 7203, 38, 15, 1395, 4, 15, 13, 17, 69, 575, 4, 15, 13, 17, 69, 1, 4064, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2124, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 331, 198, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 1255, 13, 33295, 7203, 38, 15, 1395, 15, 575, 15, 4943, 198, 220, 220, 220, 1441, 705, 59, 77, 4458, 22179, 7, 20274, 8, 198 ]
2.083682
239
import numpy as np from scipy.io import loadmat from scipy.fft import fft def make_point_clouds(vertices, temperature): """[summary] Parameters ---------- vertices : ndarray of shape (n_vertices, 3) Vertices of the mesh as 3D points. temperature : ndarray of shape (n_vertices, n_functions) A collection of functions defined on the vertices of the mesh, such as SIHKS or other spectral descriptor. Returns ------- point_clouds : ndarray of shape (n_functions, n_vertices, 4) Collection of point clouds formed by concatenating the vertex coordinates and the corresponding temperature for each given function. """ n_vertices = vertices.shape[0] n_functions = temperature.shape[1] # Repeat points n_function times [n_functions, n_vertices, 3] vertices = np.tile(vertices, reps=(n_functions, 1)) vertices = vertices.reshape(n_functions, n_vertices, 3) # Reshape temperature [n_functions, n_vertices, 1] temperature = np.expand_dims(temperature.T, axis=-1) # Concatenate coordinates and temperature point_clouds = np.concatenate([vertices, temperature], axis=-1) return point_clouds
[ 11748, 299, 32152, 355, 45941, 198, 198, 6738, 629, 541, 88, 13, 952, 1330, 3440, 6759, 198, 6738, 629, 541, 88, 13, 487, 83, 1330, 277, 701, 628, 198, 198, 4299, 787, 62, 4122, 62, 17721, 82, 7, 1851, 1063, 11, 5951, 2599, 198, 220, 220, 220, 13538, 17912, 49736, 60, 628, 220, 220, 220, 40117, 198, 220, 220, 220, 24200, 438, 198, 220, 220, 220, 9421, 1063, 1058, 299, 67, 18747, 286, 5485, 357, 77, 62, 1851, 1063, 11, 513, 8, 198, 220, 220, 220, 220, 220, 220, 220, 24417, 1063, 286, 262, 19609, 355, 513, 35, 2173, 13, 198, 220, 220, 220, 5951, 1058, 299, 67, 18747, 286, 5485, 357, 77, 62, 1851, 1063, 11, 299, 62, 12543, 2733, 8, 198, 220, 220, 220, 220, 220, 220, 220, 317, 4947, 286, 5499, 5447, 319, 262, 9421, 1063, 286, 262, 19609, 11, 884, 355, 25861, 39, 27015, 393, 584, 37410, 43087, 13, 628, 220, 220, 220, 16409, 198, 220, 220, 220, 35656, 198, 220, 220, 220, 966, 62, 17721, 82, 1058, 299, 67, 18747, 286, 5485, 357, 77, 62, 12543, 2733, 11, 299, 62, 1851, 1063, 11, 604, 8, 198, 220, 220, 220, 220, 220, 220, 220, 12251, 286, 966, 15114, 7042, 416, 1673, 36686, 803, 262, 37423, 22715, 290, 262, 11188, 198, 220, 220, 220, 220, 220, 220, 220, 5951, 329, 1123, 1813, 2163, 13, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 299, 62, 1851, 1063, 796, 9421, 1063, 13, 43358, 58, 15, 60, 198, 220, 220, 220, 299, 62, 12543, 2733, 796, 5951, 13, 43358, 58, 16, 60, 628, 220, 220, 220, 1303, 30021, 2173, 299, 62, 8818, 1661, 685, 77, 62, 12543, 2733, 11, 299, 62, 1851, 1063, 11, 513, 60, 198, 220, 220, 220, 9421, 1063, 796, 45941, 13, 40927, 7, 1851, 1063, 11, 20982, 16193, 77, 62, 12543, 2733, 11, 352, 4008, 198, 220, 220, 220, 9421, 1063, 796, 9421, 1063, 13, 3447, 1758, 7, 77, 62, 12543, 2733, 11, 299, 62, 1851, 1063, 11, 513, 8, 628, 220, 220, 220, 1303, 1874, 71, 1758, 5951, 685, 77, 62, 12543, 2733, 11, 299, 62, 1851, 1063, 11, 352, 60, 198, 220, 220, 220, 5951, 796, 45941, 13, 11201, 392, 62, 67, 12078, 7, 11498, 21069, 13, 51, 11, 16488, 10779, 16, 8, 628, 220, 220, 220, 1303, 1482, 9246, 268, 378, 22715, 290, 5951, 198, 220, 220, 220, 966, 62, 17721, 82, 796, 45941, 13, 1102, 9246, 268, 378, 26933, 1851, 1063, 11, 5951, 4357, 16488, 10779, 16, 8, 628, 220, 220, 220, 1441, 966, 62, 17721, 82, 628 ]
2.803279
427
from argparse import ( Action, Namespace, HelpFormatter, OPTIONAL, REMAINDER, SUPPRESS, PARSER, ONE_OR_MORE, ZERO_OR_MORE, ) from .actions import * from .cli import * from .core import * from .deprecated import * from .formatters import * from .jsonnet import * from .jsonschema import * from .optionals import * from .signatures import * from .typehints import * from .util import * __version__ = '3.19.2'
[ 6738, 1822, 29572, 1330, 357, 198, 220, 220, 220, 7561, 11, 198, 220, 220, 220, 28531, 10223, 11, 198, 220, 220, 220, 10478, 8479, 1436, 11, 198, 220, 220, 220, 39852, 2849, 1847, 11, 198, 220, 220, 220, 22657, 32, 12115, 1137, 11, 198, 220, 220, 220, 19549, 32761, 11, 198, 220, 220, 220, 350, 27415, 1137, 11, 198, 220, 220, 220, 16329, 62, 1581, 62, 23346, 11, 198, 220, 220, 220, 1168, 34812, 62, 1581, 62, 23346, 11, 198, 8, 198, 6738, 764, 4658, 1330, 1635, 198, 6738, 764, 44506, 1330, 1635, 198, 6738, 764, 7295, 1330, 1635, 198, 6738, 764, 10378, 31023, 1330, 1635, 198, 6738, 764, 18982, 1010, 1330, 1635, 198, 6738, 764, 17752, 3262, 1330, 1635, 198, 6738, 764, 8457, 684, 2395, 2611, 1330, 1635, 198, 6738, 764, 18076, 874, 1330, 1635, 198, 6738, 764, 12683, 6691, 1330, 1635, 198, 6738, 764, 4906, 71, 29503, 1330, 1635, 198, 6738, 764, 22602, 1330, 1635, 628, 198, 834, 9641, 834, 796, 705, 18, 13, 1129, 13, 17, 6, 198 ]
2.602339
171
#!@PYTHON_EXECUTABLE@ #ckwg +28 # Copyright 2011-2013 by Kitware, Inc. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # # * Redistributions of source code must retain the above copyright notice, # this list of conditions and the following disclaimer. # # * Redistributions in binary form must reproduce the above copyright notice, # this list of conditions and the following disclaimer in the documentation # and/or other materials provided with the distribution. # # * Neither name of Kitware, Inc. nor the names of any contributors may be used # to endorse or promote products derived from this software without specific # prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS ``AS IS'' # AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE AUTHORS OR CONTRIBUTORS BE LIABLE FOR # ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR # SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER # CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, # OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE # OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. if __name__ == '__main__': import os import sys if not len(sys.argv) == 4: test_error("Expected three arguments") sys.exit(1) testname = sys.argv[1] os.chdir(sys.argv[2]) sys.path.append(sys.argv[3]) from sprokit.test.test import * run_test(testname, find_tests(locals()))
[ 2, 0, 31, 47, 56, 4221, 1340, 62, 6369, 2943, 3843, 17534, 31, 198, 2, 694, 86, 70, 1343, 2078, 198, 2, 15069, 2813, 12, 6390, 416, 10897, 1574, 11, 3457, 13, 198, 2, 1439, 2489, 10395, 13, 198, 2, 198, 2, 2297, 396, 3890, 290, 779, 287, 2723, 290, 13934, 5107, 11, 351, 393, 1231, 198, 2, 17613, 11, 389, 10431, 2810, 326, 262, 1708, 3403, 389, 1138, 25, 198, 2, 198, 2, 220, 1635, 2297, 396, 2455, 507, 286, 2723, 2438, 1276, 12377, 262, 2029, 6634, 4003, 11, 198, 2, 220, 220, 220, 428, 1351, 286, 3403, 290, 262, 1708, 37592, 13, 198, 2, 198, 2, 220, 1635, 2297, 396, 2455, 507, 287, 13934, 1296, 1276, 22919, 262, 2029, 6634, 4003, 11, 198, 2, 220, 220, 220, 428, 1351, 286, 3403, 290, 262, 1708, 37592, 287, 262, 10314, 198, 2, 220, 220, 220, 290, 14, 273, 584, 5696, 2810, 351, 262, 6082, 13, 198, 2, 198, 2, 220, 1635, 16126, 1438, 286, 10897, 1574, 11, 3457, 13, 4249, 262, 3891, 286, 597, 20420, 743, 307, 973, 198, 2, 220, 220, 220, 284, 11438, 393, 7719, 3186, 10944, 422, 428, 3788, 1231, 2176, 198, 2, 220, 220, 220, 3161, 3194, 7170, 13, 198, 2, 198, 2, 12680, 47466, 3180, 36592, 2389, 1961, 11050, 3336, 27975, 38162, 9947, 367, 15173, 4877, 5357, 27342, 9865, 3843, 20673, 7559, 1921, 3180, 7061, 198, 2, 5357, 15529, 7788, 32761, 6375, 8959, 49094, 34764, 11015, 11, 47783, 2751, 11, 21728, 5626, 40880, 5390, 11, 3336, 198, 2, 8959, 49094, 34764, 11015, 3963, 34482, 3398, 1565, 5603, 25382, 5357, 376, 46144, 7473, 317, 16652, 2149, 37232, 33079, 48933, 198, 2, 15986, 13954, 48778, 1961, 13, 3268, 8005, 49261, 50163, 3336, 37195, 20673, 6375, 27342, 9865, 3843, 20673, 9348, 43031, 19146, 7473, 198, 2, 15529, 42242, 11, 3268, 17931, 23988, 11, 19387, 25256, 1847, 11, 38846, 11, 7788, 3620, 6489, 13153, 11, 6375, 7102, 5188, 10917, 3525, 12576, 198, 2, 29506, 25552, 357, 1268, 39149, 2751, 11, 21728, 5626, 40880, 5390, 11, 41755, 11335, 10979, 3963, 28932, 2257, 2043, 37780, 21090, 50, 6375, 198, 2, 49254, 26, 406, 18420, 3963, 23210, 11, 42865, 11, 6375, 4810, 19238, 29722, 26, 6375, 43949, 44180, 23255, 49, 8577, 24131, 8, 29630, 36, 5959, 198, 2, 7257, 2937, 1961, 5357, 6177, 15529, 3336, 15513, 3963, 43031, 25382, 11, 7655, 2767, 16879, 3268, 27342, 10659, 11, 19269, 18379, 43031, 25382, 11, 198, 2, 6375, 309, 9863, 357, 1268, 39149, 2751, 399, 7156, 43, 3528, 18310, 6375, 25401, 54, 24352, 8, 5923, 1797, 2751, 3268, 15529, 34882, 16289, 3963, 3336, 23210, 198, 2, 3963, 12680, 47466, 11, 45886, 16876, 5984, 29817, 1961, 3963, 3336, 28069, 11584, 25382, 3963, 13558, 3398, 29506, 11879, 13, 628, 628, 628, 628, 628, 628, 628, 628, 198, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 1330, 28686, 198, 220, 220, 220, 1330, 25064, 628, 220, 220, 220, 611, 407, 18896, 7, 17597, 13, 853, 85, 8, 6624, 604, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1332, 62, 18224, 7203, 3109, 7254, 1115, 7159, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 25064, 13, 37023, 7, 16, 8, 628, 220, 220, 220, 1332, 3672, 796, 25064, 13, 853, 85, 58, 16, 60, 628, 220, 220, 220, 28686, 13, 354, 15908, 7, 17597, 13, 853, 85, 58, 17, 12962, 628, 220, 220, 220, 25064, 13, 6978, 13, 33295, 7, 17597, 13, 853, 85, 58, 18, 12962, 628, 220, 220, 220, 422, 599, 305, 15813, 13, 9288, 13, 9288, 1330, 1635, 628, 220, 220, 220, 1057, 62, 9288, 7, 9288, 3672, 11, 1064, 62, 41989, 7, 17946, 874, 3419, 4008, 198 ]
3.124386
611
import hashlib from corehq.apps.integration.models import ( DialerSettings, GaenOtpServerSettings, HmacCalloutSettings, )
[ 11748, 12234, 8019, 198, 198, 6738, 4755, 71, 80, 13, 18211, 13, 18908, 1358, 13, 27530, 1330, 357, 198, 220, 220, 220, 21269, 263, 26232, 11, 198, 220, 220, 220, 12822, 268, 46, 34788, 10697, 26232, 11, 198, 220, 220, 220, 367, 20285, 14134, 448, 26232, 11, 198, 8, 628, 628, 628, 628 ]
2.679245
53
#!/usr/bin/env python import os, sys, warnings, logging logger = logging.getLogger(__name__) if __name__ == "__main__": os.environ.setdefault("DJANGO_SETTINGS_MODULE", "dashboard.settings") from django.core.management import execute_from_command_line # Regex for which modules to ignore warnings from IGNORE_MODULES = 'djangosaml2' warnings.filterwarnings("ignore", module=IGNORE_MODULES, category=DeprecationWarning) execute_from_command_line(sys.argv)
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 11748, 28686, 11, 25064, 11, 14601, 11, 18931, 198, 198, 6404, 1362, 796, 18931, 13, 1136, 11187, 1362, 7, 834, 3672, 834, 8, 198, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 628, 220, 220, 220, 28686, 13, 268, 2268, 13, 2617, 12286, 7203, 35028, 1565, 11230, 62, 28480, 51, 20754, 62, 33365, 24212, 1600, 366, 42460, 3526, 13, 33692, 4943, 628, 220, 220, 220, 422, 42625, 14208, 13, 7295, 13, 27604, 1330, 12260, 62, 6738, 62, 21812, 62, 1370, 628, 220, 220, 220, 1303, 797, 25636, 329, 543, 13103, 284, 8856, 14601, 422, 198, 220, 220, 220, 28730, 6965, 62, 33365, 6239, 1546, 796, 705, 28241, 648, 418, 43695, 17, 6, 198, 220, 220, 220, 14601, 13, 24455, 40539, 654, 7203, 46430, 1600, 8265, 28, 16284, 6965, 62, 33365, 6239, 1546, 11, 6536, 28, 12156, 8344, 341, 20361, 8, 628, 220, 220, 220, 12260, 62, 6738, 62, 21812, 62, 1370, 7, 17597, 13, 853, 85, 8, 198 ]
2.847059
170
import torch from torch import autograd, nn import torch.nn.functional as functional import utils
[ 11748, 28034, 198, 6738, 28034, 1330, 1960, 519, 6335, 11, 299, 77, 198, 11748, 28034, 13, 20471, 13, 45124, 355, 10345, 198, 198, 11748, 3384, 4487, 628, 198, 220, 220, 220, 220, 220, 220, 220, 220, 628 ]
3
37
import os basedir = os.path.abspath(os.path.dirname(__file__))
[ 11748, 28686, 198, 3106, 343, 796, 28686, 13, 6978, 13, 397, 2777, 776, 7, 418, 13, 6978, 13, 15908, 3672, 7, 834, 7753, 834, 4008 ]
2.48
25
import re import yaml def split_markup(markup): """ Given some markup, return a tuple containing the decoded data and the template code. """ match = re.search(r'\n={3,}\n', markup) if match: start, end = match.span() ctx = yaml.load(markup[:start]) template_code = markup[end:] else: ctx = {} template_code = markup return ctx, template_code
[ 11748, 302, 198, 198, 11748, 331, 43695, 628, 198, 4299, 6626, 62, 4102, 929, 7, 4102, 929, 2599, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 11259, 617, 41485, 11, 1441, 257, 46545, 7268, 262, 875, 9043, 1366, 290, 262, 198, 220, 220, 220, 11055, 2438, 13, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 2872, 796, 302, 13, 12947, 7, 81, 6, 59, 77, 34758, 18, 11, 32239, 77, 3256, 41485, 8, 198, 220, 220, 220, 611, 2872, 25, 198, 220, 220, 220, 220, 220, 220, 220, 923, 11, 886, 796, 2872, 13, 12626, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 269, 17602, 796, 331, 43695, 13, 2220, 7, 4102, 929, 58, 25, 9688, 12962, 198, 220, 220, 220, 220, 220, 220, 220, 11055, 62, 8189, 796, 41485, 58, 437, 47715, 198, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 269, 17602, 796, 23884, 198, 220, 220, 220, 220, 220, 220, 220, 11055, 62, 8189, 796, 41485, 628, 220, 220, 220, 1441, 269, 17602, 11, 11055, 62, 8189, 198 ]
2.335196
179
# CÓDIGO DE PRUEBA #!/usr/bin/env python # -*- coding: utf-8 -*- from pymongo import MongoClient from bson.objectid import ObjectId from nltk.tokenize import TweetTokenizer from datetime import datetime as dt try: client = MongoClient() print("Connected to MongoDB\n") except pymongo.errors.ConnectionFailure as e: print("Could not connect to MongoDB",e) db = client.sept2017_db tweets = db.sept2017_collection fecha1 = "Tue Sep 19 00:00:01 +0000 2017" fecha_inicio = dt.strptime(fecha1,'%a %b %d %H:%M:%S +0000 %Y') print(fecha_inicio) fecha2 = "Tue Sep 26 23:59:59 +0000 2017" fecha_fin = dt.strptime(fecha2,'%a %b %d %H:%M:%S +0000 %Y') print(fecha_fin) tknzr = TweetTokenizer(preserve_case=False, # Convertir a minúsculas reduce_len=True, # Reducir caracteres repetidos strip_handles=False) # Mostrar @usuarios id_tweet = tknzr.tokenize(tweets.find_one({'_id': ObjectId('59e55c370e0bab1d26640d94') }).get('text')) #fecha_tweet = tknzr.tokenize(tweets.find_one({"created_at": {"$gte":dt(2017,9,19),"$lt":dt(2017,9,26)}}).get('text')) print(id_tweet)
[ 2, 327, 127, 241, 35, 3528, 46, 5550, 4810, 8924, 4339, 198, 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 198, 6738, 279, 4948, 25162, 1330, 42591, 11792, 198, 6738, 275, 1559, 13, 15252, 312, 1330, 9515, 7390, 198, 6738, 299, 2528, 74, 13, 30001, 1096, 1330, 18752, 30642, 7509, 198, 6738, 4818, 8079, 1330, 4818, 8079, 355, 288, 83, 628, 198, 28311, 25, 198, 197, 16366, 796, 42591, 11792, 3419, 198, 197, 4798, 7203, 13313, 276, 284, 42591, 11012, 59, 77, 4943, 198, 16341, 279, 4948, 25162, 13, 48277, 13, 32048, 50015, 355, 304, 25, 198, 197, 4798, 7203, 23722, 407, 2018, 284, 42591, 11012, 1600, 68, 8, 198, 198, 9945, 796, 5456, 13, 325, 457, 5539, 62, 9945, 198, 83, 732, 1039, 796, 20613, 13, 325, 457, 5539, 62, 43681, 198, 198, 69, 3055, 64, 16, 796, 366, 41392, 8621, 678, 3571, 25, 405, 25, 486, 1343, 2388, 2177, 1, 198, 69, 3055, 64, 62, 259, 46441, 796, 288, 83, 13, 2536, 457, 524, 7, 69, 3055, 64, 16, 4032, 4, 64, 4064, 65, 4064, 67, 4064, 39, 25, 4, 44, 25, 4, 50, 1343, 2388, 4064, 56, 11537, 198, 4798, 7, 69, 3055, 64, 62, 259, 46441, 8, 198, 198, 69, 3055, 64, 17, 796, 366, 41392, 8621, 2608, 2242, 25, 3270, 25, 3270, 1343, 2388, 2177, 1, 198, 69, 3055, 64, 62, 15643, 796, 288, 83, 13, 2536, 457, 524, 7, 69, 3055, 64, 17, 4032, 4, 64, 4064, 65, 4064, 67, 4064, 39, 25, 4, 44, 25, 4, 50, 1343, 2388, 4064, 56, 11537, 198, 4798, 7, 69, 3055, 64, 62, 15643, 8, 198, 198, 83, 15418, 89, 81, 796, 18752, 30642, 7509, 7, 18302, 3760, 62, 7442, 28, 25101, 11, 220, 220, 220, 220, 220, 220, 1303, 38240, 343, 257, 949, 21356, 1416, 25283, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4646, 62, 11925, 28, 17821, 11, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2297, 1229, 343, 1097, 529, 68, 411, 46152, 312, 418, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10283, 62, 4993, 829, 28, 25101, 8, 220, 220, 220, 220, 220, 220, 1303, 4042, 20040, 2488, 385, 84, 13010, 628, 198, 312, 62, 83, 7277, 796, 256, 15418, 89, 81, 13, 30001, 1096, 7, 83, 732, 1039, 13, 19796, 62, 505, 15090, 6, 62, 312, 10354, 9515, 7390, 10786, 3270, 68, 2816, 66, 20167, 68, 15, 65, 397, 16, 67, 25540, 1821, 67, 5824, 11537, 1782, 737, 1136, 10786, 5239, 6, 4008, 198, 2, 69, 3055, 64, 62, 83, 7277, 796, 256, 15418, 89, 81, 13, 30001, 1096, 7, 83, 732, 1039, 13, 19796, 62, 505, 7, 4895, 25598, 62, 265, 1298, 19779, 3, 70, 660, 1298, 28664, 7, 5539, 11, 24, 11, 1129, 27267, 3, 2528, 1298, 28664, 7, 5539, 11, 24, 11, 2075, 8, 11709, 737, 1136, 10786, 5239, 6, 4008, 198, 198, 4798, 7, 312, 62, 83, 7277, 8, 198 ]
2.131579
532
__all__ = ["PairedNote"] class PairedNote: """This class holds a DebitNote together with its matching CreditNote(s) """ def __init__(self, debit_note, credit_note): """Construct from the matching pair of notes""" from Acquire.Accounting import CreditNote as _CreditNote from Acquire.Accounting import DebitNote as _DebitNote if not isinstance(debit_note, _DebitNote): raise TypeError("The debit_note must be of type DebitNote!") if not isinstance(credit_note, _CreditNote): raise TypeError("The credit_note must be of type CreditNote!") if credit_note.debit_note_uid() != debit_note.uid(): raise ValueError( "You must pair up DebitNote (%s) with a " "matching CreditNote (%s)" % (debit_note.uid(), credit_note.debit_note_uid()) ) self._debit_note = debit_note self._credit_note = credit_note def debit_note(self): """Return the debit note""" return self._debit_note def credit_note(self): """Return the credit note""" return self._credit_note @staticmethod def create(debit_notes, credit_notes): """Return a list of PairedNotes that pair together the passed debit notes and credit notes """ try: debit_note = debit_notes[0] except: debit_notes = [debit_notes] if not isinstance(credit_notes, dict): try: credit_notes[0] except: credit_notes = [credit_notes] d = {} for credit_note in credit_notes: d[credit_note.debit_note_uid()] = credit_note credit_notes = d pairs = [] missing = [] for debit_note in debit_notes: if debit_note.uid() in credit_notes: pairs.append(PairedNote(debit_note, credit_notes[debit_note.uid()])) else: missing.append(debit_note) if len(missing) > 0 or len(credit_notes) != len(debit_notes): from Acquire.Accounting import UnbalancedLedgerError raise UnbalancedLedgerError( "Cannot balance the ledger as the debit do not match the " "credits %s versus %s" % (str(debit_notes), str(credit_notes)) ) return pairs
[ 834, 439, 834, 796, 14631, 47, 9820, 6425, 8973, 628, 198, 4871, 350, 9820, 6425, 25, 198, 220, 220, 220, 37227, 1212, 1398, 6622, 257, 1024, 2545, 6425, 1978, 351, 663, 12336, 198, 220, 220, 220, 10504, 6425, 7, 82, 8, 198, 220, 220, 220, 37227, 628, 220, 220, 220, 825, 11593, 15003, 834, 7, 944, 11, 30977, 62, 11295, 11, 3884, 62, 11295, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 42316, 422, 262, 12336, 5166, 286, 4710, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 422, 24939, 557, 13, 30116, 278, 1330, 10504, 6425, 355, 4808, 23690, 6425, 198, 220, 220, 220, 220, 220, 220, 220, 422, 24939, 557, 13, 30116, 278, 1330, 1024, 2545, 6425, 355, 4808, 16587, 270, 6425, 628, 220, 220, 220, 220, 220, 220, 220, 611, 407, 318, 39098, 7, 11275, 270, 62, 11295, 11, 4808, 16587, 270, 6425, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 5994, 12331, 7203, 464, 30977, 62, 11295, 1276, 307, 286, 2099, 1024, 2545, 6425, 2474, 8, 628, 220, 220, 220, 220, 220, 220, 220, 611, 407, 318, 39098, 7, 43082, 62, 11295, 11, 4808, 23690, 6425, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 5994, 12331, 7203, 464, 3884, 62, 11295, 1276, 307, 286, 2099, 10504, 6425, 2474, 8, 628, 220, 220, 220, 220, 220, 220, 220, 611, 3884, 62, 11295, 13, 11275, 270, 62, 11295, 62, 27112, 3419, 14512, 30977, 62, 11295, 13, 27112, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 11052, 12331, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1639, 1276, 5166, 510, 1024, 2545, 6425, 37633, 82, 8, 351, 257, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 15699, 278, 10504, 6425, 37633, 82, 16725, 4064, 357, 11275, 270, 62, 11295, 13, 27112, 22784, 3884, 62, 11295, 13, 11275, 270, 62, 11295, 62, 27112, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 11275, 270, 62, 11295, 796, 30977, 62, 11295, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13557, 43082, 62, 11295, 796, 3884, 62, 11295, 628, 220, 220, 220, 825, 30977, 62, 11295, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 13615, 262, 30977, 3465, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13557, 11275, 270, 62, 11295, 628, 220, 220, 220, 825, 3884, 62, 11295, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 13615, 262, 3884, 3465, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13557, 43082, 62, 11295, 628, 220, 220, 220, 2488, 12708, 24396, 198, 220, 220, 220, 825, 2251, 7, 11275, 270, 62, 17815, 11, 3884, 62, 17815, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 13615, 257, 1351, 286, 350, 9820, 16130, 326, 5166, 1978, 262, 3804, 198, 220, 220, 220, 220, 220, 220, 220, 30977, 4710, 290, 3884, 4710, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30977, 62, 11295, 796, 30977, 62, 17815, 58, 15, 60, 198, 220, 220, 220, 220, 220, 220, 220, 2845, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30977, 62, 17815, 796, 685, 11275, 270, 62, 17815, 60, 628, 220, 220, 220, 220, 220, 220, 220, 611, 407, 318, 39098, 7, 43082, 62, 17815, 11, 8633, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3884, 62, 17815, 58, 15, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3884, 62, 17815, 796, 685, 43082, 62, 17815, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 288, 796, 23884, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 329, 3884, 62, 11295, 287, 3884, 62, 17815, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 288, 58, 43082, 62, 11295, 13, 11275, 270, 62, 11295, 62, 27112, 3419, 60, 796, 3884, 62, 11295, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3884, 62, 17815, 796, 288, 628, 220, 220, 220, 220, 220, 220, 220, 14729, 796, 17635, 198, 220, 220, 220, 220, 220, 220, 220, 4814, 796, 17635, 628, 220, 220, 220, 220, 220, 220, 220, 329, 30977, 62, 11295, 287, 30977, 62, 17815, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 30977, 62, 11295, 13, 27112, 3419, 287, 3884, 62, 17815, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 14729, 13, 33295, 7, 47, 9820, 6425, 7, 11275, 270, 62, 11295, 11, 3884, 62, 17815, 58, 11275, 270, 62, 11295, 13, 27112, 3419, 60, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4814, 13, 33295, 7, 11275, 270, 62, 11295, 8, 628, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 45688, 8, 1875, 657, 393, 18896, 7, 43082, 62, 17815, 8, 14512, 18896, 7, 11275, 270, 62, 17815, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 422, 24939, 557, 13, 30116, 278, 1330, 791, 27753, 42416, 1362, 12331, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 791, 27753, 42416, 1362, 12331, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 34, 34574, 5236, 262, 37208, 355, 262, 30977, 466, 407, 2872, 262, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 66, 20696, 4064, 82, 9051, 4064, 82, 1, 4064, 357, 2536, 7, 11275, 270, 62, 17815, 828, 965, 7, 43082, 62, 17815, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 1441, 14729, 198 ]
2.200366
1,093
from nltk import * from nltk.corpus import * ans = 'Y' while((ans=='y')|(ans=='Y')): input1 = input("Write a scentence") lang = detect_language(input1) print(input1+"\t Langauge: "+ lang) ans = input("to do this again enter (y/Y)")
[ 6738, 299, 2528, 74, 1330, 1635, 201, 198, 6738, 299, 2528, 74, 13, 10215, 79, 385, 1330, 1635, 201, 198, 504, 796, 705, 56, 6, 201, 198, 4514, 19510, 504, 855, 6, 88, 11537, 91, 7, 504, 855, 6, 56, 11537, 2599, 201, 198, 220, 220, 220, 5128, 16, 796, 5128, 7203, 16594, 257, 21212, 594, 4943, 201, 198, 220, 220, 220, 42392, 796, 4886, 62, 16129, 7, 15414, 16, 8, 201, 198, 220, 220, 220, 3601, 7, 15414, 16, 10, 1, 59, 83, 16332, 559, 469, 25, 43825, 42392, 8, 201, 198, 220, 220, 220, 9093, 796, 5128, 7203, 1462, 466, 428, 757, 3802, 357, 88, 14, 56, 8, 4943, 201, 198 ]
2.265487
113
import os import sys sys.path.append(os.path.join(os.path.dirname(__file__), "../test/integration/pyxl/")) from pyxl.codec.register import pyxl_transform_string for i in xrange(100): # pyxl/tests/test_if_1.py pyxl_transform_string( ''' from pyxl import html def test(): assert str(<frag><if cond="{True}">true</if><else>false</else></frag>) == "true" assert str(<frag><if cond="{False}">true</if><else>false</else></frag>) == "false" ''') for i in xrange(100): # pyxl/tests/test_curlies_in_attrs_1.py pyxl_transform_string( ''' from pyxl import html def test(): # kannan thinks this should be different assert str(<frag><img src="{'foo'}" /></frag>) == """<img src="foo" />""" ''') for i in xrange(100): # pyxl/tests/test_rss.py pyxl_transform_string( ''' import datetime from unittest2 import TestCase from pyxl import html from pyxl import rss class RssTests(TestCase): def test_decl(self): decl = <rss.rss_decl_standalone />.to_string() self.assertEqual(decl, u'<?xml version="1.0" encoding="UTF-8" standalone="yes" ?>') def test_rss(self): r = <rss.rss version="2.0" />.to_string() self.assertEqual(r, u'<rss version="2.0"></rss>') def test_channel(self): c = ( <rss.rss version="2.0"> <rss.channel /> </rss.rss> ).to_string() self.assertEqual(c, u'<rss version="2.0"><channel></channel></rss>') def test_channel_with_required_elements(self): channel = ( <frag> <rss.rss_decl_standalone /> <rss.rss version="2.0"> <rss.channel> <rss.title>A Title</rss.title> <rss.link>https://www.dropbox.com</rss.link> <rss.description>A detailed description</rss.description> </rss.channel> </rss.rss> </frag> ) expected = """ <?xml version="1.0" encoding="UTF-8" standalone="yes" ?> <rss version="2.0"> <channel> <title>A Title</title> <link>https://www.dropbox.com</link> <description>A detailed description</description> </channel> </rss> """ expected = u''.join(l.strip() for l in expected.splitlines()) self.assertEqual(channel.to_string(), expected) def test_channel_with_optional_elements(self): channel = ( <frag> <rss.rss_decl_standalone /> <rss.rss version="2.0"> <rss.channel> <rss.title>A Title</rss.title> <rss.link>https://www.dropbox.com</rss.link> <rss.description>A detailed description</rss.description> <rss.ttl>60</rss.ttl> <rss.language>en-us</rss.language> </rss.channel> </rss.rss> </frag> ) expected = """ <?xml version="1.0" encoding="UTF-8" standalone="yes" ?> <rss version="2.0"> <channel> <title>A Title</title> <link>https://www.dropbox.com</link> <description>A detailed description</description> <ttl>60</ttl> <language>en-us</language> </channel> </rss> """ expected = u''.join(l.strip() for l in expected.splitlines()) self.assertEqual(channel.to_string(), expected) def test_item_with_common_elements(self): item = ( <rss.item> <rss.title>Item Title</rss.title> <rss.description> {html.rawhtml('<![CDATA[ ')} This is a really interesting description {html.rawhtml(']]>')} </rss.description> <rss.link>https://www.dropbox.com/somewhere</rss.link> </rss.item> ) expected = """ <item> <title>Item Title</title> <description><![CDATA[ This is a really interesting description ]]></description> <link>https://www.dropbox.com/somewhere</link> </item> """ expected = u''.join(l.strip() for l in expected.splitlines()) self.assertEqual(item.to_string(), expected) def test_guid(self): self.assertEqual(<rss.guid>foo</rss.guid>.to_string(), u'<guid>foo</guid>') self.assertEqual(<rss.guid is-perma-link="{False}">foo</rss.guid>.to_string(), u'<guid isPermaLink="false">foo</guid>') self.assertEqual(<rss.guid is-perma-link="{True}">foo</rss.guid>.to_string(), u'<guid isPermaLink="true">foo</guid>') def test_date_elements(self): dt = datetime.datetime(2013, 12, 17, 23, 54, 14) self.assertEqual(<rss.pubDate date="{dt}" />.to_string(), u'<pubDate>Tue, 17 Dec 2013 23:54:14 GMT</pubDate>') self.assertEqual(<rss.lastBuildDate date="{dt}" />.to_string(), u'<lastBuildDate>Tue, 17 Dec 2013 23:54:14 GMT</lastBuildDate>') def test_rss_document(self): dt = datetime.datetime(2013, 12, 17, 23, 54, 14) dt2 = datetime.datetime(2013, 12, 18, 11, 54, 14) doc = ( <frag> <rss.rss_decl_standalone /> <rss.rss version="2.0"> <rss.channel> <rss.title>A Title</rss.title> <rss.link>https://www.dropbox.com</rss.link> <rss.description>A detailed description</rss.description> <rss.ttl>60</rss.ttl> <rss.language>en-us</rss.language> <rss.lastBuildDate date="{dt}" /> <rss.item> <rss.title>Item Title</rss.title> <rss.description> {html.rawhtml('<![CDATA[ ')} This is a really interesting description {html.rawhtml(']]>')} </rss.description> <rss.link>https://www.dropbox.com/somewhere</rss.link> <rss.pubDate date="{dt}" /> <rss.guid is-perma-link="{False}">123456789</rss.guid> </rss.item> <rss.item> <rss.title>Another Item</rss.title> <rss.description> {html.rawhtml('<![CDATA[ ')} This is another really interesting description {html.rawhtml(']]>')} </rss.description> <rss.link>https://www.dropbox.com/nowhere</rss.link> <rss.pubDate date="{dt2}" /> <rss.guid is-perma-link="{False}">ABCDEFGHIJ</rss.guid> </rss.item> </rss.channel> </rss.rss> </frag> ) expected = """ <?xml version="1.0" encoding="UTF-8" standalone="yes" ?> <rss version="2.0"> <channel> <title>A Title</title> <link>https://www.dropbox.com</link> <description>A detailed description</description> <ttl>60</ttl> <language>en-us</language> <lastBuildDate>Tue, 17 Dec 2013 23:54:14 GMT</lastBuildDate> <item> <title>Item Title</title> <description><![CDATA[ This is a really interesting description ]]></description> <link>https://www.dropbox.com/somewhere</link> <pubDate>Tue, 17 Dec 2013 23:54:14 GMT</pubDate> <guid isPermaLink="false">123456789</guid> </item> <item> <title>Another Item</title> <description><![CDATA[ This is another really interesting description ]]></description> <link>https://www.dropbox.com/nowhere</link> <pubDate>Wed, 18 Dec 2013 11:54:14 GMT</pubDate> <guid isPermaLink="false">ABCDEFGHIJ</guid> </item> </channel> </rss> """ expected = ''.join(l.strip() for l in expected.splitlines()) self.assertEqual(doc.to_string(), expected) ''')
[ 11748, 28686, 198, 11748, 25064, 198, 198, 17597, 13, 6978, 13, 33295, 7, 418, 13, 6978, 13, 22179, 7, 418, 13, 6978, 13, 15908, 3672, 7, 834, 7753, 834, 828, 366, 40720, 9288, 14, 18908, 1358, 14, 9078, 87, 75, 30487, 4008, 198, 198, 6738, 12972, 87, 75, 13, 19815, 721, 13, 30238, 1330, 12972, 87, 75, 62, 35636, 62, 8841, 198, 198, 1640, 1312, 287, 2124, 9521, 7, 3064, 2599, 198, 220, 220, 220, 1303, 12972, 87, 75, 14, 41989, 14, 9288, 62, 361, 62, 16, 13, 9078, 198, 220, 220, 220, 12972, 87, 75, 62, 35636, 62, 8841, 7, 198, 7061, 6, 198, 6738, 12972, 87, 75, 1330, 27711, 198, 198, 4299, 1332, 33529, 198, 220, 220, 220, 6818, 965, 7, 27, 8310, 363, 6927, 361, 1779, 2625, 90, 17821, 92, 5320, 7942, 3556, 361, 6927, 17772, 29, 9562, 3556, 17772, 12240, 8310, 363, 43734, 6624, 366, 7942, 1, 198, 220, 220, 220, 6818, 965, 7, 27, 8310, 363, 6927, 361, 1779, 2625, 90, 25101, 92, 5320, 7942, 3556, 361, 6927, 17772, 29, 9562, 3556, 17772, 12240, 8310, 363, 43734, 6624, 366, 9562, 1, 198, 7061, 11537, 198, 198, 1640, 1312, 287, 2124, 9521, 7, 3064, 2599, 198, 220, 220, 220, 1303, 12972, 87, 75, 14, 41989, 14, 9288, 62, 66, 6371, 444, 62, 259, 62, 1078, 3808, 62, 16, 13, 9078, 198, 220, 220, 220, 12972, 87, 75, 62, 35636, 62, 8841, 7, 198, 7061, 6, 198, 6738, 12972, 87, 75, 1330, 27711, 198, 4299, 1332, 33529, 198, 220, 220, 220, 1303, 479, 1236, 272, 6834, 428, 815, 307, 1180, 198, 220, 220, 220, 6818, 965, 7, 27, 8310, 363, 6927, 9600, 12351, 2625, 90, 6, 21943, 6, 36786, 11037, 3556, 8310, 363, 43734, 6624, 37227, 27, 9600, 12351, 2625, 21943, 1, 11037, 37811, 198, 7061, 11537, 628, 198, 198, 1640, 1312, 287, 2124, 9521, 7, 3064, 2599, 198, 220, 220, 220, 1303, 12972, 87, 75, 14, 41989, 14, 9288, 62, 42216, 13, 9078, 198, 220, 220, 220, 12972, 87, 75, 62, 35636, 62, 8841, 7, 198, 7061, 6, 198, 11748, 4818, 8079, 198, 198, 6738, 220, 555, 715, 395, 17, 1330, 6208, 20448, 198, 6738, 12972, 87, 75, 1330, 27711, 198, 6738, 12972, 87, 75, 1330, 374, 824, 198, 198, 4871, 371, 824, 51, 3558, 7, 14402, 20448, 2599, 198, 220, 220, 220, 825, 1332, 62, 32446, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 2377, 796, 1279, 42216, 13, 42216, 62, 32446, 62, 1481, 17749, 11037, 13, 1462, 62, 8841, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 32446, 11, 334, 6, 47934, 19875, 2196, 2625, 16, 13, 15, 1, 21004, 2625, 48504, 12, 23, 1, 27669, 2625, 8505, 1, 5633, 29, 11537, 628, 220, 220, 220, 825, 1332, 62, 42216, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 374, 796, 1279, 42216, 13, 42216, 2196, 2625, 17, 13, 15, 1, 11037, 13, 1462, 62, 8841, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 81, 11, 334, 6, 27, 42216, 2196, 2625, 17, 13, 15, 23984, 42216, 29, 11537, 628, 220, 220, 220, 825, 1332, 62, 17620, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 269, 796, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 17620, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 42216, 29, 198, 220, 220, 220, 220, 220, 220, 220, 6739, 1462, 62, 8841, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 66, 11, 334, 6, 27, 42216, 2196, 2625, 17, 13, 15, 22039, 17620, 12240, 17620, 12240, 42216, 29, 11537, 628, 220, 220, 220, 825, 1332, 62, 17620, 62, 4480, 62, 35827, 62, 68, 3639, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 6518, 796, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 8310, 363, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 62, 32446, 62, 1481, 17749, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 7839, 29, 32, 11851, 3556, 42216, 13, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 3556, 42216, 13, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 11213, 29, 32, 6496, 6764, 3556, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 42216, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 8310, 363, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 37227, 198, 47934, 19875, 2196, 2625, 16, 13, 15, 1, 21004, 2625, 48504, 12, 23, 1, 27669, 2625, 8505, 1, 5633, 29, 198, 27, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 1279, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 7839, 29, 32, 11851, 3556, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 3556, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 11213, 29, 32, 6496, 6764, 3556, 11213, 29, 198, 220, 220, 220, 7359, 17620, 29, 198, 3556, 42216, 29, 198, 37811, 198, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 334, 35384, 22179, 7, 75, 13, 36311, 3419, 329, 300, 287, 2938, 13, 35312, 6615, 28955, 628, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 17620, 13, 1462, 62, 8841, 22784, 2938, 8, 628, 220, 220, 220, 825, 1332, 62, 17620, 62, 4480, 62, 25968, 62, 68, 3639, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 6518, 796, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 8310, 363, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 62, 32446, 62, 1481, 17749, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 7839, 29, 32, 11851, 3556, 42216, 13, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 3556, 42216, 13, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 11213, 29, 32, 6496, 6764, 3556, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 926, 75, 29, 1899, 3556, 42216, 13, 926, 75, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 16129, 29, 268, 12, 385, 3556, 42216, 13, 16129, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 42216, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 8310, 363, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 37227, 198, 47934, 19875, 2196, 2625, 16, 13, 15, 1, 21004, 2625, 48504, 12, 23, 1, 27669, 2625, 8505, 1, 5633, 29, 198, 27, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 1279, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 7839, 29, 32, 11851, 3556, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 3556, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 11213, 29, 32, 6496, 6764, 3556, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 926, 75, 29, 1899, 3556, 926, 75, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 16129, 29, 268, 12, 385, 3556, 16129, 29, 198, 220, 220, 220, 7359, 17620, 29, 198, 3556, 42216, 29, 198, 37811, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 334, 35384, 22179, 7, 75, 13, 36311, 3419, 329, 300, 287, 2938, 13, 35312, 6615, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 17620, 13, 1462, 62, 8841, 22784, 2938, 8, 628, 220, 220, 220, 825, 1332, 62, 9186, 62, 4480, 62, 11321, 62, 68, 3639, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 2378, 796, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 7839, 29, 7449, 11851, 3556, 42216, 13, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6494, 13, 1831, 6494, 10786, 27, 0, 58, 8610, 13563, 58, 705, 38165, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 770, 318, 257, 1107, 3499, 6764, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6494, 13, 1831, 6494, 10786, 11907, 29, 11537, 92, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 14, 82, 28030, 1456, 3556, 42216, 13, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 37227, 198, 27, 9186, 29, 198, 220, 220, 220, 1279, 7839, 29, 7449, 11851, 3556, 7839, 29, 198, 220, 220, 220, 1279, 11213, 6927, 0, 58, 8610, 13563, 58, 220, 770, 318, 257, 1107, 3499, 6764, 2361, 60, 12240, 11213, 29, 198, 220, 220, 220, 1279, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 14, 82, 28030, 1456, 3556, 8726, 29, 198, 3556, 9186, 29, 198, 37811, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 334, 35384, 22179, 7, 75, 13, 36311, 3419, 329, 300, 287, 2938, 13, 35312, 6615, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 9186, 13, 1462, 62, 8841, 22784, 2938, 8, 628, 220, 220, 220, 825, 1332, 62, 5162, 312, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 27, 42216, 13, 5162, 312, 29, 21943, 3556, 42216, 13, 5162, 312, 28401, 1462, 62, 8841, 22784, 334, 6, 27, 5162, 312, 29, 21943, 3556, 5162, 312, 29, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 27, 42216, 13, 5162, 312, 318, 12, 525, 2611, 12, 8726, 2625, 90, 25101, 92, 5320, 21943, 3556, 42216, 13, 5162, 312, 28401, 1462, 62, 8841, 22784, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 334, 6, 27, 5162, 312, 318, 5990, 2611, 11280, 2625, 9562, 5320, 21943, 3556, 5162, 312, 29, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 27, 42216, 13, 5162, 312, 318, 12, 525, 2611, 12, 8726, 2625, 90, 17821, 92, 5320, 21943, 3556, 42216, 13, 5162, 312, 28401, 1462, 62, 8841, 22784, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 334, 6, 27, 5162, 312, 318, 5990, 2611, 11280, 2625, 7942, 5320, 21943, 3556, 5162, 312, 29, 11537, 628, 220, 220, 220, 825, 1332, 62, 4475, 62, 68, 3639, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 288, 83, 796, 4818, 8079, 13, 19608, 8079, 7, 6390, 11, 1105, 11, 1596, 11, 2242, 11, 7175, 11, 1478, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 27, 42216, 13, 12984, 10430, 3128, 2625, 90, 28664, 36786, 11037, 13, 1462, 62, 8841, 22784, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 334, 6, 27, 12984, 10430, 29, 41392, 11, 1596, 4280, 2211, 2242, 25, 4051, 25, 1415, 16987, 3556, 12984, 10430, 29, 11537, 198, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 27, 42216, 13, 12957, 15580, 10430, 3128, 2625, 90, 28664, 36786, 11037, 13, 1462, 62, 8841, 22784, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 334, 6, 27, 12957, 15580, 10430, 29, 41392, 11, 1596, 4280, 2211, 2242, 25, 4051, 25, 1415, 16987, 3556, 12957, 15580, 10430, 29, 11537, 628, 220, 220, 220, 825, 1332, 62, 42216, 62, 22897, 7, 944, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 288, 83, 796, 4818, 8079, 13, 19608, 8079, 7, 6390, 11, 1105, 11, 1596, 11, 2242, 11, 7175, 11, 1478, 8, 198, 220, 220, 220, 220, 220, 220, 220, 288, 83, 17, 796, 4818, 8079, 13, 19608, 8079, 7, 6390, 11, 1105, 11, 1248, 11, 1367, 11, 7175, 11, 1478, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2205, 796, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 8310, 363, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 62, 32446, 62, 1481, 17749, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 7839, 29, 32, 11851, 3556, 42216, 13, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 3556, 42216, 13, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 11213, 29, 32, 6496, 6764, 3556, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 926, 75, 29, 1899, 3556, 42216, 13, 926, 75, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 16129, 29, 268, 12, 385, 3556, 42216, 13, 16129, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 12957, 15580, 10430, 3128, 2625, 90, 28664, 36786, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 7839, 29, 7449, 11851, 3556, 42216, 13, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6494, 13, 1831, 6494, 10786, 27, 0, 58, 8610, 13563, 58, 705, 38165, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 770, 318, 257, 1107, 3499, 6764, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6494, 13, 1831, 6494, 10786, 11907, 29, 11537, 92, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 14, 82, 28030, 1456, 3556, 42216, 13, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 12984, 10430, 3128, 2625, 90, 28664, 36786, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 5162, 312, 318, 12, 525, 2611, 12, 8726, 2625, 90, 25101, 92, 5320, 10163, 2231, 3134, 4531, 3556, 42216, 13, 5162, 312, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 7839, 29, 6610, 9097, 3556, 42216, 13, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6494, 13, 1831, 6494, 10786, 27, 0, 58, 8610, 13563, 58, 705, 38165, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 770, 318, 1194, 1107, 3499, 6764, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6494, 13, 1831, 6494, 10786, 11907, 29, 11537, 92, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 14, 2197, 1456, 3556, 42216, 13, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 12984, 10430, 3128, 2625, 90, 28664, 17, 36786, 11037, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 42216, 13, 5162, 312, 318, 12, 525, 2611, 12, 8726, 2625, 90, 25101, 92, 5320, 24694, 32988, 17511, 23852, 3556, 42216, 13, 5162, 312, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 42216, 13, 42216, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7359, 8310, 363, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 37227, 198, 47934, 19875, 2196, 2625, 16, 13, 15, 1, 21004, 2625, 48504, 12, 23, 1, 27669, 2625, 8505, 1, 5633, 29, 198, 27, 42216, 2196, 2625, 17, 13, 15, 5320, 198, 220, 220, 220, 1279, 17620, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 7839, 29, 32, 11851, 3556, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 3556, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 11213, 29, 32, 6496, 6764, 3556, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 926, 75, 29, 1899, 3556, 926, 75, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 16129, 29, 268, 12, 385, 3556, 16129, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 12957, 15580, 10430, 29, 41392, 11, 1596, 4280, 2211, 2242, 25, 4051, 25, 1415, 16987, 3556, 12957, 15580, 10430, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 7839, 29, 7449, 11851, 3556, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 11213, 6927, 0, 58, 8610, 13563, 58, 220, 770, 318, 257, 1107, 3499, 6764, 2361, 60, 12240, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 14, 82, 28030, 1456, 3556, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 12984, 10430, 29, 41392, 11, 1596, 4280, 2211, 2242, 25, 4051, 25, 1415, 16987, 3556, 12984, 10430, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 5162, 312, 318, 5990, 2611, 11280, 2625, 9562, 5320, 10163, 2231, 3134, 4531, 3556, 5162, 312, 29, 198, 220, 220, 220, 220, 220, 220, 220, 7359, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 1279, 9186, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 7839, 29, 6610, 9097, 3556, 7839, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 11213, 6927, 0, 58, 8610, 13563, 58, 220, 770, 318, 1194, 1107, 3499, 6764, 2361, 60, 12240, 11213, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 8726, 29, 5450, 1378, 2503, 13, 14781, 3524, 13, 785, 14, 2197, 1456, 3556, 8726, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 12984, 10430, 29, 19864, 11, 1248, 4280, 2211, 1367, 25, 4051, 25, 1415, 16987, 3556, 12984, 10430, 29, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1279, 5162, 312, 318, 5990, 2611, 11280, 2625, 9562, 5320, 24694, 32988, 17511, 23852, 3556, 5162, 312, 29, 198, 220, 220, 220, 220, 220, 220, 220, 7359, 9186, 29, 198, 220, 220, 220, 7359, 17620, 29, 198, 3556, 42216, 29, 198, 37811, 628, 220, 220, 220, 220, 220, 220, 220, 2938, 796, 705, 4458, 22179, 7, 75, 13, 36311, 3419, 329, 300, 287, 2938, 13, 35312, 6615, 28955, 628, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 30493, 36, 13255, 7, 15390, 13, 1462, 62, 8841, 22784, 2938, 8, 198, 7061, 11537, 198 ]
1.878815
4,423
from __future__ import unicode_literals from __future__ import print_function from __future__ import division from __future__ import absolute_import from future import standard_library from future.utils import with_metaclass standard_library.install_aliases() from abc import ABCMeta from abc import abstractmethod class Env(with_metaclass(ABCMeta, object)): """RL learning environment. This serves a minimal interface for RL agents. """ @abstractmethod @abstractmethod @abstractmethod
[ 6738, 11593, 37443, 834, 1330, 28000, 1098, 62, 17201, 874, 198, 6738, 11593, 37443, 834, 1330, 3601, 62, 8818, 198, 6738, 11593, 37443, 834, 1330, 7297, 198, 6738, 11593, 37443, 834, 1330, 4112, 62, 11748, 198, 6738, 2003, 1330, 3210, 62, 32016, 198, 6738, 2003, 13, 26791, 1330, 351, 62, 4164, 330, 31172, 198, 20307, 62, 32016, 13, 17350, 62, 7344, 1386, 3419, 198, 198, 6738, 450, 66, 1330, 9738, 48526, 198, 6738, 450, 66, 1330, 12531, 24396, 628, 198, 4871, 2039, 85, 7, 4480, 62, 4164, 330, 31172, 7, 24694, 48526, 11, 2134, 8, 2599, 198, 220, 220, 220, 37227, 7836, 4673, 2858, 13, 628, 220, 220, 220, 770, 9179, 257, 10926, 7071, 329, 45715, 6554, 13, 198, 220, 220, 220, 37227, 628, 220, 220, 220, 2488, 397, 8709, 24396, 628, 220, 220, 220, 2488, 397, 8709, 24396, 628, 220, 220, 220, 2488, 397, 8709, 24396, 198 ]
3.493243
148
#!/usr/bin/env python3 import os import sys import argparse import logging from typing import List, Optional, Union, Dict, Tuple from datetime import datetime, timedelta from sqlalchemy import create_engine import rx import rx.operators as ops from rx.subject import AsyncSubject, Subject, BehaviorSubject, ReplaySubject from rx.core.observable import Observable from typing import List, Optional, NoReturn from collections import defaultdict from dateutil.parser import parse import numpy as np import pandas as pd from ibapi import wrapper from ibapi.common import TickerId, BarData from ibapi.client import EClient from ibapi.contract import Contract from ibapi.utils import iswrapper ContractList = List[Contract] BarDataList = List[BarData] OptionalDate = Optional[datetime] def make_download_path(args: argparse.Namespace, contract: Contract) -> str: """Make path for saving csv files. Files to be stored in base_directory/<security_type>/<size>/<symbol>/ """ path = os.path.sep.join([ args.base_directory, args.security_type, args.size.replace(" ", "_"), contract.symbol, ]) return path if __name__ == "__main__": main() # download_bars.py --size "5 min" --start-date 20110804 --end-date 20110904 AAPL # download_bars.py --size "1 day" --duration "1 Y" --end-date 20210808 ABNB # stated @ 2021-08-04 23:35:45.267262 # end @ 2021-08-04 23:35:46.107792
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 18, 198, 198, 11748, 28686, 198, 11748, 25064, 198, 11748, 1822, 29572, 198, 11748, 18931, 198, 6738, 19720, 1330, 7343, 11, 32233, 11, 4479, 11, 360, 713, 11, 309, 29291, 198, 6738, 4818, 8079, 1330, 4818, 8079, 11, 28805, 12514, 198, 6738, 44161, 282, 26599, 1330, 2251, 62, 18392, 198, 198, 11748, 374, 87, 198, 11748, 374, 87, 13, 3575, 2024, 355, 39628, 198, 6738, 374, 87, 13, 32796, 1330, 1081, 13361, 19776, 11, 15540, 11, 20181, 19776, 11, 23635, 19776, 198, 6738, 374, 87, 13, 7295, 13, 672, 3168, 540, 1330, 19243, 540, 198, 198, 6738, 19720, 1330, 7343, 11, 32233, 11, 1400, 13615, 198, 6738, 17268, 1330, 4277, 11600, 198, 6738, 3128, 22602, 13, 48610, 1330, 21136, 198, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 19798, 292, 355, 279, 67, 198, 198, 6738, 24283, 15042, 1330, 29908, 198, 6738, 24283, 15042, 13, 11321, 1330, 309, 15799, 7390, 11, 2409, 6601, 198, 6738, 24283, 15042, 13, 16366, 1330, 412, 11792, 198, 6738, 24283, 15042, 13, 28484, 1330, 17453, 198, 6738, 24283, 15042, 13, 26791, 1330, 318, 48553, 198, 198, 45845, 8053, 796, 7343, 58, 45845, 60, 198, 10374, 6601, 8053, 796, 7343, 58, 10374, 6601, 60, 198, 30719, 10430, 796, 32233, 58, 19608, 8079, 60, 628, 198, 4299, 787, 62, 15002, 62, 6978, 7, 22046, 25, 1822, 29572, 13, 36690, 10223, 11, 2775, 25, 17453, 8, 4613, 965, 25, 198, 220, 220, 220, 37227, 12050, 3108, 329, 8914, 269, 21370, 3696, 13, 198, 220, 220, 220, 13283, 284, 307, 8574, 287, 2779, 62, 34945, 14, 27, 12961, 62, 4906, 29, 14, 27, 7857, 29, 14, 27, 1837, 23650, 29, 14, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 3108, 796, 28686, 13, 6978, 13, 325, 79, 13, 22179, 26933, 198, 220, 220, 220, 220, 220, 220, 220, 26498, 13, 8692, 62, 34945, 11, 198, 220, 220, 220, 220, 220, 220, 220, 26498, 13, 12961, 62, 4906, 11, 198, 220, 220, 220, 220, 220, 220, 220, 26498, 13, 7857, 13, 33491, 7203, 33172, 45434, 12340, 198, 220, 220, 220, 220, 220, 220, 220, 2775, 13, 1837, 23650, 11, 198, 220, 220, 220, 33761, 198, 220, 220, 220, 1441, 3108, 628, 628, 628, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 198, 220, 220, 220, 1388, 3419, 198, 198, 2, 4321, 62, 34046, 13, 9078, 1377, 7857, 366, 20, 949, 1, 1377, 9688, 12, 4475, 580, 24045, 19, 1377, 437, 12, 4475, 580, 14454, 3023, 31518, 43, 198, 2, 4321, 62, 34046, 13, 9078, 1377, 7857, 366, 16, 1110, 1, 1377, 32257, 366, 16, 575, 1, 1377, 437, 12, 4475, 1160, 21536, 28362, 9564, 32819, 198, 2, 5081, 2488, 33448, 12, 2919, 12, 3023, 2242, 25, 2327, 25, 2231, 13, 25674, 29119, 198, 2, 886, 2488, 33448, 12, 2919, 12, 3023, 2242, 25, 2327, 25, 3510, 13, 940, 3324, 5892 ]
2.970954
482
# Line Ghanem 27280076 # Anthony Iatropoulos 40028246 # Mikael Samvelian 40003178 import re # V = 0 # V = 1 # V = 2 # helper function
[ 2, 6910, 402, 7637, 368, 2681, 2078, 405, 4304, 198, 2, 9953, 314, 265, 1773, 19537, 7337, 2078, 26912, 198, 2, 17722, 3010, 3409, 626, 666, 30123, 18, 23188, 198, 198, 11748, 302, 628, 220, 220, 220, 1303, 569, 796, 657, 628, 220, 220, 220, 1303, 569, 796, 352, 628, 220, 220, 220, 1303, 569, 796, 362, 628, 220, 220, 220, 1303, 31904, 2163, 198 ]
2.384615
65
from time import time from threading import Lock class PaceMaker(object): ''' Implementation of https://en.wikipedia.org/wiki/Token_bucket#Algorithm Args: no_token_sleep_in_seconds: Seconds to nap when there are no tokens to spend. Defaults to 1. ''' @classmethod def set_rate_per_second(self, rate_per_second): ''' Sets the rate/sec Args: rate_per_second: rate/sec ''' with self.lock: self.rate_per_second = rate_per_second self.tokens = self.rate_per_second def consume(self, tokens=1): ''' Consumes the tokens and returns sleep time Args: tokens: Number of tokens to consume. Defaults to 1 ''' with self.lock: # if the rate_per_second is set to 0, throw exception if self.rate_per_second == 0: raise Exception('Cannot use the pace maker without setting the heart rate_per_second!!!') now = self._epoch_in_seconds() time_lapsed = now - self.last self.last = now # Add rate_per_second x seconds lapsed self.tokens += time_lapsed * self.rate_per_second # If the bucket is full, discard if self.tokens > self.rate_per_second: self.tokens = self.rate_per_second # subtract the number of tokens being consumed self.tokens -= tokens if self.tokens > 0: # Calculate the pace based on the tokens left return round(self.tokens/self.rate_per_second, 3) else: return self.no_token_sleep_in_seconds
[ 6738, 640, 1330, 640, 198, 6738, 4704, 278, 1330, 13656, 628, 198, 4871, 44111, 48890, 7, 15252, 2599, 198, 220, 220, 220, 705, 7061, 198, 220, 220, 220, 220, 220, 220, 220, 46333, 286, 3740, 1378, 268, 13, 31266, 13, 2398, 14, 15466, 14, 30642, 62, 27041, 316, 2, 2348, 42289, 628, 198, 220, 220, 220, 220, 220, 220, 220, 943, 14542, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 645, 62, 30001, 62, 42832, 62, 259, 62, 43012, 25, 40876, 284, 25422, 618, 612, 389, 645, 16326, 284, 4341, 13, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2896, 13185, 284, 352, 13, 198, 220, 220, 220, 705, 7061, 198, 220, 220, 220, 2488, 4871, 24396, 198, 220, 220, 220, 220, 220, 220, 220, 220, 198, 220, 220, 220, 825, 900, 62, 4873, 62, 525, 62, 12227, 7, 944, 11, 2494, 62, 525, 62, 12227, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 705, 7061, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 21394, 262, 2494, 14, 2363, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 943, 14542, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2494, 62, 525, 62, 12227, 25, 2494, 14, 2363, 198, 220, 220, 220, 220, 220, 220, 220, 705, 7061, 198, 220, 220, 220, 220, 220, 220, 220, 351, 2116, 13, 5354, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 4873, 62, 525, 62, 12227, 796, 2494, 62, 525, 62, 12227, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 83, 482, 641, 796, 2116, 13, 4873, 62, 525, 62, 12227, 628, 220, 220, 220, 825, 15000, 7, 944, 11, 16326, 28, 16, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 705, 7061, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3515, 8139, 262, 16326, 290, 5860, 3993, 640, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 943, 14542, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 16326, 25, 7913, 286, 16326, 284, 15000, 13, 2896, 13185, 284, 352, 198, 220, 220, 220, 220, 220, 220, 220, 705, 7061, 628, 220, 220, 220, 220, 220, 220, 220, 351, 2116, 13, 5354, 25, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 611, 262, 2494, 62, 525, 62, 12227, 318, 900, 284, 657, 11, 3714, 6631, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2116, 13, 4873, 62, 525, 62, 12227, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 5298, 35528, 10786, 34, 34574, 779, 262, 8761, 16009, 1231, 4634, 262, 2612, 2494, 62, 525, 62, 12227, 10185, 11537, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 783, 796, 2116, 13557, 538, 5374, 62, 259, 62, 43012, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 640, 62, 75, 28361, 796, 783, 532, 2116, 13, 12957, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 12957, 796, 783, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 2494, 62, 525, 62, 12227, 2124, 4201, 24590, 276, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 83, 482, 641, 15853, 640, 62, 75, 28361, 1635, 2116, 13, 4873, 62, 525, 62, 12227, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 262, 19236, 318, 1336, 11, 27537, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2116, 13, 83, 482, 641, 1875, 2116, 13, 4873, 62, 525, 62, 12227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 83, 482, 641, 796, 2116, 13, 4873, 62, 525, 62, 12227, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 34128, 262, 1271, 286, 16326, 852, 13529, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2116, 13, 83, 482, 641, 48185, 16326, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2116, 13, 83, 482, 641, 1875, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 27131, 378, 262, 8761, 1912, 319, 262, 16326, 1364, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 2835, 7, 944, 13, 83, 482, 641, 14, 944, 13, 4873, 62, 525, 62, 12227, 11, 513, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 2116, 13, 3919, 62, 30001, 62, 42832, 62, 259, 62, 43012, 628 ]
2.038813
876
#!/usr/bin/env python # -*- coding: utf-8 -*- import warnings import pandas as pd import pytest from covsirphy import PolicyMeasures from covsirphy import SIRF, Scenario # Skip this test at this time
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 198, 11748, 14601, 198, 11748, 19798, 292, 355, 279, 67, 198, 11748, 12972, 9288, 198, 6738, 39849, 82, 343, 6883, 1330, 7820, 5308, 13846, 198, 6738, 39849, 82, 343, 6883, 1330, 311, 4663, 37, 11, 1446, 39055, 628, 220, 220, 220, 1303, 32214, 428, 1332, 379, 428, 640, 198 ]
2.861111
72
from django.contrib import admin from .models import Animal, Raca, NomeCientifico, Origem, NomePopular admin.site.register(Animal) admin.site.register(Raca) admin.site.register(Origem) admin.site.register(NomeCientifico) admin.site.register(NomePopular)
[ 6738, 42625, 14208, 13, 3642, 822, 1330, 13169, 201, 198, 6738, 764, 27530, 1330, 13792, 11, 371, 22260, 11, 399, 462, 34, 1153, 811, 78, 11, 6913, 368, 11, 399, 462, 16979, 934, 201, 198, 201, 198, 28482, 13, 15654, 13, 30238, 7, 40002, 8, 201, 198, 28482, 13, 15654, 13, 30238, 7, 49, 22260, 8, 201, 198, 28482, 13, 15654, 13, 30238, 7, 11610, 368, 8, 201, 198, 28482, 13, 15654, 13, 30238, 7, 45, 462, 34, 1153, 811, 78, 8, 201, 198, 28482, 13, 15654, 13, 30238, 7, 45, 462, 16979, 934, 8, 201, 198 ]
2.71134
97
password="pbkdf2(1000,20,sha512)$a4e3c0f67fc691f5$70638e315cc3ad9d7aed2f01edba2f36a5cbe486"
[ 28712, 2625, 40842, 74, 7568, 17, 7, 12825, 11, 1238, 11, 26270, 25836, 8, 3, 64, 19, 68, 18, 66, 15, 69, 3134, 16072, 49541, 69, 20, 3, 35402, 2548, 68, 27936, 535, 18, 324, 24, 67, 22, 8432, 17, 69, 486, 276, 7012, 17, 69, 2623, 64, 20, 66, 1350, 34251, 1, 198 ]
1.703704
54
# # PySNMP MIB module Wellfleet-GRE-MIB (http://snmplabs.com/pysmi) # ASN.1 source file:///Users/davwang4/Dev/mibs.snmplabs.com/asn1/Wellfleet-GRE-MIB # Produced by pysmi-0.3.4 at Wed May 1 15:40:19 2019 # On host DAVWANG4-M-1475 platform Darwin version 18.5.0 by user davwang4 # Using Python version 3.7.3 (default, Mar 27 2019, 09:23:15) # OctetString, Integer, ObjectIdentifier = mibBuilder.importSymbols("ASN1", "OctetString", "Integer", "ObjectIdentifier") NamedValues, = mibBuilder.importSymbols("ASN1-ENUMERATION", "NamedValues") SingleValueConstraint, ValueRangeConstraint, ConstraintsIntersection, ConstraintsUnion, ValueSizeConstraint = mibBuilder.importSymbols("ASN1-REFINEMENT", "SingleValueConstraint", "ValueRangeConstraint", "ConstraintsIntersection", "ConstraintsUnion", "ValueSizeConstraint") NotificationGroup, ModuleCompliance = mibBuilder.importSymbols("SNMPv2-CONF", "NotificationGroup", "ModuleCompliance") TimeTicks, Unsigned32, Bits, IpAddress, ObjectIdentity, Counter32, iso, NotificationType, Gauge32, Counter64, MibIdentifier, ModuleIdentity, Integer32, MibScalar, MibTable, MibTableRow, MibTableColumn = mibBuilder.importSymbols("SNMPv2-SMI", "TimeTicks", "Unsigned32", "Bits", "IpAddress", "ObjectIdentity", "Counter32", "iso", "NotificationType", "Gauge32", "Counter64", "MibIdentifier", "ModuleIdentity", "Integer32", "MibScalar", "MibTable", "MibTableRow", "MibTableColumn") TextualConvention, DisplayString = mibBuilder.importSymbols("SNMPv2-TC", "TextualConvention", "DisplayString") wfGreGroup, = mibBuilder.importSymbols("Wellfleet-COMMON-MIB", "wfGreGroup") wfGreInterfaceTable = MibTable((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1), ) if mibBuilder.loadTexts: wfGreInterfaceTable.setStatus('mandatory') if mibBuilder.loadTexts: wfGreInterfaceTable.setDescription('Parameters in wfGreInterfaceTable') wfGreInterfaceEntry = MibTableRow((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1), ).setIndexNames((0, "Wellfleet-GRE-MIB", "wfGreIntfIpAddr"), (0, "Wellfleet-GRE-MIB", "wfGreIntfCct")) if mibBuilder.loadTexts: wfGreInterfaceEntry.setStatus('mandatory') if mibBuilder.loadTexts: wfGreInterfaceEntry.setDescription('An entry in wfGreTable.') wfGreIntfCreate = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 1), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1, 2))).clone(namedValues=NamedValues(("create", 1), ("delete", 2))).clone('create')).setMaxAccess("readwrite") if mibBuilder.loadTexts: wfGreIntfCreate.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfCreate.setDescription('Create/Delete parameter. Default is created. Users perform a set operation on this object in order to create/delete an wfGreEntry instance.') wfGreIntfEnable = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 2), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1, 2))).clone(namedValues=NamedValues(("enabled", 1), ("disabled", 2))).clone('enabled')).setMaxAccess("readwrite") if mibBuilder.loadTexts: wfGreIntfEnable.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfEnable.setDescription('Enable/Disable parameter. Default is enabled. Users perform a set operation on this object in order to enable/disable GRE .') wfGreIntfState = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 3), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1, 2, 3, 4))).clone(namedValues=NamedValues(("up", 1), ("down", 2), ("init", 3), ("notpres", 4))).clone('notpres')).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreIntfState.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfState.setDescription('The current state of GRE interface.') wfGreIntfIpAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 4), IpAddress()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreIntfIpAddr.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfIpAddr.setDescription('The IP interface to run GRE on.') wfGreIntfCct = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 5), Integer32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreIntfCct.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfCct.setDescription('Circuit number of the GRE interface') wfGreIntfStatsEnable = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 6), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1, 2))).clone(namedValues=NamedValues(("enabled", 1), ("disabled", 2))).clone('enabled')).setMaxAccess("readwrite") if mibBuilder.loadTexts: wfGreIntfStatsEnable.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfStatsEnable.setDescription('Enable/Disable parameter. Default is enabled. Users perform a set operation on this object in order to enable/disable mib statistics for GRE interface.') wfGreIntfDebugLevel = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 1, 1, 7), Integer32()).setMaxAccess("readwrite") if mibBuilder.loadTexts: wfGreIntfDebugLevel.setStatus('mandatory') if mibBuilder.loadTexts: wfGreIntfDebugLevel.setDescription('A parameter to specify which messages to be printed in to the log.') wfGreTunnelTable = MibTable((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2), ) if mibBuilder.loadTexts: wfGreTunnelTable.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelTable.setDescription('Parameters in wfGreTunnelTable') wfGreTunnelEntry = MibTableRow((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1), ).setIndexNames((0, "Wellfleet-GRE-MIB", "wfGreTunnelLocalAddr"), (0, "Wellfleet-GRE-MIB", "wfGreTunnelPeerAddress"), (0, "Wellfleet-GRE-MIB", "wfGreTunnelLocalIndex")) if mibBuilder.loadTexts: wfGreTunnelEntry.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelEntry.setDescription('An entry in wfGreTunnelTable.') wfGreTunnelLocalAddr = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 1), IpAddress()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelLocalAddr.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelLocalAddr.setDescription('IP Address of local interface.') wfGreTunnelLocalIndex = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 2), Integer32().subtype(subtypeSpec=ValueRangeConstraint(0, 65535))).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelLocalIndex.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelLocalIndex.setDescription('This tunnel index is assigned by the GRE process. It is used to index into the GRE mapping table.') wfGreTunnelType = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 3), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1, 2))).clone(namedValues=NamedValues(("generic", 1), ("udas", 2)))).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelType.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelType.setDescription('Indicate whether a tunnel peer has assigned a tunnel ID.') wfGreTunnelId = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 4), Integer32().subtype(subtypeSpec=ValueRangeConstraint(0, 65535))).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelId.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelId.setDescription('This tunnel ID is assigned by the tunnel peer.') wfGreTunnelPeerAddress = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 5), IpAddress()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelPeerAddress.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelPeerAddress.setDescription('Address of the tunnel peer.') wfGreRemotePayloadAddress = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 6), OctetString().subtype(subtypeSpec=ValueSizeConstraint(10, 10)).setFixedLength(10)).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreRemotePayloadAddress.setStatus('deprecated') if mibBuilder.loadTexts: wfGreRemotePayloadAddress.setDescription('The address of the remote node.') wfGreTunnelState = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 7), Integer32().subtype(subtypeSpec=ConstraintsUnion(SingleValueConstraint(1, 2))).clone(namedValues=NamedValues(("up", 1), ("down", 2)))).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelState.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelState.setDescription('The state of the GRE tunnel.') wfGreVersion = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 8), Integer32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreVersion.setStatus('mandatory') if mibBuilder.loadTexts: wfGreVersion.setDescription('Reserved for future use') wfGreProtoMap = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 9), OctetString()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreProtoMap.setStatus('mandatory') if mibBuilder.loadTexts: wfGreProtoMap.setDescription('This will be set to the protocol type of the payload. GRE_PROTO_IP 1 GRE_PROTO_IPX 2') wfGreTunnelPktsTx = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 10), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelPktsTx.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelPktsTx.setDescription('Number of packets transmitted ') wfGreTunnelPktsRx = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 11), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelPktsRx.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelPktsRx.setDescription('Number of packets received ') wfGreTunnelBytesTx = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 12), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelBytesTx.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelBytesTx.setDescription('Number of bytes transmitted ') wfGreTunnelBytesRx = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 13), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelBytesRx.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelBytesRx.setDescription('Number of bytes received') wfGreTunnelPktsTxDropped = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 14), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelPktsTxDropped.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelPktsTxDropped.setDescription('Number of outgoing packets dropped') wfGreTunnelPktsRxDropped = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 15), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelPktsRxDropped.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelPktsRxDropped.setDescription('Number of incoming packets dropped') wfGreTunnelXsumErr = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 16), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelXsumErr.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelXsumErr.setDescription('Number of inbound checksum errors') wfGreTunnelSeqNumErr = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 17), Counter32()).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelSeqNumErr.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelSeqNumErr.setDescription('Number of sequence errors') wfGreTunnelMtu = MibTableColumn((1, 3, 6, 1, 4, 1, 18, 3, 5, 3, 20, 2, 1, 18), Integer32().subtype(subtypeSpec=ValueRangeConstraint(0, 4500))).setMaxAccess("readonly") if mibBuilder.loadTexts: wfGreTunnelMtu.setStatus('mandatory') if mibBuilder.loadTexts: wfGreTunnelMtu.setDescription('The MTU of the GRE tunnel') mibBuilder.exportSymbols("Wellfleet-GRE-MIB", wfGreTunnelPktsTxDropped=wfGreTunnelPktsTxDropped, wfGreTunnelLocalIndex=wfGreTunnelLocalIndex, wfGreTunnelEntry=wfGreTunnelEntry, wfGreTunnelState=wfGreTunnelState, wfGreTunnelType=wfGreTunnelType, wfGreTunnelBytesRx=wfGreTunnelBytesRx, wfGreTunnelPktsRxDropped=wfGreTunnelPktsRxDropped, wfGreIntfCreate=wfGreIntfCreate, wfGreIntfState=wfGreIntfState, wfGreIntfIpAddr=wfGreIntfIpAddr, wfGreTunnelPeerAddress=wfGreTunnelPeerAddress, wfGreTunnelLocalAddr=wfGreTunnelLocalAddr, wfGreIntfEnable=wfGreIntfEnable, wfGreRemotePayloadAddress=wfGreRemotePayloadAddress, wfGreIntfStatsEnable=wfGreIntfStatsEnable, wfGreTunnelBytesTx=wfGreTunnelBytesTx, wfGreProtoMap=wfGreProtoMap, wfGreTunnelXsumErr=wfGreTunnelXsumErr, wfGreTunnelId=wfGreTunnelId, wfGreTunnelTable=wfGreTunnelTable, wfGreInterfaceTable=wfGreInterfaceTable, wfGreVersion=wfGreVersion, wfGreTunnelPktsTx=wfGreTunnelPktsTx, wfGreInterfaceEntry=wfGreInterfaceEntry, wfGreIntfDebugLevel=wfGreIntfDebugLevel, wfGreTunnelPktsRx=wfGreTunnelPktsRx, wfGreIntfCct=wfGreIntfCct, wfGreTunnelMtu=wfGreTunnelMtu, wfGreTunnelSeqNumErr=wfGreTunnelSeqNumErr)
[ 2, 198, 2, 9485, 15571, 7378, 337, 9865, 8265, 3894, 33559, 12, 28934, 12, 8895, 33, 357, 4023, 1378, 16184, 76, 489, 8937, 13, 785, 14, 79, 893, 11632, 8, 198, 2, 7054, 45, 13, 16, 2723, 2393, 1378, 14, 14490, 14, 67, 615, 47562, 19, 14, 13603, 14, 76, 571, 82, 13, 16184, 76, 489, 8937, 13, 785, 14, 292, 77, 16, 14, 5779, 33559, 12, 28934, 12, 8895, 33, 198, 2, 21522, 771, 416, 279, 893, 11632, 12, 15, 13, 18, 13, 19, 379, 3300, 1737, 220, 352, 1315, 25, 1821, 25, 1129, 13130, 198, 2, 1550, 2583, 42274, 54, 15567, 19, 12, 44, 12, 1415, 2425, 3859, 21450, 2196, 1248, 13, 20, 13, 15, 416, 2836, 288, 615, 47562, 19, 198, 2, 8554, 11361, 2196, 513, 13, 22, 13, 18, 357, 12286, 11, 1526, 2681, 13130, 11, 7769, 25, 1954, 25, 1314, 8, 220, 198, 2, 198, 12349, 316, 10100, 11, 34142, 11, 9515, 33234, 7483, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 1921, 45, 16, 1600, 366, 12349, 316, 10100, 1600, 366, 46541, 1600, 366, 10267, 33234, 7483, 4943, 198, 45, 2434, 40161, 11, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 1921, 45, 16, 12, 1677, 5883, 1137, 6234, 1600, 366, 45, 2434, 40161, 4943, 198, 28008, 11395, 3103, 2536, 2913, 11, 11052, 17257, 3103, 2536, 2913, 11, 1482, 2536, 6003, 9492, 5458, 11, 1482, 2536, 6003, 38176, 11, 11052, 10699, 3103, 2536, 2913, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 1921, 45, 16, 12, 2200, 20032, 12529, 1600, 366, 28008, 11395, 3103, 2536, 2913, 1600, 366, 11395, 17257, 3103, 2536, 2913, 1600, 366, 3103, 2536, 6003, 9492, 5458, 1600, 366, 3103, 2536, 6003, 38176, 1600, 366, 11395, 10699, 3103, 2536, 2913, 4943, 198, 3673, 2649, 13247, 11, 19937, 38143, 3610, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 15571, 7378, 85, 17, 12, 10943, 37, 1600, 366, 3673, 2649, 13247, 1600, 366, 26796, 38143, 3610, 4943, 198, 7575, 51, 3378, 11, 791, 32696, 2624, 11, 44733, 11, 314, 79, 20231, 11, 9515, 7390, 26858, 11, 15034, 2624, 11, 47279, 11, 42808, 6030, 11, 35094, 469, 2624, 11, 15034, 2414, 11, 337, 571, 33234, 7483, 11, 19937, 7390, 26858, 11, 34142, 2624, 11, 337, 571, 3351, 282, 283, 11, 337, 571, 10962, 11, 337, 571, 10962, 25166, 11, 337, 571, 10962, 39470, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 15571, 7378, 85, 17, 12, 50, 8895, 1600, 366, 7575, 51, 3378, 1600, 366, 3118, 32696, 2624, 1600, 366, 33, 896, 1600, 366, 40, 79, 20231, 1600, 366, 10267, 7390, 26858, 1600, 366, 31694, 2624, 1600, 366, 26786, 1600, 366, 3673, 2649, 6030, 1600, 366, 38, 559, 469, 2624, 1600, 366, 31694, 2414, 1600, 366, 44, 571, 33234, 7483, 1600, 366, 26796, 7390, 26858, 1600, 366, 46541, 2624, 1600, 366, 44, 571, 3351, 282, 283, 1600, 366, 44, 571, 10962, 1600, 366, 44, 571, 10962, 25166, 1600, 366, 44, 571, 10962, 39470, 4943, 198, 8206, 723, 3103, 4018, 11, 16531, 10100, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 15571, 7378, 85, 17, 12, 4825, 1600, 366, 8206, 723, 3103, 4018, 1600, 366, 23114, 10100, 4943, 198, 86, 69, 43887, 13247, 11, 796, 285, 571, 32875, 13, 11748, 13940, 2022, 10220, 7203, 5779, 33559, 12, 9858, 27857, 12, 8895, 33, 1600, 366, 86, 69, 43887, 13247, 4943, 198, 86, 69, 43887, 39317, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 39317, 10962, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 39317, 10962, 13, 2617, 11828, 10786, 48944, 287, 266, 69, 43887, 39317, 10962, 11537, 198, 86, 69, 43887, 39317, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 5779, 33559, 12, 28934, 12, 8895, 33, 1600, 366, 86, 69, 43887, 5317, 69, 40, 79, 4550, 81, 12340, 357, 15, 11, 366, 5779, 33559, 12, 28934, 12, 8895, 33, 1600, 366, 86, 69, 43887, 5317, 69, 34, 310, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 39317, 30150, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 39317, 30150, 13, 2617, 11828, 10786, 2025, 5726, 287, 266, 69, 43887, 10962, 2637, 8, 198, 86, 69, 43887, 5317, 69, 16447, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 352, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 16, 11, 362, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 17953, 1600, 352, 828, 5855, 33678, 1600, 362, 4008, 737, 21018, 10786, 17953, 11537, 737, 2617, 11518, 15457, 7203, 961, 13564, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 16447, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 16447, 13, 2617, 11828, 10786, 16447, 14, 38727, 11507, 13, 15161, 318, 2727, 13, 18987, 1620, 257, 900, 4905, 319, 428, 2134, 287, 1502, 284, 2251, 14, 33678, 281, 266, 69, 43887, 30150, 4554, 2637, 8, 198, 86, 69, 43887, 5317, 69, 36695, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 362, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 16, 11, 362, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 25616, 1600, 352, 828, 5855, 47730, 1600, 362, 4008, 737, 21018, 10786, 25616, 11537, 737, 2617, 11518, 15457, 7203, 961, 13564, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 36695, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 36695, 13, 2617, 11828, 10786, 36695, 14, 48893, 11507, 13, 15161, 318, 9343, 13, 18987, 1620, 257, 900, 4905, 319, 428, 2134, 287, 1502, 284, 7139, 14, 40223, 19928, 764, 11537, 198, 86, 69, 43887, 5317, 69, 9012, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 513, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 16, 11, 362, 11, 513, 11, 604, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 929, 1600, 352, 828, 5855, 2902, 1600, 362, 828, 5855, 15003, 1600, 513, 828, 5855, 1662, 18302, 1600, 604, 4008, 737, 21018, 10786, 1662, 18302, 11537, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 9012, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 9012, 13, 2617, 11828, 10786, 464, 1459, 1181, 286, 19928, 7071, 2637, 8, 198, 86, 69, 43887, 5317, 69, 40, 79, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 604, 828, 314, 79, 20231, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 40, 79, 4550, 81, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 40, 79, 4550, 81, 13, 2617, 11828, 10786, 464, 6101, 7071, 284, 1057, 19928, 319, 2637, 8, 198, 86, 69, 43887, 5317, 69, 34, 310, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 642, 828, 34142, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 34, 310, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 34, 310, 13, 2617, 11828, 10786, 31560, 5013, 1271, 286, 262, 19928, 7071, 11537, 198, 86, 69, 43887, 5317, 69, 29668, 36695, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 718, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 16, 11, 362, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 25616, 1600, 352, 828, 5855, 47730, 1600, 362, 4008, 737, 21018, 10786, 25616, 11537, 737, 2617, 11518, 15457, 7203, 961, 13564, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 29668, 36695, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 29668, 36695, 13, 2617, 11828, 10786, 36695, 14, 48893, 11507, 13, 15161, 318, 9343, 13, 18987, 1620, 257, 900, 4905, 319, 428, 2134, 287, 1502, 284, 7139, 14, 40223, 285, 571, 7869, 329, 19928, 7071, 2637, 8, 198, 86, 69, 43887, 5317, 69, 27509, 4971, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 352, 11, 352, 11, 767, 828, 34142, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 13564, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 27509, 4971, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 5317, 69, 27509, 4971, 13, 2617, 11828, 10786, 32, 11507, 284, 11986, 543, 6218, 284, 307, 10398, 287, 284, 262, 2604, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 10962, 796, 337, 571, 10962, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 828, 1267, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 10962, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 10962, 13, 2617, 11828, 10786, 48944, 287, 266, 69, 43887, 51, 403, 4954, 10962, 11537, 198, 86, 69, 43887, 51, 403, 4954, 30150, 796, 337, 571, 10962, 25166, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 828, 6739, 2617, 15732, 36690, 19510, 15, 11, 366, 5779, 33559, 12, 28934, 12, 8895, 33, 1600, 366, 86, 69, 43887, 51, 403, 4954, 14565, 4550, 81, 12340, 357, 15, 11, 366, 5779, 33559, 12, 28934, 12, 8895, 33, 1600, 366, 86, 69, 43887, 51, 403, 4954, 6435, 263, 20231, 12340, 357, 15, 11, 366, 5779, 33559, 12, 28934, 12, 8895, 33, 1600, 366, 86, 69, 43887, 51, 403, 4954, 14565, 15732, 48774, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 30150, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 30150, 13, 2617, 11828, 10786, 2025, 5726, 287, 266, 69, 43887, 51, 403, 4954, 10962, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 14565, 4550, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 352, 828, 314, 79, 20231, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 14565, 4550, 81, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 14565, 4550, 81, 13, 2617, 11828, 10786, 4061, 17917, 286, 1957, 7071, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 14565, 15732, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 362, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 15, 11, 45021, 2327, 4008, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 14565, 15732, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 14565, 15732, 13, 2617, 11828, 10786, 1212, 13275, 6376, 318, 8686, 416, 262, 19928, 1429, 13, 632, 318, 973, 284, 6376, 656, 262, 19928, 16855, 3084, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 6030, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 513, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 16, 11, 362, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 41357, 1600, 352, 828, 5855, 463, 292, 1600, 362, 22305, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 6030, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 6030, 13, 2617, 11828, 10786, 5497, 5344, 1771, 257, 13275, 12720, 468, 8686, 257, 13275, 4522, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 7390, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 604, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 15, 11, 45021, 2327, 4008, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 7390, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 7390, 13, 2617, 11828, 10786, 1212, 13275, 4522, 318, 8686, 416, 262, 13275, 12720, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 6435, 263, 20231, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 642, 828, 314, 79, 20231, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 6435, 263, 20231, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 6435, 263, 20231, 13, 2617, 11828, 10786, 20231, 286, 262, 13275, 12720, 2637, 8, 198, 86, 69, 43887, 36510, 19197, 2220, 20231, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 718, 828, 2556, 316, 10100, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 10699, 3103, 2536, 2913, 7, 940, 11, 838, 29720, 2617, 13715, 24539, 7, 940, 29720, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 36510, 19197, 2220, 20231, 13, 2617, 19580, 10786, 10378, 31023, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 36510, 19197, 2220, 20231, 13, 2617, 11828, 10786, 464, 2209, 286, 262, 6569, 10139, 2637, 8, 198, 86, 69, 43887, 51, 403, 4954, 9012, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 767, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 3103, 2536, 6003, 38176, 7, 28008, 11395, 3103, 2536, 2913, 7, 16, 11, 362, 4008, 737, 21018, 7, 13190, 40161, 28, 45, 2434, 40161, 7, 7203, 929, 1600, 352, 828, 5855, 2902, 1600, 362, 22305, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 9012, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 9012, 13, 2617, 11828, 10786, 464, 1181, 286, 262, 19928, 13275, 2637, 8, 198, 86, 69, 43887, 14815, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 807, 828, 34142, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 14815, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 14815, 13, 2617, 11828, 10786, 4965, 8520, 329, 2003, 779, 11537, 198, 86, 69, 43887, 2964, 1462, 13912, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 860, 828, 2556, 316, 10100, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 2964, 1462, 13912, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 2964, 1462, 13912, 13, 2617, 11828, 10786, 1212, 481, 307, 900, 284, 262, 8435, 2099, 286, 262, 21437, 13, 19928, 62, 4805, 26631, 62, 4061, 352, 19928, 62, 4805, 26631, 62, 4061, 55, 362, 11537, 198, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 838, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 13, 2617, 11828, 10786, 15057, 286, 24624, 18307, 705, 8, 198, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1367, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 13, 2617, 11828, 10786, 15057, 286, 24624, 2722, 705, 8, 198, 86, 69, 43887, 51, 403, 4954, 45992, 46047, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1105, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 45992, 46047, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 45992, 46047, 13, 2617, 11828, 10786, 15057, 286, 9881, 18307, 705, 8, 198, 86, 69, 43887, 51, 403, 4954, 45992, 49, 87, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1511, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 45992, 49, 87, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 45992, 49, 87, 13, 2617, 11828, 10786, 15057, 286, 9881, 2722, 11537, 198, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 35442, 1496, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1478, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 35442, 1496, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 35442, 1496, 13, 2617, 11828, 10786, 15057, 286, 28181, 24624, 5710, 11537, 198, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 35442, 1496, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1315, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 35442, 1496, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 35442, 1496, 13, 2617, 11828, 10786, 15057, 286, 15619, 24624, 5710, 11537, 198, 86, 69, 43887, 51, 403, 4954, 55, 16345, 9139, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1467, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 55, 16345, 9139, 81, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 55, 16345, 9139, 81, 13, 2617, 11828, 10786, 15057, 286, 287, 7784, 8794, 388, 8563, 11537, 198, 86, 69, 43887, 51, 403, 4954, 4653, 80, 33111, 9139, 81, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1596, 828, 15034, 2624, 3419, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 4653, 80, 33111, 9139, 81, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 4653, 80, 33111, 9139, 81, 13, 2617, 11828, 10786, 15057, 286, 8379, 8563, 11537, 198, 86, 69, 43887, 51, 403, 4954, 44, 28047, 796, 337, 571, 10962, 39470, 19510, 16, 11, 513, 11, 718, 11, 352, 11, 604, 11, 352, 11, 1248, 11, 513, 11, 642, 11, 513, 11, 1160, 11, 362, 11, 352, 11, 1248, 828, 34142, 2624, 22446, 7266, 4906, 7, 7266, 4906, 22882, 28, 11395, 17257, 3103, 2536, 2913, 7, 15, 11, 604, 4059, 4008, 737, 2617, 11518, 15457, 7203, 961, 8807, 4943, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 44, 28047, 13, 2617, 19580, 10786, 22249, 2870, 11537, 198, 361, 285, 571, 32875, 13, 2220, 8206, 82, 25, 266, 69, 43887, 51, 403, 4954, 44, 28047, 13, 2617, 11828, 10786, 464, 19308, 52, 286, 262, 19928, 13275, 11537, 198, 76, 571, 32875, 13, 39344, 13940, 2022, 10220, 7203, 5779, 33559, 12, 28934, 12, 8895, 33, 1600, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 35442, 1496, 28, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 35442, 1496, 11, 266, 69, 43887, 51, 403, 4954, 14565, 15732, 28, 86, 69, 43887, 51, 403, 4954, 14565, 15732, 11, 266, 69, 43887, 51, 403, 4954, 30150, 28, 86, 69, 43887, 51, 403, 4954, 30150, 11, 266, 69, 43887, 51, 403, 4954, 9012, 28, 86, 69, 43887, 51, 403, 4954, 9012, 11, 266, 69, 43887, 51, 403, 4954, 6030, 28, 86, 69, 43887, 51, 403, 4954, 6030, 11, 266, 69, 43887, 51, 403, 4954, 45992, 49, 87, 28, 86, 69, 43887, 51, 403, 4954, 45992, 49, 87, 11, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 35442, 1496, 28, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 35442, 1496, 11, 266, 69, 43887, 5317, 69, 16447, 28, 86, 69, 43887, 5317, 69, 16447, 11, 266, 69, 43887, 5317, 69, 9012, 28, 86, 69, 43887, 5317, 69, 9012, 11, 266, 69, 43887, 5317, 69, 40, 79, 4550, 81, 28, 86, 69, 43887, 5317, 69, 40, 79, 4550, 81, 11, 266, 69, 43887, 51, 403, 4954, 6435, 263, 20231, 28, 86, 69, 43887, 51, 403, 4954, 6435, 263, 20231, 11, 266, 69, 43887, 51, 403, 4954, 14565, 4550, 81, 28, 86, 69, 43887, 51, 403, 4954, 14565, 4550, 81, 11, 266, 69, 43887, 5317, 69, 36695, 28, 86, 69, 43887, 5317, 69, 36695, 11, 266, 69, 43887, 36510, 19197, 2220, 20231, 28, 86, 69, 43887, 36510, 19197, 2220, 20231, 11, 266, 69, 43887, 5317, 69, 29668, 36695, 28, 86, 69, 43887, 5317, 69, 29668, 36695, 11, 266, 69, 43887, 51, 403, 4954, 45992, 46047, 28, 86, 69, 43887, 51, 403, 4954, 45992, 46047, 11, 266, 69, 43887, 2964, 1462, 13912, 28, 86, 69, 43887, 2964, 1462, 13912, 11, 266, 69, 43887, 51, 403, 4954, 55, 16345, 9139, 81, 28, 86, 69, 43887, 51, 403, 4954, 55, 16345, 9139, 81, 11, 266, 69, 43887, 51, 403, 4954, 7390, 28, 86, 69, 43887, 51, 403, 4954, 7390, 11, 266, 69, 43887, 51, 403, 4954, 10962, 28, 86, 69, 43887, 51, 403, 4954, 10962, 11, 266, 69, 43887, 39317, 10962, 28, 86, 69, 43887, 39317, 10962, 11, 266, 69, 43887, 14815, 28, 86, 69, 43887, 14815, 11, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 28, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 46047, 11, 266, 69, 43887, 39317, 30150, 28, 86, 69, 43887, 39317, 30150, 11, 266, 69, 43887, 5317, 69, 27509, 4971, 28, 86, 69, 43887, 5317, 69, 27509, 4971, 11, 266, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 28, 86, 69, 43887, 51, 403, 4954, 47, 74, 912, 49, 87, 11, 266, 69, 43887, 5317, 69, 34, 310, 28, 86, 69, 43887, 5317, 69, 34, 310, 11, 266, 69, 43887, 51, 403, 4954, 44, 28047, 28, 86, 69, 43887, 51, 403, 4954, 44, 28047, 11, 266, 69, 43887, 51, 403, 4954, 4653, 80, 33111, 9139, 81, 28, 86, 69, 43887, 51, 403, 4954, 4653, 80, 33111, 9139, 81, 8, 198 ]
2.617186
4,783
nFeatures = { "EE": 182, #22, "SD": 126, #24, "SR": 330, #23, "OF": 0, "CR": 97, #22, #91 } params = { 'SD': { 'MoveThroughDoorway_Method2': {'r2': {'nOutputs': 4, 'nInputs': 150, 'pos': -1, 'decoder': DecodeRobot_SD}}, 'Recover_Method1': {'r2': {'nOutputs': 4, 'nInputs': 128, 'pos': -1, 'decoder': DecodeRobot_SD}}, }, 'OF': { 'Order_Method1': { 'm': {'nOutputs': 5, 'nInputs': 613, 'pos': -2, 'decoder': DecodeMachine_OF}, 'objList': {'nOutputs': 10, 'nInputs': 613, 'pos': -1, 'decoder': DecodeObjList_OF}, }, 'Order_Method2': { 'm': {'nOutputs': 5, 'nInputs': 613, 'pos': -3, 'decoder': DecodeMachine_OF}, 'objList': {'nOutputs': 10, 'nInputs': 613, 'pos': -2, 'decoder': DecodeObjList_OF}, 'p': {'nOutputs': 4, 'nInputs': 613, 'pos': -1, 'decoder': DecodePalate_OF}, }, 'PickupAndLoad_Method1': {'r': {'nOutputs': 7, 'nInputs': 637, 'pos': -1, 'decoder': DecodeRobot_OF}}, 'UnloadAndDeliver_Method1': {'r': {'nOutputs': 7, 'nInputs': 625, 'pos': -1, 'decoder': DecodeRobot_OF}}, 'MoveToPallet_Method1': {'r': {'nOutputs': 7, 'nInputs': 633, 'pos': -1, 'decoder': DecodeRobot_OF}}, }, }
[ 198, 77, 23595, 796, 1391, 198, 220, 220, 220, 366, 6500, 1298, 28581, 11, 1303, 1828, 11, 198, 220, 220, 220, 366, 10305, 1298, 19710, 11, 1303, 1731, 11, 198, 220, 220, 220, 366, 12562, 1298, 25508, 11, 1303, 1954, 11, 198, 220, 220, 220, 366, 19238, 1298, 657, 11, 198, 220, 220, 220, 366, 9419, 1298, 10111, 11, 1303, 1828, 11, 1303, 6420, 198, 220, 220, 220, 1782, 198, 198, 37266, 796, 1391, 198, 220, 220, 220, 705, 10305, 10354, 1391, 198, 220, 220, 220, 220, 220, 220, 705, 21774, 15046, 35, 2675, 1014, 62, 17410, 17, 10354, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6, 81, 17, 10354, 1391, 6, 77, 26410, 82, 10354, 604, 11, 705, 77, 20560, 82, 10354, 6640, 11, 705, 1930, 10354, 532, 16, 11, 705, 12501, 12342, 10354, 4280, 1098, 14350, 313, 62, 10305, 92, 5512, 198, 220, 220, 220, 220, 220, 220, 705, 6690, 2502, 62, 17410, 16, 10354, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6, 81, 17, 10354, 1391, 6, 77, 26410, 82, 10354, 604, 11, 705, 77, 20560, 82, 10354, 13108, 11, 705, 1930, 10354, 532, 16, 11, 705, 12501, 12342, 10354, 4280, 1098, 14350, 313, 62, 10305, 92, 5512, 198, 220, 220, 220, 8964, 198, 220, 220, 220, 705, 19238, 10354, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 705, 18743, 62, 17410, 16, 10354, 220, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 76, 10354, 1391, 6, 77, 26410, 82, 10354, 642, 11, 705, 77, 20560, 82, 10354, 718, 1485, 11, 705, 1930, 10354, 532, 17, 11, 705, 12501, 12342, 10354, 4280, 1098, 37573, 62, 19238, 5512, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 26801, 8053, 10354, 1391, 6, 77, 26410, 82, 10354, 838, 11, 705, 77, 20560, 82, 10354, 718, 1485, 11, 705, 1930, 10354, 532, 16, 11, 705, 12501, 12342, 10354, 4280, 1098, 49201, 8053, 62, 19238, 5512, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 8964, 198, 220, 220, 220, 220, 220, 220, 220, 705, 18743, 62, 17410, 17, 10354, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 76, 10354, 1391, 6, 77, 26410, 82, 10354, 642, 11, 705, 77, 20560, 82, 10354, 718, 1485, 11, 705, 1930, 10354, 532, 18, 11, 705, 12501, 12342, 10354, 4280, 1098, 37573, 62, 19238, 5512, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 26801, 8053, 10354, 1391, 6, 77, 26410, 82, 10354, 838, 11, 705, 77, 20560, 82, 10354, 718, 1485, 11, 705, 1930, 10354, 532, 17, 11, 705, 12501, 12342, 10354, 4280, 1098, 49201, 8053, 62, 19238, 5512, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 705, 79, 10354, 1391, 6, 77, 26410, 82, 10354, 604, 11, 705, 77, 20560, 82, 10354, 718, 1485, 11, 705, 1930, 10354, 532, 16, 11, 220, 705, 12501, 12342, 10354, 4280, 1098, 11531, 378, 62, 19238, 5512, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 8964, 198, 220, 220, 220, 220, 220, 220, 220, 705, 31686, 929, 1870, 8912, 62, 17410, 16, 10354, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6, 81, 10354, 1391, 6, 77, 26410, 82, 10354, 767, 11, 705, 77, 20560, 82, 10354, 718, 2718, 11, 705, 1930, 10354, 532, 16, 11, 705, 12501, 12342, 10354, 4280, 1098, 14350, 313, 62, 19238, 92, 5512, 198, 220, 220, 220, 220, 220, 220, 220, 705, 3118, 2220, 1870, 13856, 1428, 62, 17410, 16, 10354, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6, 81, 10354, 1391, 6, 77, 26410, 82, 10354, 767, 11, 705, 77, 20560, 82, 10354, 48868, 11, 705, 1930, 10354, 532, 16, 11, 705, 12501, 12342, 10354, 4280, 1098, 14350, 313, 62, 19238, 92, 5512, 198, 220, 220, 220, 220, 220, 220, 220, 705, 21774, 2514, 11531, 1616, 62, 17410, 16, 10354, 220, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1391, 6, 81, 10354, 1391, 6, 77, 26410, 82, 10354, 767, 11, 705, 77, 20560, 82, 10354, 718, 2091, 11, 705, 1930, 10354, 532, 16, 11, 705, 12501, 12342, 10354, 4280, 1098, 14350, 313, 62, 19238, 92, 5512, 220, 198, 220, 220, 220, 8964, 198, 92 ]
1.811066
741
#!/usr/bin/python3 import pandas
[ 2, 48443, 14629, 14, 8800, 14, 29412, 18, 198, 198, 11748, 19798, 292, 628 ]
2.5
14
import sys print("----------------------- pythonsv project init -----------------------") sys.path.append(".") sys.path.append(r'C:\PythonSV\icelakex') from icelakex.starticx import * from icelakex.toolext import pysv_config from svtools.common.pysv_config import CFG if __name__ == '__main__': itp, sv = pythonsv_init() # x = cpuid(0x7,0) # print(x) # print("ECX data: %s" % (hex(x['ecx']))) # ECX_BIN = "{0:08b}".format(x['ecx']) # print(ECX_BIN[-14] == "1") # ECX_DEC = x['ecx'] # MASK_14 = 1 << 14 # print(ECX_DEC, MASK_14) # EXPECT_MASK_14 = 0b1 << 14 # print((ECX_DEC & MASK_14) == EXPECT_MASK_14) # x = cpuid(0x80000008,0) # print(x) # post_80 = itp.threads[0].port(0x80) # post_81 = itp.threads[0].port(0x81) # print("POST CODE: %s%s" % (post_80, post_81)) x = itp.threads[0].msr(0x981) print("MSR 0x981: %s" % x) # pythonsv_exit()
[ 11748, 25064, 198, 198, 4798, 7203, 19351, 6329, 279, 5272, 684, 85, 1628, 2315, 41436, 6329, 4943, 198, 17597, 13, 6978, 13, 33295, 7203, 19570, 198, 17597, 13, 6978, 13, 33295, 7, 81, 6, 34, 7479, 37906, 50, 53, 59, 291, 417, 539, 87, 11537, 198, 198, 6738, 14158, 417, 539, 87, 13, 9688, 291, 87, 1330, 1635, 198, 6738, 14158, 417, 539, 87, 13, 1462, 2305, 742, 1330, 279, 893, 85, 62, 11250, 198, 6738, 38487, 31391, 13, 11321, 13, 79, 893, 85, 62, 11250, 1330, 18551, 38, 628, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 340, 79, 11, 38487, 796, 279, 5272, 684, 85, 62, 15003, 3419, 198, 220, 220, 220, 1303, 2124, 796, 42804, 312, 7, 15, 87, 22, 11, 15, 8, 198, 220, 220, 220, 1303, 3601, 7, 87, 8, 198, 220, 220, 220, 1303, 3601, 7203, 2943, 55, 1366, 25, 4064, 82, 1, 4064, 357, 33095, 7, 87, 17816, 721, 87, 20520, 22305, 198, 220, 220, 220, 1303, 13182, 55, 62, 33, 1268, 796, 45144, 15, 25, 2919, 65, 92, 1911, 18982, 7, 87, 17816, 721, 87, 6, 12962, 198, 220, 220, 220, 1303, 3601, 7, 2943, 55, 62, 33, 1268, 58, 12, 1415, 60, 6624, 366, 16, 4943, 198, 220, 220, 220, 1303, 13182, 55, 62, 41374, 796, 2124, 17816, 721, 87, 20520, 198, 220, 220, 220, 1303, 32337, 42, 62, 1415, 796, 352, 9959, 1478, 198, 220, 220, 220, 1303, 3601, 7, 2943, 55, 62, 41374, 11, 32337, 42, 62, 1415, 8, 198, 220, 220, 220, 1303, 25703, 9782, 62, 31180, 42, 62, 1415, 796, 657, 65, 16, 9959, 1478, 198, 220, 220, 220, 1303, 3601, 19510, 2943, 55, 62, 41374, 1222, 32337, 42, 62, 1415, 8, 6624, 25703, 9782, 62, 31180, 42, 62, 1415, 8, 628, 220, 220, 220, 1303, 2124, 796, 42804, 312, 7, 15, 87, 23, 10535, 23, 11, 15, 8, 198, 220, 220, 220, 1303, 3601, 7, 87, 8, 628, 220, 220, 220, 1303, 1281, 62, 1795, 796, 340, 79, 13, 16663, 82, 58, 15, 4083, 634, 7, 15, 87, 1795, 8, 198, 220, 220, 220, 1303, 1281, 62, 6659, 796, 340, 79, 13, 16663, 82, 58, 15, 4083, 634, 7, 15, 87, 6659, 8, 198, 220, 220, 220, 1303, 3601, 7203, 32782, 42714, 25, 4064, 82, 4, 82, 1, 4064, 357, 7353, 62, 1795, 11, 1281, 62, 6659, 4008, 198, 220, 220, 220, 2124, 796, 340, 79, 13, 16663, 82, 58, 15, 4083, 907, 81, 7, 15, 87, 4089, 16, 8, 198, 220, 220, 220, 3601, 7203, 5653, 49, 657, 87, 4089, 16, 25, 4064, 82, 1, 4064, 2124, 8, 628, 220, 220, 220, 1303, 279, 5272, 684, 85, 62, 37023, 3419, 198 ]
2.037528
453
import sys import threading import code import socket import code import debugthread import io foo="xxx" s = socket.socket(socket.AF_INET) s.setsockopt(socket.SOL_SOCKET, socket.SO_REUSEADDR, 1) s.bind(('127.0.0.1', 4711)) s.listen(0) while True: ss, addr = s.accept() stdin =io.TextIOWrapper(ss.makefile('rb', 0), encoding='utf8') stdout = io.TextIOWrapper(ss.makefile('wb', 0), encoding='utf8') debugthread.shell(stdin, stdout, stdout, locals())
[ 11748, 25064, 198, 11748, 4704, 278, 198, 11748, 2438, 198, 11748, 17802, 198, 11748, 2438, 198, 11748, 14257, 16663, 198, 11748, 33245, 198, 198, 21943, 2625, 31811, 1, 198, 198, 82, 796, 17802, 13, 44971, 7, 44971, 13, 8579, 62, 1268, 2767, 8, 198, 82, 13, 28709, 735, 8738, 7, 44971, 13, 50, 3535, 62, 50, 11290, 2767, 11, 17802, 13, 15821, 62, 2200, 19108, 2885, 7707, 11, 352, 8, 198, 82, 13, 21653, 7, 10786, 16799, 13, 15, 13, 15, 13, 16, 3256, 6298, 1157, 4008, 198, 82, 13, 4868, 268, 7, 15, 8, 198, 4514, 6407, 25, 198, 220, 220, 220, 37786, 11, 37817, 796, 264, 13, 13635, 3419, 198, 220, 220, 220, 14367, 259, 796, 952, 13, 8206, 40, 3913, 430, 2848, 7, 824, 13, 15883, 7753, 10786, 26145, 3256, 657, 828, 21004, 11639, 40477, 23, 11537, 198, 220, 220, 220, 14367, 448, 796, 33245, 13, 8206, 40, 3913, 430, 2848, 7, 824, 13, 15883, 7753, 10786, 39346, 3256, 657, 828, 21004, 11639, 40477, 23, 11537, 198, 220, 220, 220, 14257, 16663, 13, 29149, 7, 19282, 259, 11, 14367, 448, 11, 14367, 448, 11, 17205, 28955, 198 ]
2.452632
190
import pytest from tartiflette.language.ast import InterfaceTypeDefinitionNode @pytest.mark.parametrize( "interface_type_definition_node,other,expected", [ ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), Ellipsis, False, ), ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionNameBis", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), False, ), ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescriptionBis", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), False, ), ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectivesBis", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), False, ), ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFieldsBis", location="interfaceTypeDefinitionLocation", ), False, ), ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocationBis", ), False, ), ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), True, ), ], ) @pytest.mark.parametrize( "interface_type_definition_node,expected", [ ( InterfaceTypeDefinitionNode( name="interfaceTypeDefinitionName", description="interfaceTypeDefinitionDescription", directives="interfaceTypeDefinitionDirectives", fields="interfaceTypeDefinitionFields", location="interfaceTypeDefinitionLocation", ), "InterfaceTypeDefinitionNode(" "description='interfaceTypeDefinitionDescription', " "name='interfaceTypeDefinitionName', " "directives='interfaceTypeDefinitionDirectives', " "fields='interfaceTypeDefinitionFields', " "location='interfaceTypeDefinitionLocation')", ) ], )
[ 11748, 12972, 9288, 198, 198, 6738, 35842, 361, 21348, 13, 16129, 13, 459, 1330, 26491, 6030, 36621, 19667, 628, 198, 198, 31, 9078, 9288, 13, 4102, 13, 17143, 316, 380, 2736, 7, 198, 220, 220, 220, 366, 39994, 62, 4906, 62, 46758, 62, 17440, 11, 847, 11, 40319, 1600, 198, 220, 220, 220, 685, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7122, 2419, 271, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 33, 271, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 33, 271, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 33, 271, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 33, 271, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 33, 271, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6407, 11, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 16589, 198, 8, 628, 198, 31, 9078, 9288, 13, 4102, 13, 17143, 316, 380, 2736, 7, 198, 220, 220, 220, 366, 39994, 62, 4906, 62, 46758, 62, 17440, 11, 40319, 1600, 198, 220, 220, 220, 685, 198, 220, 220, 220, 220, 220, 220, 220, 357, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 26491, 6030, 36621, 19667, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 2625, 39994, 6030, 36621, 5376, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6764, 2625, 39994, 6030, 36621, 11828, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 34819, 2625, 39994, 6030, 36621, 13470, 1083, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7032, 2625, 39994, 6030, 36621, 15878, 82, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 2625, 39994, 6030, 36621, 14749, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 39317, 6030, 36621, 19667, 7203, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 11213, 11639, 39994, 6030, 36621, 11828, 3256, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 3672, 11639, 39994, 6030, 36621, 5376, 3256, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 12942, 1083, 11639, 39994, 6030, 36621, 13470, 1083, 3256, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 25747, 11639, 39994, 6030, 36621, 15878, 82, 3256, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 24886, 11639, 39994, 6030, 36621, 14749, 11537, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 16589, 198, 8, 198 ]
2.308144
2,554
""" Main Gofra programming language source code. """ __author__ = "Kirill Zhosul @kirillzhosul" __license__ = "MIT" from typing import Generator from os.path import basename from sys import argv import gofra from gofra.core.danger import * from gofra.core.stack import Stack # MAJOR WARNING FOR ALL READERS. # This code is not refactored, # currently I am working on refactoring and splitting into the gofra module, # there is a lot of stuff, that will be reworked. # Also, want to say that bytecode is not finished, and interpretation will be # converted to gofra.core.vm that will be run bytecode for own, # as internal interpretation method (if you want to use C++ VM which is may not be finished also yet, # see that https://github.com/gofralang/vm/) # Lexer. def lexer_tokenize(lines: List[str], file_parent: str) -> Generator[Token, None, None]: """ Tokenizes lines into list of the Tokens. """ # Check that there is no changes in token type. assert len(TokenType) == 6, "Please update implementation after adding new TokenType!" # Get the basename. file_parent = basename(file_parent) # Current line index. current_line_index = 0 # Get lines count. lines_count = len(lines) # Check that there is more than zero lines. if lines_count == 0: # If there is no lines. # Error. gofra.core.errors.message_verbosed(Stage.LEXER, (file_parent, 1, 1), "Error", "There is no lines found in the given file " "are you given empty file?", True) while current_line_index < lines_count: # Loop over lines. # Get line. current_line = lines[current_line_index] # Find first non-space char. current_collumn_index = gofra.core.lexer.find_collumn(current_line, 0, lambda char: not char.isspace()) # Get current line length. current_line_length = len(current_line) # ?. current_collumn_end_index = 0 while current_collumn_index < current_line_length: # Iterate over line. # Get the location. current_location = (file_parent, current_line_index + 1, current_collumn_index + 1) if current_line[current_collumn_index] == EXTRA_CHAR: # If we got character quote*. # Index of the column end. # (Trying to find closing quote* current_collumn_end_index = gofra.core.lexer.find_collumn(current_line, current_collumn_index + 1, lambda char: char == EXTRA_CHAR) if current_collumn_end_index >= len(current_line) or \ current_line[current_collumn_end_index] != EXTRA_CHAR: # If we got not EXTRA_CHAR or exceed current line length. # Error. gofra.core.errors.message_verbosed(Stage.LEXER, current_location, "Error", "There is unclosed character literal. " f"Do you forgot to place `{EXTRA_CHAR}`?", True) # Get current token text. current_token_text = current_line[current_collumn_index + 1: current_collumn_end_index] # Get current char value. current_char_value = gofra.core.lexer.unescape(current_token_text).encode("UTF-8") if len(current_char_value) != 1: # If there is 0 or more than 1 characters*. # Error. gofra.core.errors.message_verbosed(Stage.LEXER, current_location, "Error", "Unexpected number of characters in the character literal." "Only one character is allowed in character literal", True) # Return character token. yield Token( type=TokenType.CHARACTER, text=current_token_text, location=current_location, value=current_char_value[0] ) # Find first non-space char. current_collumn_index = gofra.core.lexer.find_collumn(current_line, current_collumn_end_index + 1, lambda char: not char.isspace()) elif current_line[current_collumn_index] == EXTRA_STRING: # If this is string. # String buffer for strings. current_string_buffer = "" while current_line_index < len(lines): # While we don`t reach end of the lines. # Get string start. string_start_collumn_index = current_collumn_index if current_string_buffer == "": # If we not start writing string buffer. # Increment by one for quote. string_start_collumn_index += len(EXTRA_STRING) else: # If we started. # Just grab line. current_line = lines[current_line_index] # Get string end. string_end_collumn_index = gofra.core.lexer.find_string_end(current_line, string_start_collumn_index) if string_end_collumn_index >= len(current_line) or \ current_line[string_end_collumn_index] != EXTRA_STRING: # If got end of current line, or not found closing string. # Add current line. current_string_buffer += current_line[string_start_collumn_index:] # Reset and move next line. current_line_index += 1 current_collumn_index = 0 else: # If current line. # Add final buffer. current_string_buffer += current_line[string_start_collumn_index:string_end_collumn_index] current_collumn_end_index = string_end_collumn_index # End lexing string. break if current_line_index >= len(lines): # If we exceed current lines length. # Error. gofra.core.errors.message_verbosed(Stage.LEXER, current_location, "Error", "There is unclosed string literal. " f"Do you forgot to place `{EXTRA_STRING}`?", True) # Error?. assert current_line[current_collumn_index] == EXTRA_STRING, "Got non string closing character!" # Increase end index. current_collumn_end_index += 1 # Get current token text. current_token_text = current_string_buffer # Return string token. yield Token( type=TokenType.STRING, text=current_token_text, location=current_location, value=gofra.core.lexer.unescape(current_token_text) ) # Find first non-space char. current_collumn_index = gofra.core.lexer.find_collumn(current_line, current_collumn_end_index, lambda char: not char.isspace()) else: # Index of the column end. current_collumn_end_index = gofra.core.lexer.find_collumn(current_line, current_collumn_index, lambda char: char.isspace()) # Get current token text. current_token_text = current_line[current_collumn_index: current_collumn_end_index] try: # Try convert token integer. current_token_integer = int(current_token_text) except ValueError: # If there is invalid value for integer. if current_token_text in KEYWORD_NAMES_TO_TYPE: # If this is keyword. # Return keyword token. yield Token( type=TokenType.KEYWORD, text=current_token_text, location=current_location, value=KEYWORD_NAMES_TO_TYPE[current_token_text] ) else: # Not keyword. # If this is comment - break. # TODO: Try to fix something like 0//0 (comment not at the start) will lex not as should. if current_token_text.startswith(EXTRA_COMMENT): break # Return word token. yield Token( type=TokenType.WORD, text=current_token_text, location=current_location, value=current_token_text ) else: # If all ok. # Return token. yield Token( type=TokenType.INTEGER, text=current_token_text, location=current_location, value=current_token_integer ) # Find first non-space char. current_collumn_index = gofra.core.lexer.find_collumn(current_line, current_collumn_end_index, lambda char: not char.isspace()) # Increment current line. current_line_index += 1 # Parser. def parser_parse(tokens: List[Token], context: ParserContext, path: str): """ Parses token from lexer* (lexer_tokenize()) """ # Check that there is no changes in operator type. assert len(OperatorType) == 10, "Please update implementation after adding new OperatorType!" # Check that there is no changes in keyword type. assert len(Keyword) == 8, "Please update implementation after adding new Keyword!" # Check that there is no changes in token type. assert len(TokenType) == 6, "Please update implementation after adding new TokenType!" # Reverse tokens. reversed_tokens: List[Token] = list(reversed(tokens)) # Definitions. definitions: Dict[str, Definition] = dict() memories: Dict[str, Memory] = dict() variables: Dict[str, Variable] = dict() variables_offset = 0 memories_offset = 0 if len(reversed_tokens) == 0: gofra.core.errors.message_verbosed(Stage.PARSER, (basename(path), 1, 1), "Error", "There is no tokens found, are you given empty file?", True) while len(reversed_tokens) > 0: # While there is any token. # Get current token. current_token: Token = reversed_tokens.pop() if current_token.type == TokenType.WORD: assert isinstance(current_token.value, str), "Type error, lexer level error?" if current_token.value in INTRINSIC_NAMES_TO_TYPE: context.operators.append(Operator( type=OperatorType.INTRINSIC, token=current_token, operand=INTRINSIC_NAMES_TO_TYPE[current_token.value] )) context.operator_index += 1 continue if current_token.text in definitions: # Expand definition tokens. reversed_tokens += reversed(definitions[current_token.text].tokens) continue if current_token.text in memories: memory = memories[current_token.text] context.operators.append(Operator( type=OperatorType.PUSH_INTEGER, token=current_token, operand=memory.ptr_offset )) context.operator_index += 1 continue if current_token.text in variables: variable = variables[current_token.text] context.operators.append(Operator( type=OperatorType.PUSH_INTEGER, token=current_token, operand=variable.ptr_offset )) context.operator_index += 1 continue if current_token.text.startswith(EXTRA_DIRECTIVE): directive = current_token.text[len(EXTRA_DIRECTIVE):] if directive == "LINTER_SKIP": if context.directive_linter_skip: gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", f"Directive `{EXTRA_DIRECTIVE}{directive}` defined twice!", True) context.directive_linter_skip = True elif directive == "PYTHON_COMMENTS_SKIP": if context.directive_python_comments_skip: gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", f"Directive `{EXTRA_DIRECTIVE}{directive}` defined twice!", True) context.directive_python_comments_skip = True else: if directive.startswith("MEM_BUF_BYTE_SIZE="): # If this is starts with memory buffer byte size definition name. # Get directive value from all directive text. directive_value = directive[len("MEM_BUF_BYTE_SIZE="):] # Get new memory size try: new_memory_bytearray_size = int(directive_value) except ValueError: gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", f"Directive `{EXTRA_DIRECTIVE}{directive}` " f"passed invalid size `{directive_value}`!", True) else: # Change size of the bytearray. context.memory_bytearray_size = new_memory_bytearray_size else: # Message. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", f"Unknown directive `{EXTRA_DIRECTIVE}{directive}`", True) continue gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", f"Unknown WORD `{current_token.text}`, " f"are you misspelled something?", True) elif current_token.type == TokenType.INTEGER: # If we got an integer. # Type check. assert isinstance(current_token.value, int), "Type error, lexer level error?" # Add operator to the context. context.operators.append(Operator( type=OperatorType.PUSH_INTEGER, token=current_token, operand=current_token.value )) # Increment operator index. context.operator_index += 1 elif current_token.type == TokenType.STRING: # If we got a string. # Type check. assert isinstance(current_token.value, str), "Type error, lexer level error?" # Add operator to the context. context.operators.append(Operator( type=OperatorType.PUSH_STRING, token=current_token, operand=current_token.value )) # Increment operator index. context.operator_index += 1 elif current_token.type == TokenType.CHARACTER: # If we got a character. # Type check. assert isinstance(current_token.value, int), "Type error, lexer level error?" # Add operator to the context. context.operators.append(Operator( type=OperatorType.PUSH_INTEGER, token=current_token, operand=current_token.value )) # Increment operator index. context.operator_index += 1 elif current_token.type == TokenType.KEYWORD: # If we got a keyword. if current_token.value == Keyword.IF: # This is IF keyword. # Push operator to the context. context.operators.append(Operator( type=OperatorType.IF, token=current_token )) # Push current operator index to the context memory stack. context.memory_stack.append(context.operator_index) # Increment operator index. context.operator_index += 1 elif current_token.value == Keyword.WHILE: # This is WHILE keyword. # Push operator to the context. context.operators.append(Operator( type=OperatorType.WHILE, token=current_token )) # Push current operator index to the context memory stack. context.memory_stack.append(context.operator_index) # Increment operator index. context.operator_index += 1 elif current_token.value == Keyword.DO: # This is `DO` keyword. if len(context.memory_stack) == 0: # If there is nothing on the memory stack. # Error. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`do` should used after the `while` block!", True) # Push operator to the context. context.operators.append(Operator( type=OperatorType.DO, token=current_token )) # Get `WHILE` operator from the memory stack. block_operator_index = context.memory_stack.pop() block_operator = context.operators[block_operator_index] if block_operator.type != OperatorType.WHILE: # If this is not while. # Error. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`do` should used after the `while` block!", True) # Say that we crossreference WHILE block. context.operators[context.operator_index].operand = block_operator_index # Push current operator index to the context memory stack. context.memory_stack.append(context.operator_index) # Increment operator index. context.operator_index += 1 elif current_token.value == Keyword.ELSE: # If this is else keyword. if len(context.memory_stack) == 0: # If there is nothing on the memory stack. # Error. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`else` should used after the `if` block!", True) # Get `IF` operator from the memory stack. block_operator_index = context.memory_stack.pop() block_operator = context.operators[block_operator_index] if block_operator.type == OperatorType.IF: # If we use else after the IF. # Say that previous IF should jump at the our+1 operator index. context.operators[block_operator_index].operand = context.operator_index + 1 # Push current operator index to the stack. context.memory_stack.append(context.operator_index) # Push operator to the context. context.operators.append(Operator( type=OperatorType.ELSE, token=current_token )) # Increment operator index. context.operator_index += 1 else: # If not `IF`. # Get error location. error_location = block_operator.token.location # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, error_location, "Error", "`else` can only used after `if` block!", True) elif current_token.value == Keyword.END: # If this is end keyword. # Get block operator from the stack. block_operator_index = context.memory_stack.pop() block_operator = context.operators[block_operator_index] if block_operator.type == OperatorType.IF: # If this is IF block. # Push operator to the context. context.operators.append(Operator( type=OperatorType.END, token=current_token )) # Say that start IF block refers to this END block. context.operators[block_operator_index].operand = context.operator_index # Say that this END block refers to next operator index. context.operators[context.operator_index].operand = context.operator_index + 1 elif block_operator.type == OperatorType.ELSE: # If this is ELSE block. # Push operator to the context. context.operators.append(Operator( type=OperatorType.END, token=current_token )) # Say that owner block (If/Else) should jump to us. context.operators[block_operator_index].operand = context.operator_index # Say that we should jump to the next position. context.operators[context.operator_index].operand = context.operator_index + 1 elif block_operator.type == OperatorType.DO: # If this is DO block. # Type check. assert block_operator.operand is not None, "DO operator has unset operand! Parser level error?" assert isinstance(block_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Push operator to the context. context.operators.append(Operator( type=OperatorType.END, token=current_token )) # Say that DO crossreference to the WHILE block. context.operators[context.operator_index].operand = block_operator.operand # Say that WHILE should jump in the DO body. context.operators[block_operator.operand].operand = context.operator_index + 1 else: # If invalid we call end not after the if or else. # Get error location. error_location = block_operator.token.location # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, error_location, "Error", "`end` can only close `if`, `else` or `do` block!", True) # Increment operator index. context.operator_index += 1 elif current_token.value == Keyword.DEFINE: # This is DEFINE keyword. if len(reversed_tokens) == 0: # No name for definition is given. # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`define` should have name after the keyword, " "do you has unfinished definition?", True) # Get name for definition. definition_name = reversed_tokens.pop() if definition_name.type != TokenType.WORD: # If name is not word. # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, definition_name.location, "Error", "`define` name, should be of type WORD, sorry, but you can`t use something that you give as name for the definition!", True) if definition_name.text in definitions: # If already defined. # Error messages. gofra.core.errors.message_verbosed(Stage.PARSER, definition_name.location, "Error", "Definition with name {} was already defined!", False) gofra.core.errors.message_verbosed(Stage.PARSER, definitions[definition_name.text].location, "Error", "Original definition was here...", True) if definition_name.text in INTRINSIC_NAMES_TO_TYPE or definition_name.text in KEYWORD_NAMES_TO_TYPE: # If default item. # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, definition_name.location, "Error", "Can`t define definition with language defined name!", True) # Create blank new definition. definition = Definition(current_token.location, []) # Add definition. definitions[definition_name.text] = definition # How much we require ends. required_end_count = 0 while len(reversed_tokens) > 0: # If there is still tokens. # Get new token. current_token = reversed_tokens.pop() if current_token.type == TokenType.KEYWORD: # If got keyword. if current_token.text in KEYWORD_NAMES_TO_TYPE: # If this is correct keyword. if current_token.text == KEYWORD_TYPES_TO_NAME[Keyword.END]: # If this is end. if required_end_count <= 0: # If we no more require end. # Stop definition. break # Decrease required end counter. required_end_count -= 1 if KEYWORD_NAMES_TO_TYPE[current_token.text] in \ (Keyword.IF, Keyword.DEFINE, Keyword.DO): # If this is keyword that requires end. # Increase required end count. required_end_count += 1 if KEYWORD_NAMES_TO_TYPE[current_token.text] == Keyword.ELSE: # If got else. # Just pass as else not requires end. pass else: # Invalid keyword. assert False, "Got invalid keyword!" # Append token. definition.tokens.append(current_token) if required_end_count != 0: # If there is still required end. # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", f"There is {required_end_count} unclosed blocks, " "that requires cloing `end` keyword inside `define` definition. ", True) if not (current_token.type == TokenType.KEYWORD and current_token.text == KEYWORD_TYPES_TO_NAME[Keyword.END]): # If got not end at end of definition. # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`define` should have `end` at the end of definition, " "but it was not founded!", True) elif current_token.value == Keyword.MEMORY: if len(reversed_tokens) == 0: gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`memory` should have name after the keyword, " "do you has unfinished memory definition?", True) name_token = reversed_tokens.pop() if name_token.type != TokenType.WORD: gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", "`memory` name, should be of type WORD, sorry, but " "you can`t use something that you give as name " "for the memory!", True) if name_token.text in memories or name_token.text in definitions: gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", f"Definition or memory with name {name_token.text} " f"was already defined!", False) if name_token.text in definitions: gofra.core.errors.message_verbosed(Stage.PARSER, definitions[name_token.text].location, "Error", "Original definition was here...", True) # TODO: Memory location report. if name_token.text in INTRINSIC_NAMES_TO_TYPE or name_token.text in KEYWORD_NAMES_TO_TYPE: # If default item. gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", "Can`t define memories with language defined name!", True) if len(reversed_tokens) <= 0: gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", "`memory` requires size for memory definition, " "which was not given!", True) memory_size_token = reversed_tokens.pop() if memory_size_token.type != TokenType.INTEGER: gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", "`var` size, should be of type INTEGER, sorry, but " "you can`t use something that you give as size " "for the memory!", True) # TODO: Proper evaluation. # Create blank new memory. memory_name = name_token.text memories[memory_name] = Memory(memory_name, memory_size_token.value, memories_offset) memories_offset += memory_size_token.value if len(reversed_tokens) >= 0: end_token = reversed_tokens.pop() if end_token.type == TokenType.KEYWORD and \ end_token.text == KEYWORD_TYPES_TO_NAME[Keyword.END]: continue # If got not end at end of definition. gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`memory` should have `end` at the end of memory definition, " "but it was not founded!", True) elif current_token.value == Keyword.VARIABLE: if len(reversed_tokens) == 0: gofra.core.errors.message_verbosed(Stage.PARSER, current_token.location, "Error", "`var` should have name after the keyword, " "do you has unfinished variable definition?", True) name_token = reversed_tokens.pop() if name_token.type != TokenType.WORD: gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", "`var` name, should be of type WORD, sorry, but " "you can`t use something that you give as name " "for the variable!", True) if name_token.text in variables or name_token.text in definitions or name_token.text in memories: gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", f"Definition or variable with name {name_token.text} " f"was already defined!", False) if name_token.text in definitions: gofra.core.errors.message_verbosed(Stage.PARSER, definitions[name_token.text].location, "Error", "Original definition was here...", True) # TODO: Memory / variable location report. if name_token.text in INTRINSIC_NAMES_TO_TYPE or name_token.text in KEYWORD_NAMES_TO_TYPE: # If default item. gofra.core.errors.message_verbosed(Stage.PARSER, name_token.location, "Error", "Can`t define variable with language defined name!", True) # Create blank new memory. variable_name = name_token.text variables[variable_name] = Variable(variable_name, variables_offset) variables_offset += VARIABLE_SIZE else: # If unknown keyword type. assert False, "Unknown keyword type! (How?)" else: # If unknown operator type. assert False, "Unknown operator type! (How?)" if len(context.memory_stack) > 0: # If there is any in the stack. # Get error operator. error_operator = context.operators[context.memory_stack.pop()] # Get error location. error_location = error_operator.token.location # Error message. gofra.core.errors.message_verbosed(Stage.PARSER, error_location, "Error", f"Unclosed block \"{error_operator.token.text}\"!", True) if context.directive_linter_skip: # If skip linter. # Warning message. gofra.core.errors.message_verbosed(Stage.PARSER, (basename(path), 1, 1), "Warning", "#LINTER_SKIP DIRECTIVE! THIS IS UNSAFE, PLEASE DISABLE IT!") # Interpretator. def interpretator_run(source: Source, bytearray_size: int = MEMORY_BYTEARRAY_SIZE): """ Interpretates the source. """ assert len(OperatorType) == 10, "Please update implementation after adding new OperatorType!" assert len(Intrinsic) == 30, "Please update implementation after adding new Intrinsic!" # Create empty stack. memory_execution_stack = Stack() # String pointers. memory_string_pointers: Dict[OPERATOR_ADDRESS, TYPE_POINTER] = dict() memory_string_size = bytearray_size memory_string_size_ponter = 0 # Allocate sized bytearray. memory_bytearray = bytearray(bytearray_size + memory_string_size + MEMORY_MEMORIES_SIZE + MEMORY_VARIABLES_SIZE) # Get source operators count. operators_count = len(source.operators) current_operator_index = 0 if operators_count == 0: gofra.core.errors.message_verbosed(Stage.RUNNER, ("__RUNNER__", 1, 1), "Error", "There is no operators found in given file after parsing, " "are you given empty file or file without resulting operators?", True) while current_operator_index < operators_count: # While we not run out of the source operators list. # Get current operator from the source. current_operator: Operator = source.operators[current_operator_index] try: # Try / Catch to get unexpected Python errors. if current_operator.type == OperatorType.PUSH_INTEGER: # Push integer operator. # Type check. assert isinstance(current_operator.operand, int), "Type error, parser level error?" # Push operand to the stack. memory_execution_stack.push(current_operator.operand) # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.PUSH_STRING: # Push string operator. # Type check. assert isinstance(current_operator.operand, str), "Type error, parser level error?" # Get string data. string_value = current_operator.operand.encode("UTF-8") string_length = len(string_value) if current_operator_index not in memory_string_pointers: # If we not found string in allocated string pointers. # Get pointer, and push in to the pointers. string_pointer: TYPE_POINTER = memory_string_size + 1 + memory_string_size_ponter memory_string_pointers[current_operator_index] = string_pointer # Write string right into the bytearray memory. memory_bytearray[string_pointer: string_pointer + string_length] = string_value # Increase next pointer by current string length. memory_string_size_ponter += string_length # Check that there is no overflow. if string_length > memory_string_size: # If overflowed. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", "Trying to push string, when there is memory string buffer overflow!" " Try use memory size directive, to increase size!", True) # Push found string pointer to the stack. found_string_pointer = memory_string_pointers[current_operator_index] memory_execution_stack.push(found_string_pointer) # Push string length to the stack. memory_execution_stack.push(string_length) # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.INTRINSIC: # Intrinsic operator. if current_operator.operand == Intrinsic.PLUS: # Intristic plus operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push sum to the stack. memory_execution_stack.push(operand_b + operand_a) elif current_operator.operand == Intrinsic.DIVIDE: # Intristic divide operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push divide to the stack. memory_execution_stack.push(operand_b // operand_a) elif current_operator.operand == Intrinsic.MODULUS: # Intristic modulus operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push divide to the stack. memory_execution_stack.push(int(operand_b % operand_a)) elif current_operator.operand == Intrinsic.MINUS: # Intristic minus operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push difference to the stack. memory_execution_stack.push(operand_b - operand_a) elif current_operator.operand == Intrinsic.MULTIPLY: # Intristic multiply operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push muliply to the stack. memory_execution_stack.push(operand_b * operand_a) elif current_operator.operand == Intrinsic.EQUAL: # Intristic equal operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push equal to the stack. memory_execution_stack.push(int(operand_b == operand_a)) elif current_operator.operand == Intrinsic.NOT_EQUAL: # Intristic not equal operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push not equal to the stack. memory_execution_stack.push(int(operand_b != operand_a)) elif current_operator.operand == Intrinsic.LESS_THAN: # Intristic less than operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push less than to the stack. memory_execution_stack.push(int(operand_b < operand_a)) elif current_operator.operand == Intrinsic.GREATER_THAN: # Intristic greater than operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push greater than to the stack. memory_execution_stack.push(int(operand_b > operand_a)) elif current_operator.operand == Intrinsic.LESS_EQUAL_THAN: # Intristic less equal than operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push less equal than to the stack. memory_execution_stack.push(int(operand_b <= operand_a)) elif current_operator.operand == Intrinsic.GREATER_EQUAL_THAN: # Intristic greater equal than operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push greater equal than to the stack. memory_execution_stack.push(int(operand_b >= operand_a)) elif current_operator.operand == Intrinsic.SWAP: # Intristic swap operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push swapped to the stack. memory_execution_stack.push(operand_a) memory_execution_stack.push(operand_b) elif current_operator.operand == Intrinsic.COPY: # Intristic copy operator. # Get operand. operand_a = memory_execution_stack.pop() # Push copy to the stack. memory_execution_stack.push(operand_a) memory_execution_stack.push(operand_a) elif current_operator.operand == Intrinsic.COPY2: # Intristic copy2 operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push copy to the stack. memory_execution_stack.push(operand_b) memory_execution_stack.push(operand_a) memory_execution_stack.push(operand_b) memory_execution_stack.push(operand_a) elif current_operator.operand == Intrinsic.COPY_OVER: # Intristic copy over operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Push copy to the stack. memory_execution_stack.push(operand_b) memory_execution_stack.push(operand_a) memory_execution_stack.push(operand_b) elif current_operator.operand == Intrinsic.DECREMENT: # Intristic decrement operator. # Get operand. operand_a = memory_execution_stack.pop() # Push decrement to the stack. memory_execution_stack.push(operand_a - 1) elif current_operator.operand == Intrinsic.INCREMENT: # Intristic increment operator. # Get operand. operand_a = memory_execution_stack.pop() # Push increment to the stack. memory_execution_stack.push(operand_a + 1) elif current_operator.operand == Intrinsic.FREE: # Intristic free operator. # Pop and left. memory_execution_stack.pop() elif current_operator.operand == Intrinsic.SHOW: # Intristic show operator. # Get operand. operand_a = memory_execution_stack.pop() # Show operand. print(operand_a) elif current_operator.operand == Intrinsic.MEMORY_WRITE: # Intristic memory write operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() if operand_b > len(memory_bytearray): # If this is going to be memory overflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to write at memory address {operand_b} " f"that overflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferOverflow)", True) elif operand_b < 0: # If this is going to be memory undeflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to write at memory address {operand_b} " f"that underflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferUnderflow)", True) # Write memory. try: memory_bytearray[operand_b] = operand_a except IndexError: # Memory error. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer (over|under)flow " f"(Write to pointer {operand_b} when there is memory buffer " f"with size {len(memory_bytearray)} bytes)!", True) except ValueError: # If this is 8bit (1byte) range (number) overflow. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer cell can only contain 1 byte (8 bit) " f"that must be in range (0, 256),\nbut you passed number " f"{operand_a} which is not fits in the 1 byte cell! (ByteOverflow)", True) elif current_operator.operand == Intrinsic.MEMORY_WRITE4BYTES: # Intristic memory write 4 bytes operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # Convert value to 4 bytes. try: operand_a = operand_a.to_bytes(length=4, byteorder="little", signed=(operand_a < 0)) except OverflowError: # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer cell can only contain 4 byte (32 bit) " f"that must be in range (0, 4294967295),\nbut you passed number " f"{operand_a} which is not fits in the 4 byte cell! (ByteOverflow)", True) if operand_b + 4 - 1 > len(memory_bytearray): # If this is going to be memory overflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to write 4 bytes to memory address from {operand_b} to " f"{operand_b + 4 - 1} " f"that overflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferOverflow)", True) elif operand_b < 0: # If this is going to be memory undeflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to write at memory address " f"from {operand_b} to {operand_b + 2} " f"that underflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferUnderflow)", True) # Write memory. try: memory_bytearray[operand_b:operand_b + 4] = operand_a except IndexError: # Memory* error. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer (over|under)flow " f"(Write to pointer from " f"{operand_b} to {operand_b + 4 - 1} " f"when there is memory buffer with size " f"{len(memory_bytearray)} bytes)!", True) except ValueError: # If this is 32bit (4byte) range (number) overflow. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer cell can only contain 4 byte (32 bit) " f"that must be in range (0, 4294967295),\nbut you passed number " f"{operand_a} which is not fits in the 4 byte cell! (ByteOverflow)", True) elif current_operator.operand == Intrinsic.MEMORY_READ4BYTES: # Intristic memory read 4 bytes operator. # Get operand. operand_a = memory_execution_stack.pop() if operand_a + 4 - 1 > len(memory_bytearray): # If this is going to be memory overflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to read from memory address " f"{operand_a} to {operand_a + 4 - 1} " f"that overflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferOverflow)", True) elif operand_a < 0: # If this is going to be memory undeflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to read from memory address " f"{operand_a} to {operand_a + 4 - 1}" f"that underflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferUnderflow)", True) # Read memory at the pointer. try: memory_bytes = int.from_bytes(memory_bytearray[operand_a:operand_a + 4], byteorder="little") except IndexError: # Memory* error. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer (over|under)flow " f"(Read from pointer {operand_a} to {operand_a + 4 - 1} " f"when there is memory buffer with size " f"{len(memory_bytearray)} bytes)!", True) else: # Push memory to the stack. memory_execution_stack.push(memory_bytes) elif current_operator.operand == Intrinsic.MEMORY_READ: # Intristic memory read operator. # Get operand. operand_a = memory_execution_stack.pop() if operand_a > len(memory_bytearray): # If this is going to be memory overflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to read from memory address {operand_a} " f"that overflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferOverflow)", True) elif operand_a < 0: # If this is going to be memory undeflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to read from memory address {operand_a} " f"that underflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferUnderflow)", True) # Read memory at the pointer. try: memory_byte = memory_bytearray[operand_a] except IndexError: # Memory* error. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer (over|under)flow " f"(Read from pointer {operand_a} when there is memory buffer " f"with size {len(memory_bytearray)} bytes)!", True) else: # Push memory to the stack. memory_execution_stack.push(memory_byte) elif current_operator.operand == Intrinsic.MEMORY_SHOW_CHARACTERS: # Intristic memory show as chars operator. # Get both operands. operand_a = memory_execution_stack.pop() operand_b = memory_execution_stack.pop() # String to show. memory_string: bytes = b"" if operand_b + operand_a > len(memory_bytearray): # If this is going to be memory overflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to read from memory address " f"from {operand_b} to {operand_b + operand_a} " f"that overflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferOverflow)", True) elif operand_a < 0: # If this is going to be memory undeflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Trying to read from memory address" f"from {operand_b} to {operand_b + operand_a} " f"that underflows memory buffer size {(len(memory_bytearray))}" " bytes (MemoryBufferUnderflow)", True) # Read memory string. try: memory_string = memory_bytearray[operand_b: operand_b + operand_a] except IndexError: # Memory* error. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Memory buffer (over|under)flow " f"(Read from {operand_b} to {operand_b + operand_a} " f"when there is memory " f"buffer with size {len(memory_bytearray)} bytes)!", True) # Print decoded memory bytes. print(memory_string.decode("UTF-8"), end="") elif current_operator.operand == Intrinsic.MEMORY_POINTER: # Intristic memory pointer operator. # Push pointer to the stack. memory_execution_stack.push(MEMORY_BYTEARRAY_NULL_POINTER) elif current_operator.operand == Intrinsic.NULL: # Intristic null operator. # Push pointer to the stack. memory_execution_stack.push(0) elif current_operator.operand == Intrinsic.IO_READ_STRING: # Intrinsic I/O read string operator. # Get string data. string_value = input().encode("UTF-8") string_length = len(string_value) if current_operator_index not in memory_string_pointers: # If we not found string in allocated string pointers. # Get pointer, and push in to the pointers. string_pointer: TYPE_POINTER = 1 + memory_string_size_ponter memory_string_pointers[current_operator_index] = string_pointer # Write string right into the bytearray memory. memory_bytearray[string_pointer: string_pointer + string_length] = string_value # Increase next pointer by current string length. memory_string_size_ponter += string_length # Check that there is no overflow. if string_length > memory_string_size: # If overflow. # Error. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", "Trying to push I/O string, " "when there is memory string buffer overflow! " "Try use memory size directive, to increase size!", True) # Push found string pointer to the stack. found_string_pointer = memory_string_pointers[current_operator_index] memory_execution_stack.push(found_string_pointer) # Push string length to the stack. memory_execution_stack.push(string_length) elif current_operator.operand == Intrinsic.IO_READ_INTEGER: # Intrinsic I/O read integer operator. # Get integer data. try: integer_value = int(input()) except ValueError: integer_value = -1 # Push integer to the stack. memory_execution_stack.push(integer_value) else: # If unknown instrinsic type. assert False, "Unknown instrinsic! (How?)" # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.IF: # IF operator. # Get operand. operand_a = memory_execution_stack.pop() # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" if operand_a == 0: # If this is false. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), \ "Type error, parser level error?" # Jump to the operator operand. # As this is IF, so we should jump to the END. current_operator_index = current_operator.operand else: # If this is true. # Increment operator index. # This is makes jump into the if branch. current_operator_index += 1 elif current_operator.type == OperatorType.ELSE: # ELSE operator. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Jump to the operator operand. # As this is ELSE operator, we should have index + 1, index! current_operator_index = current_operator.operand elif current_operator.type == OperatorType.DO: # DO operator. # Get operand. operand_a = memory_execution_stack.pop() # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" if operand_a == 0: # If this is false. # Endif jump operator index. end_jump_operator_index = source.operators[current_operator.operand].operand # Type check. assert isinstance(end_jump_operator_index, OPERATOR_ADDRESS), \ "Type error, parser level error?" # Jump to the operator operand. # As this is DO, so we should jump to the END. current_operator_index = int(end_jump_operator_index) else: # If this is true. # Increment operator index. # This is makes jump into the if body. current_operator_index += 1 elif current_operator.type == OperatorType.WHILE: # WHILE operator. # Increment operator index. # This is makes jump into the if statement (expression). current_operator_index += 1 elif current_operator.type == OperatorType.END: # END operator. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), \ "Type error, parser level error?" # Jump to the operator operand. # As this is END operator, we should have index + 1, index! current_operator_index = current_operator.operand elif current_operator.type == OperatorType.DEFINE: # DEFINE Operator. # Error. assert False, "Got definition operator at runner stage, parser level error?" elif current_operator.type == OperatorType.MEMORY: assert False, "Got memory operator at runner stage, parser level error?" else: # If unknown operator type. assert False, "Unknown operator type! (How?)" except IndexError: # Should be stack error. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", f"Stack error! This is may caused by popping from empty stack!" f"Do you used {EXTRA_DIRECTIVE}LINTER_SKIP directive? IndexError, (From: " f"{current_operator.token.text})", True) except KeyboardInterrupt: # If stopped. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, current_operator.token.location, "Error", "Interpretation was stopped by keyboard interrupt!", True) if len(memory_execution_stack) > 0: # If there is any in the stack. # Error message. gofra.core.errors.message_verbosed(Stage.RUNNER, ("__runner__", 1, 1), "Warning", "Stack is not empty after running the interpretation!") # Linter. def linter_type_check(source: Source): """ Linter static type check. """ # TODO: IF/WHILE anylyse fixes. # Check that there is no new operator type. assert len(OperatorType) == 10, "Please update implementation after adding new OperatorType!" # Check that there is no new instrinsic type. assert len(Intrinsic) == 30, "Please update implementation after adding new Intrinsic!" # Create empty linter stack. memory_linter_stack = Stack() # Get source operators count. operators_count = len(source.operators) # Current operator index from the source. current_operator_index = 0 # Check that there is more than zero operators in context. if operators_count == 0: # If there is no operators in the final parser context. # Error. gofra.core.errors.message_verbosed(Stage.LINTER, ("__linter__", 1, 1), "Error", "There is no operators found in given file after parsing, " "are you given empty file or file without resulting operators?", True) while current_operator_index < operators_count: # While we not run out of the source operators list. # Get current operator from the source. current_operator: Operator = source.operators[current_operator_index] # Grab our operator if current_operator.type == OperatorType.PUSH_INTEGER: # PUSH INTEGER operator. # Type check. assert isinstance(current_operator.operand, int), "Type error, lexer level error?" # Push operand type to the stack. memory_linter_stack.push(int) # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.PUSH_STRING: # PUSH STRING operator. # Type check. assert isinstance(current_operator.operand, str), "Type error, lexer level error?" # Push operand types to the stack. memory_linter_stack.push(int) # String size. memory_linter_stack.push(TYPE_POINTER) # String pointer. # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.MEMORY: assert False, "Got memory operator at linter stage, parser level error?" elif current_operator.type == OperatorType.INTRINSIC: # Intrinsic operator. if current_operator.operand == Intrinsic.PLUS: # Intristic plus operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.DIVIDE: # Intristic divide operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.MODULUS: # Intristic modulus operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.MINUS: # Intristic minus operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.MULTIPLY: # Intristic multiply operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.EQUAL: # Intristic equal operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.NOT_EQUAL: # Intristic not equal operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.LESS_THAN: # Intristic less than operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.GREATER_THAN: # Intristic greater than operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.LESS_EQUAL_THAN: # Intristic less equal than operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.GREATER_EQUAL_THAN: # Intristic greater equal than operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.SWAP: # Intristic swap operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Push swapped to the stack. memory_linter_stack.push(operand_a) memory_linter_stack.push(operand_b) elif current_operator.operand == Intrinsic.COPY: # Intristic copy operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Push copy to the stack. memory_linter_stack.push(operand_a) memory_linter_stack.push(operand_a) elif current_operator.operand == Intrinsic.COPY2: # Intristic copy2 operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Push copy to the stack. memory_linter_stack.push(operand_b) memory_linter_stack.push(operand_a) memory_linter_stack.push(operand_b) memory_linter_stack.push(operand_a) elif current_operator.operand == Intrinsic.COPY_OVER: # Intristic copy over operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Push copy to the stack. memory_linter_stack.push(operand_a) memory_linter_stack.push(operand_a) memory_linter_stack.push(operand_b) elif current_operator.operand == Intrinsic.DECREMENT: # Intristic decrement operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.INCREMENT: # Intristic increment operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.FREE: # Intristic free operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Free operand. memory_linter_stack.pop() elif current_operator.operand == Intrinsic.SHOW: # Intristic show operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) elif current_operator.operand == Intrinsic.MEMORY_WRITE: # Intristic memory write operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_POINTER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) elif current_operator.operand == Intrinsic.MEMORY_WRITE4BYTES: # Intristic memory write 4 bytes operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_POINTER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Check type. if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) elif current_operator.operand == Intrinsic.MEMORY_READ4BYTES: # Intristic memory read 4 bytes operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_POINTER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.MEMORY_READ: # Intristic memory read operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_POINTER: cli_argument_type_error_message(current_operator, 2, operand_a, int, True) # Push to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.MEMORY_SHOW_CHARACTERS: # Intristic memory show bytes as chars operator. # Check stack size. if len(memory_linter_stack) < 2: cli_no_arguments_error_message(current_operator, True) # Get both operands. operand_a = memory_linter_stack.pop() operand_b = memory_linter_stack.pop() # Check type. if operand_a != TYPE_POINTER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) if operand_b != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 2, operand_b, int, True) elif current_operator.operand == Intrinsic.MEMORY_POINTER: # Intristic memory pointer operator. # Push pointer to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.NULL: # Intristic null operator. # Push pointer to the stack. memory_linter_stack.push(int) elif current_operator.operand == Intrinsic.IO_READ_STRING: # I/O read string operator. # Push operand types to the stack. memory_linter_stack.push(int) # String size. memory_linter_stack.push(TYPE_POINTER) # String pointer. elif current_operator.operand == Intrinsic.IO_READ_INTEGER: # I/O read integer operator. # Push operand types to the stack. memory_linter_stack.push(int) # Integer. else: # If unknown instrinsic type. assert False, "Got unexpected / unknon intrinsic type! (How?)" # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.IF: # IF operator. # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Increment operator index. # This is makes jump into the if branch. current_operator_index += 1 elif current_operator.type == OperatorType.ELSE: # ELSE operator. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Jump to the operator operand. # As this is ELSE operator, we should have index + 1, index! current_operator_index = current_operator.operand elif current_operator.type == OperatorType.WHILE: # WHILE operator. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Increase operator index. current_operator_index += 1 elif current_operator.type == OperatorType.DO: # DO operator. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Check stack size. if len(memory_linter_stack) < 1: cli_no_arguments_error_message(current_operator, True) # Get operand. operand_a = memory_linter_stack.pop() # Check type. if operand_a != TYPE_INTEGER: cli_argument_type_error_message(current_operator, 1, operand_a, int, True) # Endif jump operator index. end_jump_operator_index = source.operators[current_operator.operand].operand # Type check. assert isinstance(end_jump_operator_index, OPERATOR_ADDRESS), "Type error, parser level error?" # Jump to the END from WHILE. current_operator_index = int(end_jump_operator_index) elif current_operator.type == OperatorType.END: # END operator. # Type check. assert isinstance(current_operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Jump to the operator operand. # As this is END operator, we should have index + 1, index! current_operator_index = current_operator.operand elif current_operator.type == OperatorType.DEFINE: assert False, "Got definition operator at linter stage, parser level error?" else: assert False, "Got unexpected / unknon operator type! (How?)" if len(memory_linter_stack) != 0: # If there is any in the stack. # Get last operator token location. location: LOCATION = source.operators[current_operator_index - 1].token.location # Error message. gofra.core.errors.message_verbosed(Stage.LINTER, location, "Error", f"Stack is not empty at the type checking stage! " f"(There is {len(memory_linter_stack)} elements when should be 0)", True) # Source. def load_source_from_file(file_path: str) -> tuple[Source, ParserContext]: """ Load file, then return ready source and context for it. (Tokenized, Parsed, Linted). """ # Read source lines. source_file, _ = gofra.core.other.try_open_file(file_path, "r", True, encoding="UTF-8") source_lines = source_file.readlines() source_file.close() parser_context = ParserContext() # Tokenize. lexer_tokens = list(lexer_tokenize(source_lines, file_path)) if len(lexer_tokens) == 0: gofra.core.errors.message_verbosed(Stage.LEXER, (basename(file_path), 1, 1), "Error", "There is no tokens found in given file, are you given empty file?", True) # Parse. parser_parse(lexer_tokens, parser_context, file_path) # Create source from context. parser_context_source = Source(parser_context.operators) # Type check. assert isinstance(parser_context.directive_linter_skip, bool), "Expected linter skip directive to be boolean." if not parser_context.directive_linter_skip: linter_type_check(parser_context_source) return parser_context_source, parser_context # Python. def python_generate(source: Source, context: ParserContext, path: str): """ Generates graph from the source. """ # Check that there is no changes in operator type or intrinsic. assert len(OperatorType) == 10, "Please update implementation for python generation after adding new OperatorType!" assert len(Intrinsic) == 28, "Please update implementation for python generationg after adding new Intrinsic!" def __update_indent(value: int): """ Updates indent by given value. """ # Update level. nonlocal current_indent_level # type: ignore current_indent_level += value # Update indent string. nonlocal current_indent # type: ignore current_indent = "\t" * current_indent_level def __write_footer(): """ Write footer. """ # Trick. nonlocal current_bytearray_should_written, current_string_buffer_should_written if current_bytearray_should_written or current_string_buffer_should_written: current_string_buffer_should_written = True current_bytearray_should_written = True if current_bytearray_should_written: # If we should write bytearray block. # Allocate bytearray. current_lines.insert(current_bytearray_insert_position, f"memory = bytearray(" f"{context.memory_bytearray_size} + strings_size" f")") # Comment allocation. if not directive_skip_comments: current_lines.insert(current_bytearray_insert_position, "# Allocate memory buffer (memory + strings)" "(As you called memory operators): \n") # Warn user about using byte operations in python compilation. gofra.core.errors.message("Warning", "YOU ARE USING MEMORY OPERATIONS, THAT MAY HAVE EXPLICIT BEHAVIOUR! " "IT IS MAY HARDER TO CATCH ERROR IF YOU RUN COMPILED VERSION " "(NOT INTERPRETATED)") if current_string_buffer_should_written: # If we should write string buffer block. # Push string function. current_lines.insert(current_string_buffer_insert_position, "\ndef stack_push_string(stack_str, op_index): \n" "\tstr_len = len(stack_str)\n" "\tif op_index not in strings_pointers:\n" "\t\tglobal strings_size_pointer\n" "\t\tptr = strings_size + 1 + strings_size_pointer\n" "\t\tstrings_pointers[op_index] = ptr\n" "\t\tmemory[ptr: ptr + str_len] = stack_str\n" "\t\tstrings_size_pointer += str_len\n" "\t\tif str_len > strings_size:\n" "\t\t\tprint(\"" "ERROR! Trying to push string, " "when there is memory string buffer overflow! " "Try use memory size directive, to increase size!" "\")\n" "\t\t\texit(1)\n" "\tfsp = strings_pointers[op_index]\n" "\treturn fsp, str_len\n" ) # Allocate string buffer. current_lines.insert(current_string_buffer_insert_position, f"strings_pointers = dict()\n" f"strings_size = {context.memory_bytearray_size}\n" f"strings_size_pointer = 0") # Comment allocation. if not directive_skip_comments: current_lines.insert(current_string_buffer_insert_position, "# Allocate strings buffer " "(As you used strings): \n") def __write_header(): """ Writes header. """ # Write auto-generated mention. if not directive_skip_comments: current_lines.append("# This file is auto-generated by Gofra-Language python subcommand! \n\n") # Write stack initialization element. if not directive_skip_comments: current_lines.append("# Allocate stack (As is Gofra is Stack-Based Language): \n") current_lines.append("stack = []\n") # Update bytearray insert position. nonlocal current_bytearray_insert_position current_bytearray_insert_position = len(current_lines) # Update string buffer insert position. nonlocal current_string_buffer_insert_position current_string_buffer_insert_position = len(current_lines) # Write file and expression comments. if not directive_skip_comments: current_lines.append("\n\n") current_lines.append(f"# File ({basename(path)}): \n") current_lines.append(f"# Expressions: \n") # Update while insert position. nonlocal current_while_insert_position current_while_insert_position = len(current_lines) # Write source header. if not directive_skip_comments: current_lines.append("# Source:\n") def __write_operator_intrinsic(operator: Operator): """ Writes default operator (non-intrinsic). """ # Check that this is intrinsic operator. assert operator.type == OperatorType.INTRINSIC, "Non-INTRINSIC operators " \ "should be written using __write_operator()!" # Type check. assert isinstance(current_operator.operand, Intrinsic), f"Type error, parser level error?" nonlocal current_bytearray_should_written # type: ignore if current_operator.operand == Intrinsic.PLUS: # Intristic plus operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_b + operand_a)") elif current_operator.operand == Intrinsic.MINUS: # Intristic minus operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_b - operand_a)") elif current_operator.operand == Intrinsic.INCREMENT: # Intristic increment operator. # Write operator data. write("stack.append(stack.pop() + 1)") elif current_operator.operand == Intrinsic.DECREMENT: # Intristic decrement operator. # Write operator data. write("stack.append(stack.pop() - 1)") elif current_operator.operand == Intrinsic.MULTIPLY: # Intristic multiply operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_b * operand_a)") elif current_operator.operand == Intrinsic.DIVIDE: # Intristic divide operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_b // operand_a)") elif current_operator.operand == Intrinsic.MODULUS: # Intristic modulus operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write(f"stack.append(int(operand_b % operand_a))") # TODO: Check %, remove or left int() elif current_operator.operand == Intrinsic.EQUAL: # Intristic equal operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(int(operand_b == operand_a))") elif current_operator.operand == Intrinsic.GREATER_EQUAL_THAN: # Intristic greater equal than operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(int(operand_b >= operand_a))") elif current_operator.operand == Intrinsic.GREATER_THAN: # Intristic greater than operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(int(operand_b > operand_a))") elif current_operator.operand == Intrinsic.LESS_THAN: # Intristic less than operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(int(operand_b < operand_a))") elif current_operator.operand == Intrinsic.LESS_EQUAL_THAN: # Intristic less equal than operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(int(operand_b<= operand_a))") elif current_operator.operand == Intrinsic.SWAP: # Intristic swap operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_a)") write("stack.append(operand_b)") elif current_operator.operand == Intrinsic.COPY: # Intristic copy operator. # Write operator data. write("operand_a = stack.pop()") write("stack.append(operand_a)") write("stack.append(operand_a)") elif current_operator.operand == Intrinsic.SHOW: # Intristic show operator. # Write operator data. write("print(stack.pop())") elif current_operator.operand == Intrinsic.FREE: # Intristic free operator. # Write operator data. write("stack.pop()") elif current_operator.operand == Intrinsic.NOT_EQUAL: # Intristic not equal operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(int(operand_b != operand_a))") elif current_operator.operand == Intrinsic.COPY2: # Intristic copy2 operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_b)") write("stack.append(operand_a)") write("stack.append(operand_b)") write("stack.append(operand_a)") elif current_operator.operand == Intrinsic.COPY_OVER: # Intristic copy over operator. # Write operator data. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("stack.append(operand_b)") write("stack.append(operand_a)") write("stack.append(operand_b)") elif current_operator.operand == Intrinsic.MEMORY_POINTER: # Intrinsic null pointer operator. # Write bytearray block. # TODO: May be removed, but just OK. current_bytearray_should_written = True # Write operator data. write(f"stack.append({MEMORY_BYTEARRAY_NULL_POINTER})") elif current_operator.operand == Intrinsic.NULL: # Intrinsic null operator. # Write operator data. write(f"stack.append(0)") elif current_operator.operand == Intrinsic.MEMORY_WRITE: # Intrinsic memory write operator. # Write bytearray block. current_bytearray_should_written = True # Write operator data. # TODO: More checks at compiled script. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("memory[operand_b] = operand_a") elif current_operator.operand == Intrinsic.MEMORY_READ: # Intrinsic memory read operator. # Write bytearray block. current_bytearray_should_written = True # Write operator data. # TODO: More checks at compiled script. write("operand_a = stack.pop()") write("memory_byte = memory[operand_a]") write("stack.append(memory_byte)") elif current_operator.operand == Intrinsic.MEMORY_WRITE4BYTES: # Intristic memory write 4 bytes operator. # Write bytearray block. current_bytearray_should_written = True # Write operator data. # TODO: More checks at compiled script. write("operand_a = stack.pop()") write("operand_b = stack.pop()") write("memory_bytes = operand_a.to_bytes(length=4, byteorder=\"little\", signed=(operand_a < 0))") write("memory[operand_b:operand_b + 4] = memory_bytes") elif current_operator.operand == Intrinsic.MEMORY_READ4BYTES: # Intristic memory read 4 bytes operator. # Write bytearray block. current_bytearray_should_written = True # Write operator data. # TODO: More checks at compiled script. write("operand_a = stack.pop()") write("memory_bytes = int.from_bytes(memory[operand_a:operand_a + 4], byteorder=\"little\")") write("stack.append(memory_bytes)") elif current_operator.operand == Intrinsic.MEMORY_SHOW_CHARACTERS: # Intrinsic memory show as characters operator. # Write bytearray block. current_bytearray_should_written = True # Write operator data. write("memory_length = stack.pop()") write("memory_pointer = stack.pop()") write("memory_index = 0") write("while memory_index < memory_length:") write("\tmemory_byte = memory[memory_pointer + memory_index]") write("\tprint(chr(memory_byte), end=\"\")") write("\tmemory_index += 1") else: # If unknown instrinsic type. # Write node data. gofra.core.errors.message_verbosed(Stage.COMPILATOR, current_operator.token.location, "Error", f"Intrinsic `{INTRINSIC_TYPES_TO_NAME[current_operator.operand]}` " f"is not implemented for python generation!", True) def __write_operator(operator: Operator): """ Writes default operator (non-intrinsic). """ # Nonlocalise while data. nonlocal current_while_block # type: ignore nonlocal current_while_defined_name # type: ignore nonlocal current_while_comment # type: ignore # Grab our operator if operator.type == OperatorType.INTRINSIC: # Intrinsic operator. # Error. assert False, "Intrinsic operators should be written using __write_operator_intrinsic()!" elif operator.type == OperatorType.PUSH_INTEGER: # PUSH INTEGER operator. # Type check. assert isinstance(operator.operand, int), "Type error, parser level error?" # Write operator data. write(f"stack.append({operator.operand})") elif operator.type == OperatorType.PUSH_STRING: # PUSH STRING operator. # Type check. assert isinstance(operator.operand, str), "Type error, parser level error?" # Write operator data. # TODO: Warn using `current_operator_index` write(f"s_str, s_len = stack_push_string({operator.operand.encode('UTF-8')}, {current_operator_index})") write(f"stack.append(s_str)") write(f"stack.append(s_len)") # Write strings buffer block. nonlocal current_string_buffer_should_written current_string_buffer_should_written = True # And memory. nonlocal current_bytearray_should_written current_bytearray_should_written = True elif operator.type == OperatorType.IF: # IF operator. # Type check. assert isinstance(operator.operand, OPERATOR_ADDRESS), f"Type error, parser level error?" # Write operator data. write("if stack.pop() != 0:") # Increase indent level. __update_indent(1) elif operator.type == OperatorType.WHILE: # WHILE operator. # Type check. assert isinstance(operator.operand, OPERATOR_ADDRESS), f"Type error, parser level error?" # Remember name, so we can write "def" at the top of the source in current_while_insert_position. current_while_defined_name = f"while_expression_ip{current_operator_index}" # Remember comment for while function block. current_while_comment = comment # Write operator data. current_lines.append(f"{current_indent}{comment[2:]}\n" f"{current_indent}while {current_while_defined_name}()") # Set that we in while expression. current_while_block = True elif operator.type == OperatorType.DO: # DO operator. # Type check. assert isinstance(operator.operand, OPERATOR_ADDRESS), f"Type error, parser level error?" if current_while_block: # If we close while. # Current insert position for lines. # (As we don`t want to reset current_while_insert_position) while_block_insert_position = current_while_insert_position # Insert header. function_comment = "" if directive_skip_comments else f"\t# -- Should be called from WHILE.\n" current_lines.insert(while_block_insert_position, f"def {current_while_defined_name}():{current_while_comment}\n" + function_comment) for while_stack_line in current_while_lines: # Iterate over while stack lines. # Increment. while_block_insert_position += 1 # Insert. current_lines.insert(while_block_insert_position, f"\t{while_stack_line}") # Insert return. return_comment = "" if directive_skip_comments else f" # -- Return for calling from WHILE ." current_lines.insert(while_block_insert_position + 1, f"\treturn stack.pop()" + return_comment + "\n") else: # If this is not while. # Error. gofra.core.errors.message_verbosed(Stage.COMPILATOR, operator.token.location, "Error", "Got `do`, when there is no `while` block started! " "(Parsing error?)", True) # Write operator. current_lines.append(f":{comment}\n") # Go out the while block expression. current_while_block = False # Reset current while lines list (stack). current_while_lines.clear() # Increase indent level. __update_indent(1) elif operator.type == OperatorType.ELSE: # ELSE operator. # Type check. assert isinstance(operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Write operator data. pass_comment = "" if directive_skip_comments else f" # -- Be sure that there is no empty body." current_lines.append(current_indent + f"pass{pass_comment}\n") # Decrease indent level. __update_indent(-1) # Write operator data. write("else:") # Increase indent level. __update_indent(1) elif operator.type == OperatorType.END: # END operator. # Actually, there is no END in Python. # Type check. assert isinstance(operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" # Write operator data. pass_comment = "" if directive_skip_comments else f" # -- Be sure that there is no empty body." current_lines.append(current_indent + f"pass{pass_comment}\n") # Decrease indent level. __update_indent(-1) elif operator.type == OperatorType.DEFINE: # DEFINE Operator. # Error. assert False, "Got definition operator at runner stage, parser level error?" else: # If unknown operator type. assert False, f"Got unexpected / unknon operator type! (How?)" def write(text: str): """ Writes text to file. """ if current_while_block: # If we are in loop. # Add text without indent. current_while_lines.append(text + comment + "\n") else: # Write default text. current_lines.append(current_indent + text + comment + "\n") # Indentation level. current_indent_level = 0 # Indent level for calculating. current_indent = "" # Indent string for writing. # While. current_while_block = False # If true, we are in while loop. current_while_comment = "" # While block comment to place in final expression function. current_while_defined_name = "" # While defined name for naming expression function. current_while_lines: List[str] = [] # List of while lines to write in expression function. current_while_insert_position = 0 # Position to insert while expressions blocks. # Bytearray. current_bytearray_insert_position = 0 # Position to insert bytearray block if bytearray_should_written is true. current_bytearray_should_written = False # If true, will warn about memory usage and write bytearray block. # TODO: Remove, as redundant, there is bytearray insert position above, which is same. # Strings. # Position to insert string bufer allocation block, # if current_string_buffer_should_written is true. current_string_buffer_insert_position = 0 current_string_buffer_should_written = False # If true, will write string buffer allocation block. # Should we skip comments. directive_skip_comments = context.directive_python_comments_skip # Get source operators count. operators_count = len(source.operators) # Current operator index from the source. current_operator_index = 0 # Lines. current_lines: List[str] = [] # Check that there is more than zero operators in context. if operators_count == 0: # If there is no operators in the final parser context. # Error. gofra.core.errors.message_verbosed(Stage.COMPILATOR, (basename(path), 1, 1), "Error", "There is no operators found in given file after parsing, " "are you given empty file or file without resulting operators?", True) # Open file. file, _ = gofra.core.other.try_open_file(path + ".py", "w", True) # Write header. __write_header() while current_operator_index < operators_count: # While we not run out of the source operators list. # Get current operator from the source. current_operator: Operator = source.operators[current_operator_index] # Make comment string. location: LOCATION = current_operator.token.location location_string: str = f"Line {location[1]}, Row {location[2]}" comment = "" if directive_skip_comments else f" # Token: {current_operator.token.text} [{location_string}]" if current_operator.type == OperatorType.INTRINSIC: # If this is intrinsic. # Write intrinsic operator. __write_operator_intrinsic(current_operator) else: # If this is other operator. # Write default operator. __write_operator(current_operator) # Increment current index. current_operator_index += 1 # Write footer. __write_footer() if len(current_while_lines) != 0: # If we have something at the while lines stack. # Error. gofra.core.errors.message_verbosed(Stage.COMPILATOR, source.operators[-1].token.location, "Error", "While lines stack is not empty after running python generation! " "(Compilation error?)", True) # Write lines in final file. for current_stack_line in current_lines: file.write(current_stack_line) # Close file. file.close() # Bytecode. def compile_bytecode(source: Source, _, path: str): """ Compiles operators to bytecode. """ # Check that there is no changes in operator type or intrinsic. assert len(OperatorType) == 10, \ "Please update implementation for bytecode compilation after adding new OperatorType!" assert len(Intrinsic) == 28, "Please update implementation for bytecode compilation after adding new Intrinsic!" def __write_operator_intrinsic(operator: Operator): """ Writes default operator (non-intrinsic). """ # Check that this is intrinsic operator. assert operator.type == OperatorType.INTRINSIC, "Non-INTRINSIC operators " \ "should be written using __write_operator()!" # Type check. assert isinstance(current_operator.operand, Intrinsic), f"Type error, parser level error?" if current_operator.operand in INTRINSIC_TO_BYTECODE_OPERATOR: # Intristic operator. # Write operator data. write(INTRINSIC_TO_BYTECODE_OPERATOR[current_operator.operand]) else: gofra.core.errors.message_verbosed(Stage.COMPILATOR, current_operator.token.location, "Error", f"Intrinsic `{INTRINSIC_TYPES_TO_NAME[current_operator.operand]}` " f"is not implemented for bytecode compilation!", True) def __write_operator(operator: Operator): """ Writes default operator (non-intrinsic). """ # Grab our operator if operator.type == OperatorType.INTRINSIC: assert False, "Intrinsic operators should be written using __write_operator_intrinsic()!" elif operator.type == OperatorType.PUSH_INTEGER: assert isinstance(operator.operand, int), "Type error, parser level error?" # Write operator data. write(OPERATOR_TYPE_TO_BYTECODE_OPERATOR[OperatorType.PUSH_INTEGER]) write(f"{operator.operand}") elif operator.type == OperatorType.PUSH_STRING: assert isinstance(operator.operand, str), "Type error, parser level error?" gofra.core.errors.message("Error", "Strings is not implemented yet in the bytecode!", True) elif operator.type == OperatorType.IF: assert isinstance(operator.operand, OPERATOR_ADDRESS), f"Type error, parser level error?" gofra.core.errors.message("Error", "Conditional is not implemented yet in the bytecode!", True) elif operator.type == OperatorType.WHILE: assert isinstance(operator.operand, OPERATOR_ADDRESS), f"Type error, parser level error?" gofra.core.errors.message("Error", "Conditional is not implemented yet in the bytecode!", True) elif operator.type == OperatorType.DO: assert isinstance(operator.operand, OPERATOR_ADDRESS), f"Type error, parser level error?" gofra.core.errors.message("Error", "Conditional is not implemented yet in the bytecode!", True) elif operator.type == OperatorType.ELSE: assert isinstance(operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" gofra.core.errors.message("Error", "Conditional is not implemented yet in the bytecode!", True) elif operator.type == OperatorType.END: assert isinstance(operator.operand, OPERATOR_ADDRESS), "Type error, parser level error?" gofra.core.errors.message("Error", "Conditional is not implemented yet in the bytecode!", True) elif operator.type == OperatorType.DEFINE: assert False, "Got definition operator at runner stage, parser level error?" else: # If unknown operator type. assert False, f"Got unexpected / unknon operator type! (How?)" # WIP. current_lines.append("\n") def write(text: str): """ Writes text to file. """ current_lines.append(text + " ") # Get source operators count. operators_count = len(source.operators) # Current operator index from the source. current_operator_index = 0 # Lines. current_lines: List[str] = [] # Check that there is more than zero operators in context. if operators_count == 0: # If there is no operators in the final parser context. gofra.core.errors.message_verbosed(Stage.COMPILATOR, (basename(path), 1, 1), "Error", "There is no operators found in given file after parsing, " "are you given empty file or file without resulting operators?", True) # Open file. bytecode_path = path + ".gofbc" file, _ = gofra.core.other.try_open_file(bytecode_path, "w", True) while current_operator_index < operators_count: # While we not run out of the source operators list. # Get current operator from the source. current_operator: Operator = source.operators[current_operator_index] if current_operator.type == OperatorType.INTRINSIC: # If this is intrinsic. # Write intrinsic operator. __write_operator_intrinsic(current_operator) else: # If this is other operator. # Write default operator. __write_operator(current_operator) # Increment current index. current_operator_index += 1 # Write lines in final file. for current_stack_line in current_lines: file.write(current_stack_line) # Close file. file.close() return bytecode_path def execute_bytecode(path: str): """ Executes bytecode file. """ # Check that there is no changes in operator type or intrinsic. assert len(OperatorType) == 10, "Please update implementation for bytecode execution after adding new OperatorType!" assert len(Intrinsic) == 28, "Please update implementation for bytecode execution after adding new Intrinsic!" if not path.endswith(".gofbc"): gofra.core.errors.message("Error", f"File \"{path}\" should have extension `.gofbc` for being executed!", True) return # Open file. file, _ = gofra.core.other.try_open_file(path, "r", True) # Tokenize operator tokens. bc_op_tokens = [] for line in file.readlines(): op_tokens = line.split(" ") for op_token in op_tokens: if op_token == "\n" or op_token.replace(" ", "") == "": continue bc_op_tokens.append(op_token) # New context. parser_context = ParserContext() # Convert OPs to interpretator operators. current_bc_operator_index = 0 while current_bc_operator_index < len(bc_op_tokens): bc_operator = bc_op_tokens[current_bc_operator_index] if bc_operator == OPERATOR_TYPE_TO_BYTECODE_OPERATOR[OperatorType.PUSH_INTEGER]: parser_context.operators.append(Operator( OperatorType.PUSH_INTEGER, Token(TokenType.BYTECODE, bc_operator, (path, -1, -1), bc_operator), int(bc_op_tokens[current_bc_operator_index + 1]) )) current_bc_operator_index += 2 continue else: if bc_operator in BYTECODE_OPERATOR_NAMES_TO_INTRINSIC: parser_context.operators.append(Operator( OperatorType.INTRINSIC, Token(TokenType.BYTECODE, bc_operator, (path, -1, -1), bc_operator), BYTECODE_OPERATOR_NAMES_TO_INTRINSIC[bc_operator] )) else: gofra.core.errors.message_verbosed(Stage.PARSER, ("Bytecode", -1, -1), "Error", f"Got unexpected bytecode instruction - {repr(bc_operator)}!", True) current_bc_operator_index += 1 continue # Run. parser_context_source = Source(parser_context.operators) interpretator_run(parser_context_source) # Close file. file.close() # CLI. def cli_no_arguments_error_message(operator: Operator, force_exit: bool = False): """ Shows no arguments passed error message to the CLI. """ if operator.type == OperatorType.INTRINSIC: # Intrinsic Operator. # Type check. assert isinstance(operator.operand, Intrinsic), "Type error, parser level error?" # Error gofra.core.errors.message_verbosed(Stage.LINTER, operator.token.location, "Error", f"`{INTRINSIC_TYPES_TO_NAME[operator.operand]}` " f"intrinsic should have more arguments at the stack, but it was not founded!") elif operator.type == OperatorType.IF: # IF Operator. # Error gofra.core.errors.message_verbosed(Stage.LINTER, operator.token.location, "Error", "`IF` operator should have 1 argument at the stack, but it was not found!") elif operator.type == OperatorType.DO: # DO Operator. # Error gofra.core.errors.message_verbosed(Stage.LINTER, operator.token.location, "Error", "`DO` operator should have 1 argument at the stack, but it was not found!") else: # Unknown operator. assert False, "Tried to call no_arguments_error_message() " \ "for operator that does not need arguments! (Type checker error?)" # If we should force exit. if force_exit: exit(1) def cli_argument_type_error_message(operator: Operator, argument_index: int, actual_type: type, expected_type: type, force_exit: bool = False): """ Shows unexpected argument type passed error message to the CLI. """ if operator.type == OperatorType.INTRINSIC: assert isinstance(operator.operand, Intrinsic), "Type error, parser level error?" gofra.core.errors.message_verbosed(Stage.LINTER, operator.token.location, "Error", f"`{INTRINSIC_TYPES_TO_NAME[operator.operand]}` " f"intrinsic expected {argument_index} argument " f"to be with type {expected_type}, but it has type {actual_type}!") elif operator.type == OperatorType.IF: gofra.core.errors.message_verbosed(Stage.LINTER, operator.token.location, "Error", f"`IF` operator expected type {expected_type} but got {actual_type}!") elif operator.type == OperatorType.DO: gofra.core.errors.message_verbosed(Stage.LINTER, operator.token.location, "Error", f"`DO` operator expected type {expected_type} but got {actual_type}!") else: assert False, "Tried to call cli_argument_type_error_message() " \ "for unknown operator! (Type checker error?)" if force_exit: exit(1) def cli_validate_argument_vector(argument_vector: List[str]) -> List[str]: """ Validates CLI argv (argument vector) """ # Check that ther is any in the ARGV. assert len(argument_vector) > 0, "There is no source (mspl.py) file path in the ARGV" # Get argument vector without source(mspl.py) path. argument_runner_filename: str = argument_vector[0] argument_vector = argument_vector[1:] # Validate ARGV. if len(argument_vector) == 0: # If there is no arguments. # Message. gofra.systems.cli.usage_message(argument_runner_filename) gofra.core.errors.message("Error", "Please pass file path to work with (.gof or .gofbc ~)", True) elif len(argument_vector) == 1: # Just one argument. if argument_vector[0] != "help": # If this is not help. # Message. gofra.systems.cli.usage_message(argument_runner_filename) gofra.core.errors.message("Error", "Please pass subcommand after the file path!", True) # Show usage. gofra.systems.cli.usage_message(argument_runner_filename) # Exit. exit(0) # Return path as source file and help (argv[0]). return ["", argument_vector[0], ""] elif len(argument_vector) == 2: # Expected ARGV length. # All ok. return [*argument_vector, ""] elif len(argument_vector) == 3: # If this is may silent argument. if argument_vector[2] != "-silent": # If silent. # Message. gofra.systems.cli.usage_message(argument_runner_filename) gofra.core.errors.message("Error", "Unexpected arguments!", True) # Return final ARGV. return argument_vector def cli_entry_point(): """ Entry point for the CLI. """ # Get and check size of cli argument vector. cli_argument_vector = cli_validate_argument_vector(argv) assert len(cli_argument_vector) == 3, "Got unexpected size of argument vector." # CLI Options. cli_source_path, cli_subcommand, cli_silent = cli_argument_vector cli_silent: bool = bool(cli_silent == "-silent") # Welcome message. if not cli_silent: gofra.systems.cli.welcome_message() # Load source and check size of it. loaded_file = None if cli_subcommand in ("run", "graph", "python", "dump", "compile"): loaded_file = load_source_from_file(cli_source_path) assert len(loaded_file) == 2, "Got unexpected data from loaded file." if cli_subcommand == "run": # If this is interpretate subcommand. cli_source, cli_context = loaded_file interpretator_run(cli_source, cli_context.memory_bytearray_size) # Message. if not cli_silent: print(f"[Info] File \"{basename(cli_source_path)}\" was interpreted!") elif cli_subcommand == "graph": # If this is graph subcommand. # Get source from loaded file. cli_source, _ = loaded_file # Generate graph file. gofra.systems.graph.write(cli_source, cli_source_path) # Message. if not cli_silent: print(f"[Info] .dot file \"{basename(cli_source_path)}.dot\" generated!") elif cli_subcommand == "python": # If this is python subcommand. # Get source and context from loaded file. cli_source, cli_context = loaded_file # Generate python file. python_generate(cli_source, cli_context, cli_source_path) # Message. if not cli_silent: print(f"[Info] .py file \"{basename(cli_source_path)}.py\" generated!") elif cli_subcommand == "dump": # If this is dump subcommand. # Get source from loaded file. cli_source, _ = loaded_file # Dump print. gofra.systems.dump.dump(cli_source.operators) # Message. if not cli_silent: print(f"[Info] File \"{basename(cli_source_path)}\" was dump printed!") elif cli_subcommand == "compile": # If this is compile subcommand. # Get source from loaded file. cli_source, cli_context = loaded_file # Compile. bytecode_path = compile_bytecode(cli_source, cli_context, cli_source_path) # Message. if not cli_silent: print(f"[Info] File \"{basename(cli_source_path)}\" was compiled to \"{basename(bytecode_path)}\"!") elif cli_subcommand == "execute": # If this is execute subcommand. # Execute. execute_bytecode(cli_source_path) # Message. if not cli_silent: print(f"[Info] File \"{basename(cli_source_path)}\" was executed!") else: # If unknown subcommand. # Message. gofra.systems.cli.usage_message(__file__) gofra.core.errors.message("Error", f"Unknown subcommand `{cli_subcommand}`!") if __name__ == "__main__": cli_entry_point()
[ 37811, 198, 220, 220, 220, 8774, 1514, 69, 430, 8300, 3303, 2723, 2438, 13, 198, 198, 37811, 198, 198, 834, 9800, 834, 796, 366, 42, 343, 359, 10511, 418, 377, 2488, 74, 343, 359, 23548, 418, 377, 1, 198, 834, 43085, 834, 796, 366, 36393, 1, 198, 198, 6738, 19720, 1330, 35986, 198, 6738, 28686, 13, 6978, 1330, 1615, 12453, 198, 6738, 25064, 1330, 1822, 85, 198, 198, 11748, 467, 69, 430, 198, 6738, 467, 69, 430, 13, 7295, 13, 38537, 1330, 1635, 198, 6738, 467, 69, 430, 13, 7295, 13, 25558, 1330, 23881, 628, 198, 2, 8779, 41, 1581, 39410, 7473, 11096, 20832, 4877, 13, 198, 2, 770, 2438, 318, 407, 1006, 529, 1850, 11, 198, 2, 3058, 314, 716, 1762, 319, 1006, 529, 3255, 290, 26021, 656, 262, 467, 69, 430, 8265, 11, 198, 2, 612, 318, 257, 1256, 286, 3404, 11, 326, 481, 307, 302, 32931, 13, 198, 198, 2, 4418, 11, 765, 284, 910, 326, 18022, 8189, 318, 407, 5201, 11, 290, 10794, 481, 307, 198, 2, 11513, 284, 467, 69, 430, 13, 7295, 13, 14761, 326, 481, 307, 1057, 18022, 8189, 329, 898, 11, 198, 2, 355, 5387, 10794, 2446, 357, 361, 345, 765, 284, 779, 327, 4880, 16990, 543, 318, 743, 407, 307, 5201, 635, 1865, 11, 198, 2, 766, 326, 3740, 1378, 12567, 13, 785, 14, 70, 1659, 1373, 648, 14, 14761, 34729, 628, 198, 2, 17210, 263, 13, 628, 198, 4299, 31191, 263, 62, 30001, 1096, 7, 6615, 25, 7343, 58, 2536, 4357, 2393, 62, 8000, 25, 965, 8, 4613, 35986, 58, 30642, 11, 6045, 11, 6045, 5974, 198, 220, 220, 220, 37227, 29130, 4340, 3951, 656, 1351, 286, 262, 47365, 13, 37227, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 11241, 2099, 13, 198, 220, 220, 220, 6818, 18896, 7, 30642, 6030, 8, 6624, 718, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 29130, 6030, 2474, 628, 220, 220, 220, 1303, 3497, 262, 1615, 12453, 13, 198, 220, 220, 220, 2393, 62, 8000, 796, 1615, 12453, 7, 7753, 62, 8000, 8, 628, 220, 220, 220, 1303, 9236, 1627, 6376, 13, 198, 220, 220, 220, 1459, 62, 1370, 62, 9630, 796, 657, 628, 220, 220, 220, 1303, 3497, 3951, 954, 13, 198, 220, 220, 220, 3951, 62, 9127, 796, 18896, 7, 6615, 8, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 517, 621, 6632, 3951, 13, 198, 220, 220, 220, 611, 3951, 62, 9127, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 645, 3951, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 2538, 55, 1137, 11, 357, 7753, 62, 8000, 11, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 3951, 1043, 287, 262, 1813, 2393, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 533, 345, 1813, 6565, 2393, 35379, 6407, 8, 628, 220, 220, 220, 981, 1459, 62, 1370, 62, 9630, 1279, 3951, 62, 9127, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 26304, 625, 3951, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1627, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 796, 3951, 58, 14421, 62, 1370, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 9938, 717, 1729, 12, 13200, 1149, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 26000, 4182, 7, 14421, 62, 1370, 11, 657, 11, 37456, 1149, 25, 407, 1149, 13, 747, 10223, 28955, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 1627, 4129, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 62, 13664, 796, 18896, 7, 14421, 62, 1370, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 5633, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 796, 657, 628, 220, 220, 220, 220, 220, 220, 220, 981, 1459, 62, 26000, 4182, 62, 9630, 1279, 1459, 62, 1370, 62, 13664, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 40806, 378, 625, 1627, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 262, 4067, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 24886, 796, 357, 7753, 62, 8000, 11, 1459, 62, 1370, 62, 9630, 1343, 352, 11, 1459, 62, 26000, 4182, 62, 9630, 1343, 352, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 1370, 58, 14421, 62, 26000, 4182, 62, 9630, 60, 6624, 27489, 3861, 62, 38019, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1392, 2095, 9577, 24620, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 12901, 286, 262, 5721, 886, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 357, 51, 14992, 284, 1064, 9605, 9577, 9, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 26000, 4182, 7, 14421, 62, 1370, 11, 1459, 62, 26000, 4182, 62, 9630, 1343, 352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 1149, 25, 1149, 6624, 27489, 3861, 62, 38019, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 18189, 18896, 7, 14421, 62, 1370, 8, 393, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 58, 14421, 62, 26000, 4182, 62, 437, 62, 9630, 60, 14512, 27489, 3861, 62, 38019, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1392, 407, 27489, 3861, 62, 38019, 393, 7074, 1459, 1627, 4129, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 2538, 55, 1137, 11, 1459, 62, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 555, 20225, 2095, 18875, 13, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5211, 345, 16453, 284, 1295, 4600, 90, 13918, 3861, 62, 38019, 92, 63, 35379, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 11241, 2420, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 62, 5239, 796, 1459, 62, 1370, 58, 14421, 62, 26000, 4182, 62, 9630, 1343, 352, 25, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 1149, 1988, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 10641, 62, 8367, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 403, 41915, 7, 14421, 62, 30001, 62, 5239, 737, 268, 8189, 7203, 48504, 12, 23, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 14421, 62, 10641, 62, 8367, 8, 14512, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 657, 393, 517, 621, 352, 3435, 24620, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 2538, 55, 1137, 11, 1459, 62, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 52, 42072, 1271, 286, 3435, 287, 262, 2095, 18875, 526, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 10049, 530, 2095, 318, 3142, 287, 2095, 18875, 1600, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8229, 2095, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7800, 29130, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 30642, 6030, 13, 38019, 2246, 5781, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2420, 28, 14421, 62, 30001, 62, 5239, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 28, 14421, 62, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 28, 14421, 62, 10641, 62, 8367, 58, 15, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9938, 717, 1729, 12, 13200, 1149, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 26000, 4182, 7, 14421, 62, 1370, 11, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 1343, 352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 1149, 25, 407, 1149, 13, 747, 10223, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 1370, 58, 14421, 62, 26000, 4182, 62, 9630, 60, 6624, 27489, 3861, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 4731, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10903, 11876, 329, 13042, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 8841, 62, 22252, 796, 13538, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 981, 1459, 62, 1370, 62, 9630, 1279, 18896, 7, 6615, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2893, 356, 836, 63, 83, 3151, 886, 286, 262, 3951, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4731, 923, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 9688, 62, 26000, 4182, 62, 9630, 796, 1459, 62, 26000, 4182, 62, 9630, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 8841, 62, 22252, 6624, 366, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 407, 923, 3597, 4731, 11876, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 416, 530, 329, 9577, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 9688, 62, 26000, 4182, 62, 9630, 15853, 18896, 7, 13918, 3861, 62, 18601, 2751, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 2067, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2329, 5552, 1627, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 796, 3951, 58, 14421, 62, 1370, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4731, 886, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 437, 62, 26000, 4182, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 8841, 62, 437, 7, 14421, 62, 1370, 11, 4731, 62, 9688, 62, 26000, 4182, 62, 9630, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 4731, 62, 437, 62, 26000, 4182, 62, 9630, 18189, 18896, 7, 14421, 62, 1370, 8, 393, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 58, 8841, 62, 437, 62, 26000, 4182, 62, 9630, 60, 14512, 27489, 3861, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1392, 886, 286, 1459, 1627, 11, 393, 407, 1043, 9605, 4731, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 1459, 1627, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 8841, 62, 22252, 15853, 1459, 62, 1370, 58, 8841, 62, 9688, 62, 26000, 4182, 62, 9630, 47715, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 30027, 290, 1445, 1306, 1627, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 9630, 796, 657, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1459, 1627, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 2457, 11876, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 8841, 62, 22252, 15853, 1459, 62, 1370, 58, 8841, 62, 9688, 62, 26000, 4182, 62, 9630, 25, 8841, 62, 437, 62, 26000, 4182, 62, 9630, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 796, 4731, 62, 437, 62, 26000, 4182, 62, 9630, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5268, 31191, 278, 4731, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 1370, 62, 9630, 18189, 18896, 7, 6615, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 7074, 1459, 3951, 4129, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 2538, 55, 1137, 11, 1459, 62, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 555, 20225, 4731, 18875, 13, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5211, 345, 16453, 284, 1295, 4600, 90, 13918, 3861, 62, 18601, 2751, 92, 63, 35379, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 30, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 1459, 62, 1370, 58, 14421, 62, 26000, 4182, 62, 9630, 60, 6624, 27489, 3861, 62, 18601, 2751, 11, 366, 30074, 1729, 4731, 9605, 2095, 2474, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 886, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 15853, 352, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 11241, 2420, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 62, 5239, 796, 1459, 62, 8841, 62, 22252, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8229, 4731, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7800, 29130, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 30642, 6030, 13, 18601, 2751, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2420, 28, 14421, 62, 30001, 62, 5239, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 28, 14421, 62, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 28, 70, 1659, 430, 13, 7295, 13, 2588, 263, 13, 403, 41915, 7, 14421, 62, 30001, 62, 5239, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9938, 717, 1729, 12, 13200, 1149, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 26000, 4182, 7, 14421, 62, 1370, 11, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 1149, 25, 407, 1149, 13, 747, 10223, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 12901, 286, 262, 5721, 886, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 26000, 4182, 7, 14421, 62, 1370, 11, 1459, 62, 26000, 4182, 62, 9630, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 1149, 25, 1149, 13, 747, 10223, 28955, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 11241, 2420, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 62, 5239, 796, 1459, 62, 1370, 58, 14421, 62, 26000, 4182, 62, 9630, 25, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9993, 10385, 11241, 18253, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 62, 41433, 796, 493, 7, 14421, 62, 30001, 62, 5239, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 11052, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 12515, 1988, 329, 18253, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 62, 5239, 287, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8229, 21179, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7800, 29130, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 30642, 6030, 13, 20373, 54, 12532, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2420, 28, 14421, 62, 30001, 62, 5239, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 28, 14421, 62, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 28, 20373, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 58, 14421, 62, 30001, 62, 5239, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1892, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 2912, 532, 2270, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 9993, 284, 4259, 1223, 588, 657, 1003, 15, 357, 23893, 407, 379, 262, 923, 8, 481, 31191, 407, 355, 815, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 62, 5239, 13, 9688, 2032, 342, 7, 13918, 3861, 62, 9858, 10979, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8229, 1573, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7800, 29130, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 30642, 6030, 13, 54, 12532, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2420, 28, 14421, 62, 30001, 62, 5239, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 28, 14421, 62, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 28, 14421, 62, 30001, 62, 5239, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 477, 12876, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8229, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7800, 29130, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 30642, 6030, 13, 12394, 7156, 1137, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2420, 28, 14421, 62, 30001, 62, 5239, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4067, 28, 14421, 62, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1988, 28, 14421, 62, 30001, 62, 41433, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9938, 717, 1729, 12, 13200, 1149, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 26000, 4182, 62, 9630, 796, 467, 69, 430, 13, 7295, 13, 2588, 263, 13, 19796, 62, 26000, 4182, 7, 14421, 62, 1370, 11, 1459, 62, 26000, 4182, 62, 437, 62, 9630, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37456, 1149, 25, 407, 1149, 13, 747, 10223, 28955, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 1459, 1627, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1370, 62, 9630, 15853, 352, 628, 198, 2, 23042, 263, 13, 198, 198, 4299, 30751, 62, 29572, 7, 83, 482, 641, 25, 7343, 58, 30642, 4357, 4732, 25, 23042, 263, 21947, 11, 3108, 25, 965, 2599, 198, 220, 220, 220, 37227, 23042, 274, 11241, 422, 31191, 263, 9, 357, 2588, 263, 62, 30001, 1096, 28955, 37227, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 10088, 2099, 13, 198, 220, 220, 220, 6818, 18896, 7, 18843, 1352, 6030, 8, 6624, 838, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 35946, 6030, 2474, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 21179, 2099, 13, 198, 220, 220, 220, 6818, 18896, 7, 9218, 4775, 8, 6624, 807, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 7383, 4775, 2474, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 11241, 2099, 13, 198, 220, 220, 220, 6818, 18896, 7, 30642, 6030, 8, 6624, 718, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 29130, 6030, 2474, 628, 220, 220, 220, 1303, 31849, 16326, 13, 198, 220, 220, 220, 17687, 62, 83, 482, 641, 25, 7343, 58, 30642, 60, 796, 1351, 7, 260, 690, 276, 7, 83, 482, 641, 4008, 628, 220, 220, 220, 1303, 45205, 13, 198, 220, 220, 220, 17336, 25, 360, 713, 58, 2536, 11, 30396, 60, 796, 8633, 3419, 198, 220, 220, 220, 9846, 25, 360, 713, 58, 2536, 11, 14059, 60, 796, 8633, 3419, 198, 220, 220, 220, 9633, 25, 360, 713, 58, 2536, 11, 35748, 60, 796, 8633, 3419, 198, 220, 220, 220, 9633, 62, 28968, 796, 657, 198, 220, 220, 220, 9846, 62, 28968, 796, 657, 628, 220, 220, 220, 611, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 357, 12093, 12453, 7, 6978, 828, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 16326, 1043, 11, 389, 345, 1813, 6565, 2393, 35379, 6407, 8, 628, 220, 220, 220, 981, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 1875, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2893, 612, 318, 597, 11241, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 25, 29130, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 54, 12532, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 30001, 13, 8367, 11, 965, 828, 366, 6030, 4049, 11, 31191, 263, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 8367, 287, 3268, 5446, 20913, 2149, 62, 45, 29559, 62, 10468, 62, 25216, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 1268, 5446, 20913, 2149, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 28, 1268, 5446, 20913, 2149, 62, 45, 29559, 62, 10468, 62, 25216, 58, 14421, 62, 30001, 13, 8367, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 5239, 287, 17336, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 49368, 6770, 16326, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 17687, 62, 83, 482, 641, 15853, 17687, 7, 4299, 50101, 58, 14421, 62, 30001, 13, 5239, 4083, 83, 482, 641, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 5239, 287, 9846, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 796, 9846, 58, 14421, 62, 30001, 13, 5239, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 28, 31673, 13, 20692, 62, 28968, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 5239, 287, 9633, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7885, 796, 9633, 58, 14421, 62, 30001, 13, 5239, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 28, 45286, 13, 20692, 62, 28968, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 5239, 13, 9688, 2032, 342, 7, 13918, 3861, 62, 17931, 23988, 9306, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 22644, 796, 1459, 62, 30001, 13, 5239, 58, 11925, 7, 13918, 3861, 62, 17931, 23988, 9306, 2599, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 22644, 6624, 366, 34509, 5781, 62, 18831, 4061, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 4732, 13, 12942, 425, 62, 2815, 353, 62, 48267, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 13470, 425, 4600, 90, 13918, 3861, 62, 17931, 23988, 9306, 18477, 12942, 425, 92, 63, 5447, 5403, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 12942, 425, 62, 2815, 353, 62, 48267, 796, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 22644, 6624, 366, 47, 56, 4221, 1340, 62, 9858, 28957, 62, 18831, 4061, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 4732, 13, 12942, 425, 62, 29412, 62, 15944, 62, 48267, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 13470, 425, 4600, 90, 13918, 3861, 62, 17931, 23988, 9306, 18477, 12942, 425, 92, 63, 5447, 5403, 40754, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 12942, 425, 62, 29412, 62, 15944, 62, 48267, 796, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 22644, 13, 9688, 2032, 342, 7203, 44, 3620, 62, 19499, 37, 62, 17513, 9328, 62, 33489, 2625, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 4940, 351, 4088, 11876, 18022, 2546, 6770, 1438, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 22644, 1988, 422, 477, 22644, 2420, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 22644, 62, 8367, 796, 22644, 58, 11925, 7203, 44, 3620, 62, 19499, 37, 62, 17513, 9328, 62, 33489, 2625, 2599, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 649, 4088, 2546, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 649, 62, 31673, 62, 1525, 83, 451, 2433, 62, 7857, 796, 493, 7, 12942, 425, 62, 8367, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 11052, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 13470, 425, 4600, 90, 13918, 3861, 62, 17931, 23988, 9306, 18477, 12942, 425, 92, 63, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 6603, 276, 12515, 2546, 4600, 90, 12942, 425, 62, 8367, 92, 63, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9794, 2546, 286, 262, 416, 83, 451, 2433, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 31673, 62, 1525, 83, 451, 2433, 62, 7857, 796, 649, 62, 31673, 62, 1525, 83, 451, 2433, 62, 7857, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 20035, 22644, 4600, 90, 13918, 3861, 62, 17931, 23988, 9306, 18477, 12942, 425, 92, 63, 1600, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 20035, 370, 12532, 4600, 90, 14421, 62, 30001, 13, 5239, 92, 47671, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 533, 345, 2051, 15803, 1223, 35379, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1392, 281, 18253, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 30001, 13, 8367, 11, 493, 828, 366, 6030, 4049, 11, 31191, 263, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 28, 14421, 62, 30001, 13, 8367, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1392, 257, 4731, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 30001, 13, 8367, 11, 965, 828, 366, 6030, 4049, 11, 31191, 263, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 47, 27143, 62, 18601, 2751, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 28, 14421, 62, 30001, 13, 8367, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 38019, 2246, 5781, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1392, 257, 2095, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 30001, 13, 8367, 11, 493, 828, 366, 6030, 4049, 11, 31191, 263, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 28, 14421, 62, 30001, 13, 8367, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 20373, 54, 12532, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1392, 257, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 16876, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 5064, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1459, 10088, 6376, 284, 262, 4732, 4088, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 31673, 62, 25558, 13, 33295, 7, 22866, 13, 46616, 62, 9630, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 12418, 41119, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 7655, 41119, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 12418, 41119, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1459, 10088, 6376, 284, 262, 4732, 4088, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 31673, 62, 25558, 13, 33295, 7, 22866, 13, 46616, 62, 9630, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 4600, 18227, 63, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 22866, 13, 31673, 62, 25558, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 2147, 319, 262, 4088, 8931, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 4598, 63, 815, 973, 706, 262, 4600, 4514, 63, 2512, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 18227, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4600, 12418, 41119, 63, 10088, 422, 262, 4088, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2512, 62, 46616, 62, 9630, 796, 4732, 13, 31673, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2512, 62, 46616, 796, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2512, 62, 46616, 13, 4906, 14512, 35946, 6030, 13, 12418, 41119, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 407, 981, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 4598, 63, 815, 973, 706, 262, 4600, 4514, 63, 2512, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 356, 3272, 35790, 7655, 41119, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 22866, 13, 46616, 62, 9630, 4083, 3575, 392, 796, 2512, 62, 46616, 62, 9630, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1459, 10088, 6376, 284, 262, 4732, 4088, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 31673, 62, 25558, 13, 33295, 7, 22866, 13, 46616, 62, 9630, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 2073, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 22866, 13, 31673, 62, 25558, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 2147, 319, 262, 4088, 8931, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 17772, 63, 815, 973, 706, 262, 4600, 361, 63, 2512, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4600, 5064, 63, 10088, 422, 262, 4088, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2512, 62, 46616, 62, 9630, 796, 4732, 13, 31673, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2512, 62, 46616, 796, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2512, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 779, 2073, 706, 262, 16876, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 2180, 16876, 815, 4391, 379, 262, 674, 10, 16, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 62, 9630, 4083, 3575, 392, 796, 4732, 13, 46616, 62, 9630, 1343, 352, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1459, 10088, 6376, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 31673, 62, 25558, 13, 33295, 7, 22866, 13, 46616, 62, 9630, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 3698, 5188, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 407, 4600, 5064, 44646, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4049, 4067, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4049, 62, 24886, 796, 2512, 62, 46616, 13, 30001, 13, 24886, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 4049, 62, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 17772, 63, 460, 691, 973, 706, 4600, 361, 63, 2512, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 10619, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 886, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 2512, 10088, 422, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2512, 62, 46616, 62, 9630, 796, 4732, 13, 31673, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2512, 62, 46616, 796, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2512, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 16876, 2512, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 10619, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 923, 16876, 2512, 10229, 284, 428, 23578, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 62, 9630, 4083, 3575, 392, 796, 4732, 13, 46616, 62, 9630, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 428, 23578, 2512, 10229, 284, 1306, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 22866, 13, 46616, 62, 9630, 4083, 3575, 392, 796, 4732, 13, 46616, 62, 9630, 1343, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 2512, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 17852, 5188, 2512, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 10619, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 4870, 2512, 357, 1532, 14, 40674, 8, 815, 4391, 284, 514, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 62, 9630, 4083, 3575, 392, 796, 4732, 13, 46616, 62, 9630, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 356, 815, 4391, 284, 262, 1306, 2292, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 22866, 13, 46616, 62, 9630, 4083, 3575, 392, 796, 4732, 13, 46616, 62, 9630, 1343, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 2512, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 8410, 2512, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 2512, 62, 46616, 13, 3575, 392, 318, 407, 6045, 11, 366, 18227, 10088, 468, 555, 2617, 1515, 392, 0, 23042, 263, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 9967, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 10088, 284, 262, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2099, 28, 18843, 1352, 6030, 13, 10619, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11241, 28, 14421, 62, 30001, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 8410, 3272, 35790, 284, 262, 7655, 41119, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 22866, 13, 46616, 62, 9630, 4083, 3575, 392, 796, 2512, 62, 46616, 13, 3575, 392, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13816, 326, 7655, 41119, 815, 4391, 287, 262, 8410, 1767, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 3575, 2024, 58, 9967, 62, 46616, 13, 3575, 392, 4083, 3575, 392, 796, 4732, 13, 46616, 62, 9630, 1343, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 12515, 356, 869, 886, 407, 706, 262, 611, 393, 2073, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4049, 4067, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4049, 62, 24886, 796, 2512, 62, 46616, 13, 30001, 13, 24886, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 4049, 62, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 437, 63, 460, 691, 1969, 4600, 361, 47671, 4600, 17772, 63, 393, 4600, 4598, 63, 2512, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4732, 13, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 7206, 29940, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 23449, 8881, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1400, 1438, 329, 6770, 318, 1813, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 13086, 63, 815, 423, 1438, 706, 262, 21179, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 4598, 345, 468, 34419, 6770, 35379, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1438, 329, 6770, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6770, 62, 3672, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 6770, 62, 3672, 13, 4906, 14512, 29130, 6030, 13, 54, 12532, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1438, 318, 407, 1573, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 6770, 62, 3672, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 13086, 63, 1438, 11, 815, 307, 286, 2099, 370, 12532, 11, 7926, 11, 475, 345, 460, 63, 83, 779, 1223, 326, 345, 1577, 355, 1438, 329, 262, 6770, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 6770, 62, 3672, 13, 5239, 287, 17336, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1541, 5447, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 6218, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 6770, 62, 3672, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 36621, 351, 1438, 23884, 373, 1541, 5447, 40754, 10352, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 17336, 58, 46758, 62, 3672, 13, 5239, 4083, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 20556, 6770, 373, 994, 9313, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 6770, 62, 3672, 13, 5239, 287, 3268, 5446, 20913, 2149, 62, 45, 29559, 62, 10468, 62, 25216, 393, 6770, 62, 3672, 13, 5239, 287, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 4277, 2378, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 6770, 62, 3672, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6090, 63, 83, 8160, 6770, 351, 3303, 5447, 1438, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13610, 9178, 649, 6770, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6770, 796, 30396, 7, 14421, 62, 30001, 13, 24886, 11, 685, 12962, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 6770, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 17336, 58, 46758, 62, 3672, 13, 5239, 60, 796, 6770, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1374, 881, 356, 2421, 5645, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2672, 62, 437, 62, 9127, 796, 657, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 981, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 1875, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 991, 16326, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 649, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 20373, 54, 12532, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1392, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 5239, 287, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 3376, 21179, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 30001, 13, 5239, 6624, 35374, 54, 12532, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 9218, 4775, 13, 10619, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 886, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2672, 62, 437, 62, 9127, 19841, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 645, 517, 2421, 886, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13707, 6770, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2270, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 36400, 589, 2672, 886, 3753, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2672, 62, 437, 62, 9127, 48185, 352, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 58, 14421, 62, 30001, 13, 5239, 60, 287, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 357, 9218, 4775, 13, 5064, 11, 7383, 4775, 13, 7206, 29940, 11, 7383, 4775, 13, 18227, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 21179, 326, 4433, 886, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 2672, 886, 954, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2672, 62, 437, 62, 9127, 15853, 352, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 58, 14421, 62, 30001, 13, 5239, 60, 6624, 7383, 4775, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1392, 2073, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2329, 1208, 355, 2073, 407, 4433, 886, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1208, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17665, 21179, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 12515, 21179, 2474, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2034, 437, 11241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6770, 13, 83, 482, 641, 13, 33295, 7, 14421, 62, 30001, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 2672, 62, 437, 62, 9127, 14512, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 991, 2672, 886, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 1858, 318, 1391, 35827, 62, 437, 62, 9127, 92, 555, 20225, 7021, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 5562, 4433, 28050, 278, 4600, 437, 63, 21179, 2641, 4600, 13086, 63, 6770, 13, 33172, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 407, 357, 14421, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 20373, 54, 12532, 290, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 30001, 13, 5239, 6624, 35374, 54, 12532, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 9218, 4775, 13, 10619, 60, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1392, 407, 886, 379, 886, 286, 6770, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 13086, 63, 815, 423, 4600, 437, 63, 379, 262, 886, 286, 6770, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 4360, 340, 373, 407, 9393, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 44, 3620, 15513, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 31673, 63, 815, 423, 1438, 706, 262, 21179, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 4598, 345, 468, 34419, 4088, 6770, 35379, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 62, 30001, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 4906, 14512, 29130, 6030, 13, 54, 12532, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 31673, 63, 1438, 11, 815, 307, 286, 2099, 370, 12532, 11, 7926, 11, 475, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 5832, 460, 63, 83, 779, 1223, 326, 345, 1577, 355, 1438, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1640, 262, 4088, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 5239, 287, 9846, 393, 1438, 62, 30001, 13, 5239, 287, 17336, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 36621, 393, 4088, 351, 1438, 1391, 3672, 62, 30001, 13, 5239, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 9776, 1541, 5447, 40754, 10352, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 5239, 287, 17336, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 17336, 58, 3672, 62, 30001, 13, 5239, 4083, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 12331, 1600, 366, 20556, 6770, 373, 994, 9313, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 14059, 4067, 989, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 5239, 287, 3268, 5446, 20913, 2149, 62, 45, 29559, 62, 10468, 62, 25216, 393, 1438, 62, 30001, 13, 5239, 287, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 4277, 2378, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6090, 63, 83, 8160, 9846, 351, 3303, 5447, 1438, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 19841, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 31673, 63, 4433, 2546, 329, 4088, 6770, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 4758, 373, 407, 1813, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 7857, 62, 30001, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 4088, 62, 7857, 62, 30001, 13, 4906, 14512, 29130, 6030, 13, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 7785, 63, 2546, 11, 815, 307, 286, 2099, 17828, 7156, 1137, 11, 7926, 11, 475, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 5832, 460, 63, 83, 779, 1223, 326, 345, 1577, 355, 2546, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1640, 262, 4088, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 45989, 12660, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13610, 9178, 649, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 3672, 796, 1438, 62, 30001, 13, 5239, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9846, 58, 31673, 62, 3672, 60, 796, 14059, 7, 31673, 62, 3672, 11, 4088, 62, 7857, 62, 30001, 13, 8367, 11, 9846, 62, 28968, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9846, 62, 28968, 15853, 4088, 62, 7857, 62, 30001, 13, 8367, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 18189, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 886, 62, 30001, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 886, 62, 30001, 13, 4906, 6624, 29130, 6030, 13, 20373, 54, 12532, 290, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 886, 62, 30001, 13, 5239, 6624, 35374, 54, 12532, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 9218, 4775, 13, 10619, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 1392, 407, 886, 379, 886, 286, 6770, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 31673, 63, 815, 423, 4600, 437, 63, 379, 262, 886, 286, 4088, 6770, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 4360, 340, 373, 407, 9393, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 30001, 13, 8367, 6624, 7383, 4775, 13, 53, 1503, 3539, 19146, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 260, 690, 276, 62, 83, 482, 641, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1459, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 7785, 63, 815, 423, 1438, 706, 262, 21179, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 4598, 345, 468, 34419, 7885, 6770, 35379, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1438, 62, 30001, 796, 17687, 62, 83, 482, 641, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 4906, 14512, 29130, 6030, 13, 54, 12532, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 7785, 63, 1438, 11, 815, 307, 286, 2099, 370, 12532, 11, 7926, 11, 475, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 5832, 460, 63, 83, 779, 1223, 326, 345, 1577, 355, 1438, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1640, 262, 7885, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 5239, 287, 9633, 393, 1438, 62, 30001, 13, 5239, 287, 17336, 393, 1438, 62, 30001, 13, 5239, 287, 9846, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 36621, 393, 7885, 351, 1438, 1391, 3672, 62, 30001, 13, 5239, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 9776, 1541, 5447, 40754, 10352, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 5239, 287, 17336, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 17336, 58, 3672, 62, 30001, 13, 5239, 4083, 24886, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 12331, 1600, 366, 20556, 6770, 373, 994, 9313, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 14059, 1220, 7885, 4067, 989, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1438, 62, 30001, 13, 5239, 287, 3268, 5446, 20913, 2149, 62, 45, 29559, 62, 10468, 62, 25216, 393, 1438, 62, 30001, 13, 5239, 287, 35374, 54, 12532, 62, 45, 29559, 62, 10468, 62, 25216, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 4277, 2378, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 1438, 62, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6090, 63, 83, 8160, 7885, 351, 3303, 5447, 1438, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13610, 9178, 649, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 7885, 62, 3672, 796, 1438, 62, 30001, 13, 5239, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9633, 58, 45286, 62, 3672, 60, 796, 35748, 7, 45286, 62, 3672, 11, 9633, 62, 28968, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9633, 62, 28968, 15853, 569, 1503, 3539, 19146, 62, 33489, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 21179, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 20035, 21179, 2099, 0, 357, 2437, 10091, 1, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 10088, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 20035, 10088, 2099, 0, 357, 2437, 10091, 1, 628, 220, 220, 220, 611, 18896, 7, 22866, 13, 31673, 62, 25558, 8, 1875, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 597, 287, 262, 8931, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4049, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 4049, 62, 46616, 796, 4732, 13, 3575, 2024, 58, 22866, 13, 31673, 62, 25558, 13, 12924, 3419, 60, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4049, 4067, 13, 198, 220, 220, 220, 220, 220, 220, 220, 4049, 62, 24886, 796, 4049, 62, 46616, 13, 30001, 13, 24886, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 4049, 62, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 3118, 20225, 2512, 19990, 90, 18224, 62, 46616, 13, 30001, 13, 5239, 92, 7879, 40754, 6407, 8, 628, 220, 220, 220, 611, 4732, 13, 12942, 425, 62, 2815, 353, 62, 48267, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 14267, 300, 3849, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 15932, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 357, 12093, 12453, 7, 6978, 828, 352, 11, 352, 828, 366, 20361, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 25113, 34509, 5781, 62, 18831, 4061, 42242, 9306, 0, 12680, 3180, 4725, 4090, 15112, 11, 37795, 13954, 17534, 7283, 2474, 8, 628, 198, 2, 48907, 1352, 13, 198, 198, 4299, 6179, 1352, 62, 5143, 7, 10459, 25, 8090, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 416, 83, 451, 2433, 62, 7857, 25, 493, 796, 35153, 15513, 62, 17513, 9328, 1503, 30631, 62, 33489, 2599, 198, 220, 220, 220, 37227, 48907, 689, 262, 2723, 13, 37227, 198, 220, 220, 220, 6818, 18896, 7, 18843, 1352, 6030, 8, 6624, 838, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 35946, 6030, 2474, 198, 220, 220, 220, 6818, 18896, 7, 5317, 81, 1040, 291, 8, 6624, 1542, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 2558, 81, 1040, 291, 2474, 628, 220, 220, 220, 1303, 13610, 6565, 8931, 13, 198, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 796, 23881, 3419, 628, 220, 220, 220, 1303, 10903, 32007, 13, 198, 220, 220, 220, 4088, 62, 8841, 62, 47809, 25, 360, 713, 58, 31054, 25633, 62, 2885, 7707, 7597, 11, 41876, 62, 16402, 41358, 60, 796, 8633, 3419, 198, 220, 220, 220, 4088, 62, 8841, 62, 7857, 796, 416, 83, 451, 2433, 62, 7857, 198, 220, 220, 220, 4088, 62, 8841, 62, 7857, 62, 79, 261, 353, 796, 657, 628, 220, 220, 220, 1303, 1439, 13369, 19943, 416, 83, 451, 2433, 13, 198, 220, 220, 220, 4088, 62, 1525, 83, 451, 2433, 796, 416, 83, 451, 2433, 7, 1525, 83, 451, 2433, 62, 7857, 1343, 4088, 62, 8841, 62, 7857, 1343, 35153, 15513, 62, 44, 3620, 1581, 11015, 62, 33489, 1343, 35153, 15513, 62, 53, 1503, 3539, 9148, 1546, 62, 33489, 8, 628, 220, 220, 220, 1303, 3497, 2723, 12879, 954, 13, 198, 220, 220, 220, 12879, 62, 9127, 796, 18896, 7, 10459, 13, 3575, 2024, 8, 628, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 657, 628, 220, 220, 220, 611, 12879, 62, 9127, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 5855, 834, 49, 4944, 21479, 834, 1600, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 12879, 1043, 287, 1813, 2393, 706, 32096, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 533, 345, 1813, 6565, 2393, 393, 2393, 1231, 7186, 12879, 35379, 6407, 8, 628, 220, 220, 220, 981, 1459, 62, 46616, 62, 9630, 1279, 12879, 62, 9127, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2893, 356, 407, 1057, 503, 286, 262, 2723, 12879, 1351, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 10088, 422, 262, 2723, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 25, 35946, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9993, 1220, 25750, 284, 651, 10059, 11361, 8563, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 18253, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 493, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1515, 392, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 14421, 62, 46616, 13, 3575, 392, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4731, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 965, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4731, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 8367, 796, 1459, 62, 46616, 13, 3575, 392, 13, 268, 8189, 7203, 48504, 12, 23, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 13664, 796, 18896, 7, 8841, 62, 8367, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 62, 9630, 407, 287, 4088, 62, 8841, 62, 47809, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 407, 1043, 4731, 287, 19171, 4731, 32007, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 17562, 11, 290, 4574, 287, 284, 262, 32007, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 29536, 25, 41876, 62, 16402, 41358, 796, 4088, 62, 8841, 62, 7857, 1343, 352, 1343, 4088, 62, 8841, 62, 7857, 62, 79, 261, 353, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 8841, 62, 47809, 58, 14421, 62, 46616, 62, 9630, 60, 796, 4731, 62, 29536, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4731, 826, 656, 262, 416, 83, 451, 2433, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 1525, 83, 451, 2433, 58, 8841, 62, 29536, 25, 4731, 62, 29536, 1343, 4731, 62, 13664, 60, 796, 4731, 62, 8367, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 1306, 17562, 416, 1459, 4731, 4129, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 8841, 62, 7857, 62, 79, 261, 353, 15853, 4731, 62, 13664, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 30343, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 4731, 62, 13664, 1875, 4088, 62, 8841, 62, 7857, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 32876, 6972, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 51, 14992, 284, 4574, 4731, 11, 618, 612, 318, 4088, 4731, 11876, 30343, 2474, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9993, 779, 4088, 2546, 22644, 11, 284, 2620, 2546, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1043, 4731, 17562, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1043, 62, 8841, 62, 29536, 796, 4088, 62, 8841, 62, 47809, 58, 14421, 62, 46616, 62, 9630, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 9275, 62, 8841, 62, 29536, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4731, 4129, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 8841, 62, 13664, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 6489, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 5556, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 2160, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 1343, 1515, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33569, 14114, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 14083, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 14083, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 3373, 1515, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33365, 6239, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 953, 23515, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 14083, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 4064, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 23678, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 20208, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 3580, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 532, 1515, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 16724, 4061, 11319, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 29162, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 35971, 541, 306, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 1635, 1515, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 36, 10917, 1847, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4961, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4961, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 6624, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 11929, 62, 36, 10917, 1847, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 407, 4961, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 407, 4961, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 14512, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 48481, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1342, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1342, 621, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 1279, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 28934, 23261, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 3744, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 3744, 621, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 1875, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 48481, 62, 36, 10917, 1847, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1342, 4961, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1342, 4961, 621, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 19841, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 28934, 23261, 62, 36, 10917, 1847, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 3744, 4961, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 3744, 4961, 621, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 600, 7, 3575, 392, 62, 65, 18189, 1515, 392, 62, 64, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 17887, 2969, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 16075, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 37245, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4866, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 17, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 17, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4866, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 62, 41983, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 625, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4866, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 41374, 2200, 10979, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 5255, 434, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 5255, 434, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 532, 352, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 30158, 2200, 10979, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 18703, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 18703, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 1343, 352, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 39274, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1479, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8099, 290, 1364, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9693, 3913, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 905, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5438, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 18564, 12709, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 3551, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 1875, 18896, 7, 31673, 62, 1525, 83, 451, 2433, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 3551, 379, 4088, 2209, 1391, 3575, 392, 62, 65, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 32876, 1666, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 5886, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1515, 392, 62, 65, 1279, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 3318, 891, 9319, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 3551, 379, 4088, 2209, 1391, 3575, 392, 62, 65, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 739, 44041, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 9203, 11125, 42501, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 1525, 83, 451, 2433, 58, 3575, 392, 62, 65, 60, 796, 1515, 392, 62, 64, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 12901, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 14059, 4049, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 357, 2502, 91, 4625, 8, 11125, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 18109, 16594, 284, 17562, 1391, 3575, 392, 62, 65, 92, 618, 612, 318, 4088, 11876, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 4480, 2546, 1391, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 38165, 9881, 31520, 1600, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 11052, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 807, 2545, 357, 16, 26327, 8, 2837, 357, 17618, 8, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 2685, 460, 691, 3994, 352, 18022, 357, 23, 1643, 8, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 1276, 307, 287, 2837, 357, 15, 11, 17759, 828, 59, 77, 4360, 345, 3804, 1271, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 64, 92, 543, 318, 407, 11414, 287, 262, 352, 18022, 2685, 0, 357, 40778, 5886, 11125, 42501, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 18564, 12709, 19, 17513, 51, 1546, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 3551, 604, 9881, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 38240, 1988, 284, 604, 9881, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 1515, 392, 62, 64, 13, 1462, 62, 33661, 7, 13664, 28, 19, 11, 18022, 2875, 2625, 31629, 1600, 4488, 16193, 3575, 392, 62, 64, 1279, 657, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 3827, 11125, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 2685, 460, 691, 3994, 604, 18022, 357, 2624, 1643, 8, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 1276, 307, 287, 2837, 357, 15, 11, 42313, 2920, 3134, 25710, 828, 59, 77, 4360, 345, 3804, 1271, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 64, 92, 543, 318, 407, 11414, 287, 262, 604, 18022, 2685, 0, 357, 40778, 5886, 11125, 42501, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 1343, 604, 532, 352, 1875, 18896, 7, 31673, 62, 1525, 83, 451, 2433, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 3551, 604, 9881, 284, 4088, 2209, 422, 1391, 3575, 392, 62, 65, 92, 284, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 65, 1343, 604, 532, 352, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 32876, 1666, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 5886, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1515, 392, 62, 65, 1279, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 3318, 891, 9319, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 3551, 379, 4088, 2209, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 6738, 1391, 3575, 392, 62, 65, 92, 284, 1391, 3575, 392, 62, 65, 1343, 362, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 739, 44041, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 9203, 11125, 42501, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 1525, 83, 451, 2433, 58, 3575, 392, 62, 65, 25, 3575, 392, 62, 65, 1343, 604, 60, 796, 1515, 392, 62, 64, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 12901, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 14059, 9, 4049, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 357, 2502, 91, 4625, 8, 11125, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 18109, 16594, 284, 17562, 422, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 65, 92, 284, 1391, 3575, 392, 62, 65, 1343, 604, 532, 352, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 12518, 612, 318, 4088, 11876, 351, 2546, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 38165, 9881, 31520, 1600, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 11052, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 3933, 2545, 357, 19, 26327, 8, 2837, 357, 17618, 8, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 2685, 460, 691, 3994, 604, 18022, 357, 2624, 1643, 8, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 1276, 307, 287, 2837, 357, 15, 11, 42313, 2920, 3134, 25710, 828, 59, 77, 4360, 345, 3804, 1271, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 64, 92, 543, 318, 407, 11414, 287, 262, 604, 18022, 2685, 0, 357, 40778, 5886, 11125, 42501, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 15675, 19, 17513, 51, 1546, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 1100, 604, 9881, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 1343, 604, 532, 352, 1875, 18896, 7, 31673, 62, 1525, 83, 451, 2433, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 1100, 422, 4088, 2209, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 64, 92, 284, 1391, 3575, 392, 62, 64, 1343, 604, 532, 352, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 32876, 1666, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 5886, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1515, 392, 62, 64, 1279, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 3318, 891, 9319, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 1100, 422, 4088, 2209, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 3575, 392, 62, 64, 92, 284, 1391, 3575, 392, 62, 64, 1343, 604, 532, 352, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 739, 44041, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 9203, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 4149, 4088, 379, 262, 17562, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 33661, 796, 493, 13, 6738, 62, 33661, 7, 31673, 62, 1525, 83, 451, 2433, 58, 3575, 392, 62, 64, 25, 3575, 392, 62, 64, 1343, 604, 4357, 18022, 2875, 2625, 31629, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 12901, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 14059, 9, 4049, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 357, 2502, 91, 4625, 8, 11125, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 18109, 5569, 422, 17562, 1391, 3575, 392, 62, 64, 92, 284, 1391, 3575, 392, 62, 64, 1343, 604, 532, 352, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 12518, 612, 318, 4088, 11876, 351, 2546, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 38165, 9881, 31520, 1600, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4088, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 31673, 62, 33661, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 15675, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 1100, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 1875, 18896, 7, 31673, 62, 1525, 83, 451, 2433, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 1100, 422, 4088, 2209, 1391, 3575, 392, 62, 64, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 32876, 1666, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 5886, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1515, 392, 62, 64, 1279, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 3318, 891, 9319, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 1100, 422, 4088, 2209, 1391, 3575, 392, 62, 64, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 739, 44041, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 9203, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 4149, 4088, 379, 262, 17562, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 26327, 796, 4088, 62, 1525, 83, 451, 2433, 58, 3575, 392, 62, 64, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 12901, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 14059, 9, 4049, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 357, 2502, 91, 4625, 8, 11125, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 18109, 5569, 422, 17562, 1391, 3575, 392, 62, 64, 92, 618, 612, 318, 4088, 11876, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 4480, 2546, 1391, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 38165, 9881, 31520, 1600, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4088, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 31673, 62, 26327, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 9693, 3913, 62, 38019, 10659, 4877, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 905, 355, 34534, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10903, 284, 905, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 8841, 25, 9881, 796, 275, 15931, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 1343, 1515, 392, 62, 64, 1875, 18896, 7, 31673, 62, 1525, 83, 451, 2433, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 1100, 422, 4088, 2209, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 6738, 1391, 3575, 392, 62, 65, 92, 284, 1391, 3575, 392, 62, 65, 1343, 1515, 392, 62, 64, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 32876, 1666, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 5886, 11125, 42501, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1515, 392, 62, 64, 1279, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 1016, 284, 307, 4088, 3318, 891, 9319, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 51, 14992, 284, 1100, 422, 4088, 2209, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 6738, 1391, 3575, 392, 62, 65, 92, 284, 1391, 3575, 392, 62, 65, 1343, 1515, 392, 62, 64, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5562, 739, 44041, 4088, 11876, 2546, 1391, 7, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 4008, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9881, 357, 30871, 28632, 9203, 11125, 42501, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 4149, 4088, 4731, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 8841, 796, 4088, 62, 1525, 83, 451, 2433, 58, 3575, 392, 62, 65, 25, 1515, 392, 62, 65, 1343, 1515, 392, 62, 64, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 12901, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 14059, 9, 4049, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30871, 11876, 357, 2502, 91, 4625, 8, 11125, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 18109, 5569, 422, 1391, 3575, 392, 62, 65, 92, 284, 1391, 3575, 392, 62, 65, 1343, 1515, 392, 62, 64, 92, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 12518, 612, 318, 4088, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 22252, 351, 2546, 1391, 11925, 7, 31673, 62, 1525, 83, 451, 2433, 38165, 9881, 31520, 1600, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 12578, 875, 9043, 4088, 9881, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 31673, 62, 8841, 13, 12501, 1098, 7203, 48504, 12, 23, 12340, 886, 2625, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 17562, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 17562, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 44, 3620, 15513, 62, 17513, 9328, 1503, 30631, 62, 33991, 62, 16402, 41358, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33991, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 9242, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 17562, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 15, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9399, 62, 15675, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 314, 14, 46, 1100, 4731, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 4731, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 8367, 796, 5128, 22446, 268, 8189, 7203, 48504, 12, 23, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 13664, 796, 18896, 7, 8841, 62, 8367, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 62, 9630, 407, 287, 4088, 62, 8841, 62, 47809, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 407, 1043, 4731, 287, 19171, 4731, 32007, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 17562, 11, 290, 4574, 287, 284, 262, 32007, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4731, 62, 29536, 25, 41876, 62, 16402, 41358, 796, 352, 1343, 4088, 62, 8841, 62, 7857, 62, 79, 261, 353, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 8841, 62, 47809, 58, 14421, 62, 46616, 62, 9630, 60, 796, 4731, 62, 29536, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4731, 826, 656, 262, 416, 83, 451, 2433, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 1525, 83, 451, 2433, 58, 8841, 62, 29536, 25, 4731, 62, 29536, 1343, 4731, 62, 13664, 60, 796, 4731, 62, 8367, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 1306, 17562, 416, 1459, 4731, 4129, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 8841, 62, 7857, 62, 79, 261, 353, 15853, 4731, 62, 13664, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 30343, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 4731, 62, 13664, 1875, 4088, 62, 8841, 62, 7857, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 30343, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 51, 14992, 284, 4574, 314, 14, 46, 4731, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 12518, 612, 318, 4088, 4731, 11876, 30343, 0, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 23433, 779, 4088, 2546, 22644, 11, 284, 2620, 2546, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1043, 4731, 17562, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1043, 62, 8841, 62, 29536, 796, 4088, 62, 8841, 62, 47809, 58, 14421, 62, 46616, 62, 9630, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 9275, 62, 8841, 62, 29536, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4731, 4129, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 8841, 62, 13664, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9399, 62, 15675, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 314, 14, 46, 1100, 18253, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 18253, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1949, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 18253, 62, 8367, 796, 493, 7, 15414, 28955, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2845, 11052, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 18253, 62, 8367, 796, 532, 16, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 18253, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 18558, 1009, 62, 25558, 13, 14689, 7, 41433, 62, 8367, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 6480, 1040, 291, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 20035, 6480, 1040, 291, 0, 357, 2437, 10091, 1, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16876, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 3991, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 10088, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1081, 428, 318, 16876, 11, 523, 356, 815, 4391, 284, 262, 23578, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 1459, 62, 46616, 13, 3575, 392, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 2081, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 1838, 4391, 656, 262, 611, 8478, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17852, 5188, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 10088, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1081, 428, 318, 17852, 5188, 10088, 11, 356, 815, 423, 6376, 1343, 352, 11, 6376, 0, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 1459, 62, 46616, 13, 3575, 392, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8410, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 18558, 1009, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 3991, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5268, 361, 4391, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 886, 62, 43327, 62, 46616, 62, 9630, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 13, 3575, 392, 4083, 3575, 392, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 437, 62, 43327, 62, 46616, 62, 9630, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 10088, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1081, 428, 318, 8410, 11, 523, 356, 815, 4391, 284, 262, 23578, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 493, 7, 437, 62, 43327, 62, 46616, 62, 9630, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 2081, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 1838, 4391, 656, 262, 611, 1767, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 12418, 41119, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 7655, 41119, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 1838, 4391, 656, 262, 611, 2643, 357, 38011, 737, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 10619, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23578, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 10088, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1081, 428, 318, 23578, 10088, 11, 356, 815, 423, 6376, 1343, 352, 11, 6376, 0, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 1459, 62, 46616, 13, 3575, 392, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 7206, 29940, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23449, 8881, 35946, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 6770, 10088, 379, 17490, 3800, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 44, 3620, 15513, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 4088, 10088, 379, 17490, 3800, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 10088, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 20035, 10088, 2099, 0, 357, 2437, 10091, 1, 198, 220, 220, 220, 220, 220, 220, 220, 2845, 12901, 12331, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10358, 307, 8931, 4049, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 25896, 4049, 0, 770, 318, 743, 4073, 416, 26324, 422, 6565, 8931, 2474, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5211, 345, 973, 1391, 13918, 3861, 62, 17931, 23988, 9306, 92, 34509, 5781, 62, 18831, 4061, 22644, 30, 12901, 12331, 11, 357, 4863, 25, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 14421, 62, 46616, 13, 30001, 13, 5239, 30072, 1600, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2845, 31973, 9492, 3622, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 5025, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 9492, 5310, 341, 373, 5025, 416, 10586, 11313, 40754, 6407, 8, 628, 220, 220, 220, 611, 18896, 7, 31673, 62, 18558, 1009, 62, 25558, 8, 1875, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 597, 287, 262, 8931, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 49, 4944, 21479, 11, 5855, 834, 16737, 834, 1600, 352, 11, 352, 828, 366, 20361, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 25896, 318, 407, 6565, 706, 2491, 262, 10794, 2474, 8, 628, 198, 2, 406, 3849, 13, 198, 198, 4299, 300, 3849, 62, 4906, 62, 9122, 7, 10459, 25, 8090, 2599, 198, 220, 220, 220, 37227, 406, 3849, 9037, 2099, 2198, 13, 37227, 628, 220, 220, 220, 1303, 16926, 46, 25, 16876, 14, 12418, 41119, 597, 306, 325, 13040, 13, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 649, 10088, 2099, 13, 198, 220, 220, 220, 6818, 18896, 7, 18843, 1352, 6030, 8, 6624, 838, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 35946, 6030, 2474, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 649, 6480, 1040, 291, 2099, 13, 198, 220, 220, 220, 6818, 18896, 7, 5317, 81, 1040, 291, 8, 6624, 1542, 11, 366, 5492, 4296, 7822, 706, 4375, 649, 2558, 81, 1040, 291, 2474, 628, 220, 220, 220, 1303, 13610, 6565, 300, 3849, 8931, 13, 198, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 796, 23881, 3419, 628, 220, 220, 220, 1303, 3497, 2723, 12879, 954, 13, 198, 220, 220, 220, 12879, 62, 9127, 796, 18896, 7, 10459, 13, 3575, 2024, 8, 628, 220, 220, 220, 1303, 9236, 10088, 6376, 422, 262, 2723, 13, 198, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 657, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 517, 621, 6632, 12879, 287, 4732, 13, 198, 220, 220, 220, 611, 12879, 62, 9127, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 645, 12879, 287, 262, 2457, 30751, 4732, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 5855, 834, 2815, 353, 834, 1600, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 12879, 1043, 287, 1813, 2393, 706, 32096, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 533, 345, 1813, 6565, 2393, 393, 2393, 1231, 7186, 12879, 35379, 6407, 8, 628, 220, 220, 220, 981, 1459, 62, 46616, 62, 9630, 1279, 12879, 62, 9127, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2893, 356, 407, 1057, 503, 286, 262, 2723, 12879, 1351, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 10088, 422, 262, 2723, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 25, 35946, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 25339, 674, 10088, 198, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 350, 27143, 17828, 7156, 1137, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 493, 828, 366, 6030, 4049, 11, 31191, 263, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1515, 392, 2099, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 350, 27143, 19269, 2751, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 965, 828, 366, 6030, 4049, 11, 31191, 263, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1515, 392, 3858, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 220, 1303, 10903, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 25216, 62, 16402, 41358, 8, 220, 1303, 10903, 17562, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 44, 3620, 15513, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 4088, 10088, 379, 300, 3849, 3800, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 6489, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 5556, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33569, 14114, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 14083, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33365, 6239, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 953, 23515, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 23678, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 20208, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 16724, 4061, 11319, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 29162, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 36, 10917, 1847, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4961, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 11929, 62, 36, 10917, 1847, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 407, 4961, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 48481, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1342, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 28934, 23261, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 3744, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 48481, 62, 36, 10917, 1847, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1342, 4961, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 28934, 23261, 62, 36, 10917, 1847, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 3744, 4961, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 17887, 2969, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 16075, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 37245, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4866, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 17, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 17, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4866, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 62, 41983, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 625, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4866, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 64, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 3575, 392, 62, 65, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 41374, 2200, 10979, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 5255, 434, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 30158, 2200, 10979, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 18703, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 39274, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1479, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3232, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9693, 3913, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 905, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 18564, 12709, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 3551, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 18564, 12709, 19, 17513, 51, 1546, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 3551, 604, 9881, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 15675, 19, 17513, 51, 1546, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 1100, 604, 9881, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 15675, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 1100, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 9693, 3913, 62, 38019, 10659, 4877, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 905, 9881, 355, 34534, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1111, 1515, 1746, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 65, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 65, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 362, 11, 1515, 392, 62, 65, 11, 493, 11, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 17562, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 17562, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33991, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 9242, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 17562, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9399, 62, 15675, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 314, 14, 46, 1100, 4731, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1515, 392, 3858, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 220, 1303, 10903, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 25216, 62, 16402, 41358, 8, 220, 1303, 10903, 17562, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9399, 62, 15675, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 314, 14, 46, 1100, 18253, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 1515, 392, 3858, 284, 262, 8931, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4088, 62, 2815, 353, 62, 25558, 13, 14689, 7, 600, 8, 220, 1303, 34142, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 6480, 1040, 291, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 10059, 1220, 555, 74, 13159, 28327, 2099, 0, 357, 2437, 10091, 1, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16876, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 770, 318, 1838, 4391, 656, 262, 611, 8478, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17852, 5188, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 10088, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1081, 428, 318, 17852, 5188, 10088, 11, 356, 815, 423, 6376, 1343, 352, 11, 6376, 0, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 1459, 62, 46616, 13, 3575, 392, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 12418, 41119, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 7655, 41119, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8410, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 8931, 2546, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 1279, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1515, 392, 62, 64, 796, 4088, 62, 2815, 353, 62, 25558, 13, 12924, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1515, 392, 62, 64, 14512, 41876, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 14421, 62, 46616, 11, 352, 11, 1515, 392, 62, 64, 11, 493, 11, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5268, 361, 4391, 10088, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 886, 62, 43327, 62, 46616, 62, 9630, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 13, 3575, 392, 4083, 3575, 392, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 437, 62, 43327, 62, 46616, 62, 9630, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 23578, 422, 7655, 41119, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 493, 7, 437, 62, 43327, 62, 46616, 62, 9630, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 10619, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23578, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 15903, 284, 262, 10088, 1515, 392, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1081, 428, 318, 23578, 10088, 11, 356, 815, 423, 6376, 1343, 352, 11, 6376, 0, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 1459, 62, 46616, 13, 3575, 392, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 7206, 29940, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 6770, 10088, 379, 300, 3849, 3800, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 10059, 1220, 555, 74, 13159, 10088, 2099, 0, 357, 2437, 10091, 1, 628, 220, 220, 220, 611, 18896, 7, 31673, 62, 2815, 353, 62, 25558, 8, 14512, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 597, 287, 262, 8931, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 938, 10088, 11241, 4067, 13, 198, 220, 220, 220, 220, 220, 220, 220, 4067, 25, 37347, 6234, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 62, 9630, 532, 352, 4083, 30001, 13, 24886, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 3275, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 4067, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 25896, 318, 407, 6565, 379, 262, 2099, 10627, 3800, 0, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 18109, 1858, 318, 1391, 11925, 7, 31673, 62, 2815, 353, 62, 25558, 38165, 4847, 618, 815, 307, 657, 42501, 6407, 8, 628, 198, 2, 8090, 13, 628, 198, 4299, 3440, 62, 10459, 62, 6738, 62, 7753, 7, 7753, 62, 6978, 25, 965, 8, 4613, 46545, 58, 7416, 11, 23042, 263, 21947, 5974, 198, 220, 220, 220, 37227, 8778, 2393, 11, 788, 1441, 3492, 2723, 290, 4732, 329, 340, 13, 357, 30642, 1143, 11, 23042, 276, 11, 406, 600, 276, 737, 37227, 628, 220, 220, 220, 1303, 4149, 2723, 3951, 13, 198, 220, 220, 220, 2723, 62, 7753, 11, 4808, 796, 467, 69, 430, 13, 7295, 13, 847, 13, 28311, 62, 9654, 62, 7753, 7, 7753, 62, 6978, 11, 366, 81, 1600, 6407, 11, 21004, 2625, 48504, 12, 23, 4943, 198, 220, 220, 220, 2723, 62, 6615, 796, 2723, 62, 7753, 13, 961, 6615, 3419, 198, 220, 220, 220, 2723, 62, 7753, 13, 19836, 3419, 628, 220, 220, 220, 30751, 62, 22866, 796, 23042, 263, 21947, 3419, 628, 220, 220, 220, 1303, 29130, 1096, 13, 198, 220, 220, 220, 31191, 263, 62, 83, 482, 641, 796, 1351, 7, 2588, 263, 62, 30001, 1096, 7, 10459, 62, 6615, 11, 2393, 62, 6978, 4008, 628, 220, 220, 220, 611, 18896, 7, 2588, 263, 62, 83, 482, 641, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 2538, 55, 1137, 11, 357, 12093, 12453, 7, 7753, 62, 6978, 828, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 16326, 1043, 287, 1813, 2393, 11, 389, 345, 1813, 6565, 2393, 35379, 6407, 8, 628, 220, 220, 220, 1303, 2547, 325, 13, 198, 220, 220, 220, 30751, 62, 29572, 7, 2588, 263, 62, 83, 482, 641, 11, 30751, 62, 22866, 11, 2393, 62, 6978, 8, 628, 220, 220, 220, 1303, 13610, 2723, 422, 4732, 13, 198, 220, 220, 220, 30751, 62, 22866, 62, 10459, 796, 8090, 7, 48610, 62, 22866, 13, 3575, 2024, 8, 628, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 6818, 318, 39098, 7, 48610, 62, 22866, 13, 12942, 425, 62, 2815, 353, 62, 48267, 11, 20512, 828, 366, 3109, 7254, 300, 3849, 14267, 22644, 284, 307, 25131, 526, 198, 220, 220, 220, 611, 407, 30751, 62, 22866, 13, 12942, 425, 62, 2815, 353, 62, 48267, 25, 198, 220, 220, 220, 220, 220, 220, 220, 300, 3849, 62, 4906, 62, 9122, 7, 48610, 62, 22866, 62, 10459, 8, 628, 220, 220, 220, 1441, 30751, 62, 22866, 62, 10459, 11, 30751, 62, 22866, 628, 198, 2, 11361, 13, 198, 198, 4299, 21015, 62, 8612, 378, 7, 10459, 25, 8090, 11, 4732, 25, 23042, 263, 21947, 11, 3108, 25, 965, 2599, 198, 220, 220, 220, 37227, 2980, 689, 4823, 422, 262, 2723, 13, 37227, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 10088, 2099, 393, 28327, 13, 198, 220, 220, 220, 6818, 18896, 7, 18843, 1352, 6030, 8, 6624, 838, 11, 366, 5492, 4296, 7822, 329, 21015, 5270, 706, 4375, 649, 35946, 6030, 2474, 198, 220, 220, 220, 6818, 18896, 7, 5317, 81, 1040, 291, 8, 6624, 2579, 11, 366, 5492, 4296, 7822, 329, 21015, 5270, 70, 706, 4375, 649, 2558, 81, 1040, 291, 2474, 628, 220, 220, 220, 825, 11593, 19119, 62, 521, 298, 7, 8367, 25, 493, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 28090, 33793, 416, 1813, 1988, 13, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10133, 1241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 521, 298, 62, 5715, 220, 1303, 2099, 25, 8856, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 521, 298, 62, 5715, 15853, 1988, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10133, 33793, 4731, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 521, 298, 220, 1303, 2099, 25, 8856, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 521, 298, 796, 37082, 83, 1, 1635, 1459, 62, 521, 298, 62, 5715, 628, 220, 220, 220, 825, 11593, 13564, 62, 5898, 263, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 19430, 2366, 263, 13, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 30028, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 11, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 198, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 393, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 796, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 815, 3551, 416, 83, 451, 2433, 2512, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1439, 13369, 416, 83, 451, 2433, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 14421, 62, 1525, 83, 451, 2433, 62, 28463, 62, 9150, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 31673, 796, 416, 83, 451, 2433, 7203, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 22866, 13, 31673, 62, 1525, 83, 451, 2433, 62, 7857, 92, 1343, 13042, 62, 7857, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 4943, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 18957, 20157, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 407, 22644, 62, 48267, 62, 15944, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 14421, 62, 1525, 83, 451, 2433, 62, 28463, 62, 9150, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 25113, 1439, 13369, 4088, 11876, 357, 31673, 1343, 13042, 16725, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30629, 1722, 345, 1444, 4088, 12879, 2599, 3467, 77, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 39567, 2836, 546, 1262, 18022, 4560, 287, 21015, 23340, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 20361, 1600, 366, 36981, 15986, 1294, 2751, 35153, 15513, 43521, 18421, 11, 14603, 26720, 21515, 7788, 31484, 2043, 9348, 7801, 12861, 11698, 0, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 2043, 3180, 26720, 367, 9795, 1137, 5390, 327, 11417, 33854, 16876, 7013, 32494, 24301, 4146, 1961, 44156, 2849, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30629, 11929, 23255, 47, 26087, 11617, 8, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 815, 3551, 4731, 11876, 2512, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23691, 4731, 2163, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 14421, 62, 8841, 62, 22252, 62, 28463, 62, 9150, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 358, 891, 8931, 62, 14689, 62, 8841, 7, 25558, 62, 2536, 11, 1034, 62, 9630, 2599, 3467, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 2536, 62, 11925, 796, 18896, 7, 25558, 62, 2536, 19415, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 49929, 1034, 62, 9630, 407, 287, 13042, 62, 47809, 7479, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 20541, 13042, 62, 7857, 62, 29536, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 20692, 796, 13042, 62, 7857, 1343, 352, 1343, 13042, 62, 7857, 62, 29536, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 37336, 62, 47809, 58, 404, 62, 9630, 60, 796, 50116, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 31673, 58, 20692, 25, 50116, 1343, 965, 62, 11925, 60, 796, 8931, 62, 2536, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 37336, 62, 7857, 62, 29536, 15853, 965, 62, 11925, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 49929, 965, 62, 11925, 1875, 13042, 62, 7857, 7479, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 59, 83, 4798, 7, 7879, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 24908, 0, 31165, 284, 4574, 4731, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 12518, 612, 318, 4088, 4731, 11876, 30343, 0, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 23433, 779, 4088, 2546, 22644, 11, 284, 2620, 2546, 2474, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 4943, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 59, 83, 59, 660, 10198, 7, 16, 19415, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 27110, 2777, 796, 13042, 62, 47809, 58, 404, 62, 9630, 60, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 37082, 83, 7783, 277, 2777, 11, 965, 62, 11925, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1267, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1439, 13369, 4731, 11876, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 14421, 62, 8841, 62, 22252, 62, 28463, 62, 9150, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 37336, 62, 47809, 796, 8633, 3419, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 37336, 62, 7857, 796, 1391, 22866, 13, 31673, 62, 1525, 83, 451, 2433, 62, 7857, 32239, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 37336, 62, 7857, 62, 29536, 796, 657, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 18957, 20157, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 407, 22644, 62, 48267, 62, 15944, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 14421, 62, 8841, 62, 22252, 62, 28463, 62, 9150, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 25113, 1439, 13369, 13042, 11876, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30629, 1722, 345, 973, 13042, 2599, 3467, 77, 4943, 628, 220, 220, 220, 825, 11593, 13564, 62, 25677, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 13639, 13, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 8295, 12, 27568, 3068, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 22644, 62, 48267, 62, 15944, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7203, 2, 770, 2393, 318, 8295, 12, 27568, 416, 1514, 69, 430, 12, 32065, 21015, 850, 21812, 0, 3467, 77, 59, 77, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 8931, 37588, 5002, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 22644, 62, 48267, 62, 15944, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7203, 2, 1439, 13369, 8931, 357, 1722, 318, 1514, 69, 430, 318, 23881, 12, 15001, 15417, 2599, 3467, 77, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7203, 25558, 796, 17635, 59, 77, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10133, 416, 83, 451, 2433, 7550, 2292, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 1525, 83, 451, 2433, 62, 28463, 62, 9150, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 28463, 62, 9150, 796, 18896, 7, 14421, 62, 6615, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10133, 4731, 11876, 7550, 2292, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 8841, 62, 22252, 62, 28463, 62, 9150, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 8841, 62, 22252, 62, 28463, 62, 9150, 796, 18896, 7, 14421, 62, 6615, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 2393, 290, 5408, 3651, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 22644, 62, 48267, 62, 15944, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7203, 59, 77, 59, 77, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 69, 1, 2, 9220, 37913, 12093, 12453, 7, 6978, 38165, 2599, 3467, 77, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 69, 1, 2, 10604, 507, 25, 3467, 77, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10133, 981, 7550, 2292, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 4514, 62, 28463, 62, 9150, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 28463, 62, 9150, 796, 18896, 7, 14421, 62, 6615, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 2723, 13639, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 22644, 62, 48267, 62, 15944, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7203, 2, 8090, 7479, 77, 4943, 628, 220, 220, 220, 825, 11593, 13564, 62, 46616, 62, 600, 81, 1040, 291, 7, 46616, 25, 35946, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 4277, 10088, 357, 13159, 12, 600, 81, 1040, 291, 737, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 326, 428, 318, 28327, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 10088, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 11, 366, 15419, 12, 1268, 5446, 20913, 2149, 12879, 366, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 21754, 307, 3194, 1262, 11593, 13564, 62, 46616, 3419, 2474, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 2558, 81, 1040, 291, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 220, 1303, 2099, 25, 8856, 198, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 6489, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 5556, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 1343, 1515, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 23678, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 20208, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 532, 1515, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 30158, 2200, 10979, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 18703, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 25558, 13, 12924, 3419, 1343, 352, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 41374, 2200, 10979, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 5255, 434, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 25558, 13, 12924, 3419, 532, 352, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 16724, 4061, 11319, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 29162, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 1635, 1515, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33569, 14114, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 14083, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 3373, 1515, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33365, 6239, 2937, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 953, 23515, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 4064, 1515, 392, 62, 64, 4008, 4943, 220, 1303, 16926, 46, 25, 6822, 4064, 11, 4781, 393, 1364, 493, 3419, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 36, 10917, 1847, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4961, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 6624, 1515, 392, 62, 64, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 28934, 23261, 62, 36, 10917, 1847, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 3744, 4961, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 18189, 1515, 392, 62, 64, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 28934, 23261, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 3744, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 1875, 1515, 392, 62, 64, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 48481, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1342, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 1279, 1515, 392, 62, 64, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 48481, 62, 36, 10917, 1847, 62, 4221, 1565, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1342, 4961, 621, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 27, 28, 1515, 392, 62, 64, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 17887, 2969, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 16075, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 9693, 3913, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 905, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 4798, 7, 25558, 13, 12924, 28955, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 39274, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 1479, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 11929, 62, 36, 10917, 1847, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 407, 4961, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 600, 7, 3575, 392, 62, 65, 14512, 1515, 392, 62, 64, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 17, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 17, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 34, 3185, 56, 62, 41983, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4866, 625, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 64, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 3575, 392, 62, 65, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 16402, 41358, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 9242, 17562, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 416, 83, 451, 2433, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 1737, 307, 4615, 11, 475, 655, 7477, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 25558, 13, 33295, 15090, 44, 3620, 15513, 62, 17513, 9328, 1503, 30631, 62, 33991, 62, 16402, 41358, 30072, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 33991, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 9242, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 25558, 13, 33295, 7, 15, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 18564, 12709, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 4088, 3551, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 416, 83, 451, 2433, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 3125, 8794, 379, 14102, 4226, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 58, 3575, 392, 62, 65, 60, 796, 1515, 392, 62, 64, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 15675, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 4088, 1100, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 416, 83, 451, 2433, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 3125, 8794, 379, 14102, 4226, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 62, 26327, 796, 4088, 58, 3575, 392, 62, 64, 60, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 31673, 62, 26327, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 18564, 12709, 19, 17513, 51, 1546, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 3551, 604, 9881, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 416, 83, 451, 2433, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 3125, 8794, 379, 14102, 4226, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 65, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 62, 33661, 796, 1515, 392, 62, 64, 13, 1462, 62, 33661, 7, 13664, 28, 19, 11, 18022, 2875, 17553, 31629, 34607, 4488, 16193, 3575, 392, 62, 64, 1279, 657, 4008, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 58, 3575, 392, 62, 65, 25, 3575, 392, 62, 65, 1343, 604, 60, 796, 4088, 62, 33661, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 15675, 19, 17513, 51, 1546, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 4088, 1100, 604, 9881, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 416, 83, 451, 2433, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 3125, 8794, 379, 14102, 4226, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 3575, 392, 62, 64, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 62, 33661, 796, 493, 13, 6738, 62, 33661, 7, 31673, 58, 3575, 392, 62, 64, 25, 3575, 392, 62, 64, 1343, 604, 4357, 18022, 2875, 17553, 31629, 59, 4943, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 25558, 13, 33295, 7, 31673, 62, 33661, 8, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 1459, 62, 46616, 13, 3575, 392, 6624, 2558, 81, 1040, 291, 13, 44, 3620, 15513, 62, 9693, 3913, 62, 38019, 10659, 4877, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 4088, 905, 355, 3435, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 416, 83, 451, 2433, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 62, 13664, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 62, 29536, 796, 8931, 13, 12924, 3419, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 31673, 62, 9630, 796, 657, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 4514, 4088, 62, 9630, 1279, 4088, 62, 13664, 25, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 59, 83, 31673, 62, 26327, 796, 4088, 58, 31673, 62, 29536, 1343, 4088, 62, 9630, 60, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 59, 83, 4798, 7, 354, 81, 7, 31673, 62, 26327, 828, 886, 17553, 59, 4943, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 59, 83, 31673, 62, 9630, 15853, 352, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 6480, 1040, 291, 2099, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10139, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 9858, 47, 4146, 25633, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5317, 81, 1040, 291, 4600, 90, 1268, 5446, 20913, 2149, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 14421, 62, 46616, 13, 3575, 392, 48999, 63, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 271, 407, 9177, 329, 21015, 5270, 40754, 6407, 8, 628, 220, 220, 220, 825, 11593, 13564, 62, 46616, 7, 46616, 25, 35946, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 4277, 10088, 357, 13159, 12, 600, 81, 1040, 291, 737, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 8504, 12001, 786, 981, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 4514, 62, 9967, 220, 1303, 2099, 25, 8856, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 4514, 62, 23211, 62, 3672, 220, 1303, 2099, 25, 8856, 198, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 4514, 62, 23893, 220, 1303, 2099, 25, 8856, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 25339, 674, 10088, 198, 220, 220, 220, 220, 220, 220, 220, 611, 10088, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 5317, 81, 1040, 291, 12879, 815, 307, 3194, 1262, 11593, 13564, 62, 46616, 62, 600, 81, 1040, 291, 3419, 2474, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 350, 27143, 17828, 7156, 1137, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 493, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 25558, 13, 33295, 15090, 46616, 13, 3575, 392, 30072, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 350, 27143, 19269, 2751, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 965, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16926, 46, 25, 39567, 1262, 4600, 14421, 62, 46616, 62, 9630, 63, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 82, 62, 2536, 11, 264, 62, 11925, 796, 8931, 62, 14689, 62, 8841, 15090, 46616, 13, 3575, 392, 13, 268, 8189, 10786, 48504, 12, 23, 11537, 5512, 1391, 14421, 62, 46616, 62, 9630, 30072, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 25558, 13, 33295, 7, 82, 62, 2536, 8, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 25558, 13, 33295, 7, 82, 62, 11925, 8, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 13042, 11876, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 796, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 843, 4088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1729, 12001, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 6407, 628, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16876, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 361, 8931, 13, 12924, 3419, 14512, 657, 25, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 33793, 1241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 19119, 62, 521, 298, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 12418, 41119, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 7655, 41119, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 11436, 1438, 11, 523, 356, 460, 3551, 366, 4299, 1, 379, 262, 1353, 286, 262, 2723, 287, 1459, 62, 4514, 62, 28463, 62, 9150, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 23211, 62, 3672, 796, 277, 1, 4514, 62, 38011, 62, 541, 90, 14421, 62, 46616, 62, 9630, 36786, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 11436, 2912, 329, 981, 2163, 2512, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 23893, 796, 2912, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 69, 1, 90, 14421, 62, 521, 298, 18477, 23893, 58, 17, 47715, 32239, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 90, 14421, 62, 521, 298, 92, 4514, 1391, 14421, 62, 4514, 62, 23211, 62, 3672, 92, 3419, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5345, 326, 356, 287, 981, 5408, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 9967, 796, 6407, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 8410, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 4514, 62, 9967, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 1969, 981, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 9236, 7550, 2292, 329, 3951, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 357, 1722, 356, 836, 63, 83, 765, 284, 13259, 1459, 62, 4514, 62, 28463, 62, 9150, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 981, 62, 9967, 62, 28463, 62, 9150, 796, 1459, 62, 4514, 62, 28463, 62, 9150, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 35835, 13639, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2163, 62, 23893, 796, 13538, 611, 22644, 62, 48267, 62, 15944, 2073, 277, 1, 59, 83, 2, 1377, 10358, 307, 1444, 422, 7655, 41119, 13, 59, 77, 1, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 4514, 62, 9967, 62, 28463, 62, 9150, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 4299, 1391, 14421, 62, 4514, 62, 23211, 62, 3672, 92, 33529, 90, 14421, 62, 4514, 62, 23893, 32239, 77, 1, 1343, 2163, 62, 23893, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 329, 981, 62, 25558, 62, 1370, 287, 1459, 62, 4514, 62, 6615, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 40806, 378, 625, 981, 8931, 3951, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 981, 62, 9967, 62, 28463, 62, 9150, 15853, 352, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 35835, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 4514, 62, 9967, 62, 28463, 62, 9150, 11, 277, 1, 59, 83, 90, 4514, 62, 25558, 62, 1370, 92, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 35835, 1441, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1441, 62, 23893, 796, 13538, 611, 22644, 62, 48267, 62, 15944, 2073, 277, 1, 220, 1303, 1377, 8229, 329, 4585, 422, 7655, 41119, 22135, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 28463, 7, 4514, 62, 9967, 62, 28463, 62, 9150, 1343, 352, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 59, 83, 7783, 8931, 13, 12924, 3419, 1, 1343, 1441, 62, 23893, 1343, 37082, 77, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 407, 981, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 9858, 47, 4146, 25633, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 30074, 4600, 4598, 47671, 618, 612, 318, 645, 4600, 4514, 63, 2512, 2067, 0, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30629, 47, 945, 278, 4049, 10091, 1600, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 69, 1298, 90, 23893, 32239, 77, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1514, 503, 262, 981, 2512, 5408, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 9967, 796, 10352, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 30027, 1459, 981, 3951, 1351, 357, 25558, 737, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 6615, 13, 20063, 3419, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 33793, 1241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 19119, 62, 521, 298, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 17852, 5188, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1208, 62, 23893, 796, 13538, 611, 22644, 62, 48267, 62, 15944, 2073, 277, 1, 220, 1303, 1377, 1355, 1654, 326, 612, 318, 645, 6565, 1767, 526, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 14421, 62, 521, 298, 1343, 277, 1, 6603, 90, 6603, 62, 23893, 32239, 77, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 36400, 589, 33793, 1241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 19119, 62, 521, 298, 32590, 16, 8, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7203, 17772, 25, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 25285, 33793, 1241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 19119, 62, 521, 298, 7, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 10619, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23578, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 18689, 11, 612, 318, 645, 23578, 287, 11361, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1208, 62, 23893, 796, 13538, 611, 22644, 62, 48267, 62, 15944, 2073, 277, 1, 220, 1303, 1377, 1355, 1654, 326, 612, 318, 645, 6565, 1767, 526, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 14421, 62, 521, 298, 1343, 277, 1, 6603, 90, 6603, 62, 23893, 32239, 77, 4943, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 36400, 589, 33793, 1241, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 19119, 62, 521, 298, 32590, 16, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 7206, 29940, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 23449, 8881, 35946, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 6770, 10088, 379, 17490, 3800, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 10088, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 277, 1, 30074, 10059, 1220, 555, 74, 13159, 10088, 2099, 0, 357, 2437, 10091, 1, 628, 220, 220, 220, 825, 3551, 7, 5239, 25, 965, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 2420, 284, 2393, 13, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 4514, 62, 9967, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 389, 287, 9052, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 3060, 2420, 1231, 33793, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 4514, 62, 6615, 13, 33295, 7, 5239, 1343, 2912, 1343, 37082, 77, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4277, 2420, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 14421, 62, 521, 298, 1343, 2420, 1343, 2912, 1343, 37082, 77, 4943, 628, 220, 220, 220, 1303, 1423, 298, 341, 1241, 13, 198, 220, 220, 220, 1459, 62, 521, 298, 62, 5715, 796, 657, 220, 1303, 1423, 298, 1241, 329, 26019, 13, 198, 220, 220, 220, 1459, 62, 521, 298, 796, 13538, 220, 1303, 1423, 298, 4731, 329, 3597, 13, 628, 220, 220, 220, 1303, 2893, 13, 198, 220, 220, 220, 1459, 62, 4514, 62, 9967, 796, 10352, 220, 1303, 1002, 2081, 11, 356, 389, 287, 981, 9052, 13, 198, 220, 220, 220, 1459, 62, 4514, 62, 23893, 796, 13538, 220, 1303, 2893, 2512, 2912, 284, 1295, 287, 2457, 5408, 2163, 13, 198, 220, 220, 220, 1459, 62, 4514, 62, 23211, 62, 3672, 796, 13538, 220, 1303, 2893, 5447, 1438, 329, 19264, 5408, 2163, 13, 198, 220, 220, 220, 1459, 62, 4514, 62, 6615, 25, 7343, 58, 2536, 60, 796, 17635, 220, 1303, 7343, 286, 981, 3951, 284, 3551, 287, 5408, 2163, 13, 198, 220, 220, 220, 1459, 62, 4514, 62, 28463, 62, 9150, 796, 657, 220, 1303, 23158, 284, 7550, 981, 14700, 7021, 13, 628, 220, 220, 220, 1303, 2750, 83, 451, 2433, 13, 198, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 28463, 62, 9150, 796, 657, 220, 1303, 23158, 284, 7550, 416, 83, 451, 2433, 2512, 611, 416, 83, 451, 2433, 62, 21754, 62, 15266, 318, 2081, 13, 198, 220, 220, 220, 1459, 62, 1525, 83, 451, 2433, 62, 21754, 62, 15266, 796, 10352, 220, 1303, 1002, 2081, 11, 481, 9828, 546, 4088, 8748, 290, 3551, 416, 83, 451, 2433, 2512, 13, 628, 220, 220, 220, 1303, 16926, 46, 25, 17220, 11, 355, 30806, 11, 612, 318, 416, 83, 451, 2433, 7550, 2292, 2029, 11, 543, 318, 976, 13, 198, 220, 220, 220, 1303, 4285, 654, 13, 628, 220, 220, 220, 1303, 23158, 284, 7550, 4731, 809, 2232, 20157, 2512, 11, 198, 220, 220, 220, 1303, 611, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 318, 2081, 13, 198, 220, 220, 220, 1459, 62, 8841, 62, 22252, 62, 28463, 62, 9150, 796, 657, 628, 220, 220, 220, 1459, 62, 8841, 62, 22252, 62, 21754, 62, 15266, 796, 10352, 220, 1303, 1002, 2081, 11, 481, 3551, 4731, 11876, 20157, 2512, 13, 628, 220, 220, 220, 1303, 10358, 356, 14267, 3651, 13, 198, 220, 220, 220, 22644, 62, 48267, 62, 15944, 796, 4732, 13, 12942, 425, 62, 29412, 62, 15944, 62, 48267, 628, 220, 220, 220, 1303, 3497, 2723, 12879, 954, 13, 198, 220, 220, 220, 12879, 62, 9127, 796, 18896, 7, 10459, 13, 3575, 2024, 8, 628, 220, 220, 220, 1303, 9236, 10088, 6376, 422, 262, 2723, 13, 198, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 657, 628, 220, 220, 220, 1303, 26299, 13, 198, 220, 220, 220, 1459, 62, 6615, 25, 7343, 58, 2536, 60, 796, 17635, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 517, 621, 6632, 12879, 287, 4732, 13, 198, 220, 220, 220, 611, 12879, 62, 9127, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 645, 12879, 287, 262, 2457, 30751, 4732, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 9858, 47, 4146, 25633, 11, 357, 12093, 12453, 7, 6978, 828, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 12879, 1043, 287, 1813, 2393, 706, 32096, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 533, 345, 1813, 6565, 2393, 393, 2393, 1231, 7186, 12879, 35379, 6407, 8, 628, 220, 220, 220, 1303, 4946, 2393, 13, 198, 220, 220, 220, 2393, 11, 4808, 796, 467, 69, 430, 13, 7295, 13, 847, 13, 28311, 62, 9654, 62, 7753, 7, 6978, 1343, 27071, 9078, 1600, 366, 86, 1600, 6407, 8, 628, 220, 220, 220, 1303, 19430, 13639, 13, 198, 220, 220, 220, 11593, 13564, 62, 25677, 3419, 628, 220, 220, 220, 981, 1459, 62, 46616, 62, 9630, 1279, 12879, 62, 9127, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2893, 356, 407, 1057, 503, 286, 262, 2723, 12879, 1351, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 10088, 422, 262, 2723, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 25, 35946, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 6889, 2912, 4731, 13, 198, 220, 220, 220, 220, 220, 220, 220, 4067, 25, 37347, 6234, 796, 1459, 62, 46616, 13, 30001, 13, 24886, 198, 220, 220, 220, 220, 220, 220, 220, 4067, 62, 8841, 25, 965, 796, 277, 1, 13949, 1391, 24886, 58, 16, 60, 5512, 11314, 1391, 24886, 58, 17, 60, 36786, 198, 220, 220, 220, 220, 220, 220, 220, 2912, 796, 13538, 611, 22644, 62, 48267, 62, 15944, 2073, 277, 1, 220, 1303, 29130, 25, 1391, 14421, 62, 46616, 13, 30001, 13, 5239, 92, 685, 90, 24886, 62, 8841, 92, 30866, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 28327, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 28327, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 13564, 62, 46616, 62, 600, 81, 1040, 291, 7, 14421, 62, 46616, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 584, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4277, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 13564, 62, 46616, 7, 14421, 62, 46616, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 1459, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 628, 220, 220, 220, 1303, 19430, 2366, 263, 13, 198, 220, 220, 220, 11593, 13564, 62, 5898, 263, 3419, 628, 220, 220, 220, 611, 18896, 7, 14421, 62, 4514, 62, 6615, 8, 14512, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 356, 423, 1223, 379, 262, 981, 3951, 8931, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 9858, 47, 4146, 25633, 11, 2723, 13, 3575, 2024, 58, 12, 16, 4083, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 3633, 3951, 8931, 318, 407, 6565, 706, 2491, 21015, 5270, 0, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30629, 7293, 10520, 4049, 10091, 1600, 6407, 8, 628, 220, 220, 220, 1303, 19430, 3951, 287, 2457, 2393, 13, 198, 220, 220, 220, 329, 1459, 62, 25558, 62, 1370, 287, 1459, 62, 6615, 25, 198, 220, 220, 220, 220, 220, 220, 220, 2393, 13, 13564, 7, 14421, 62, 25558, 62, 1370, 8, 628, 220, 220, 220, 1303, 13872, 2393, 13, 198, 220, 220, 220, 2393, 13, 19836, 3419, 628, 198, 2, 30589, 8189, 13, 198, 198, 4299, 17632, 62, 26327, 8189, 7, 10459, 25, 8090, 11, 4808, 11, 3108, 25, 965, 2599, 198, 220, 220, 220, 37227, 3082, 2915, 12879, 284, 18022, 8189, 13, 37227, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 10088, 2099, 393, 28327, 13, 198, 220, 220, 220, 6818, 18896, 7, 18843, 1352, 6030, 8, 6624, 838, 11, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 366, 5492, 4296, 7822, 329, 18022, 8189, 23340, 706, 4375, 649, 35946, 6030, 2474, 198, 220, 220, 220, 6818, 18896, 7, 5317, 81, 1040, 291, 8, 6624, 2579, 11, 366, 5492, 4296, 7822, 329, 18022, 8189, 23340, 706, 4375, 649, 2558, 81, 1040, 291, 2474, 628, 220, 220, 220, 825, 11593, 13564, 62, 46616, 62, 600, 81, 1040, 291, 7, 46616, 25, 35946, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 4277, 10088, 357, 13159, 12, 600, 81, 1040, 291, 737, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 6822, 326, 428, 318, 28327, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 10088, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 11, 366, 15419, 12, 1268, 5446, 20913, 2149, 12879, 366, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 21754, 307, 3194, 1262, 11593, 13564, 62, 46616, 3419, 2474, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 14421, 62, 46616, 13, 3575, 392, 11, 2558, 81, 1040, 291, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 3575, 392, 287, 3268, 5446, 20913, 2149, 62, 10468, 62, 17513, 51, 2943, 16820, 62, 31054, 25633, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 1585, 291, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 1268, 5446, 20913, 2149, 62, 10468, 62, 17513, 51, 2943, 16820, 62, 31054, 25633, 58, 14421, 62, 46616, 13, 3575, 392, 12962, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 9858, 47, 4146, 25633, 11, 1459, 62, 46616, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 5317, 81, 1040, 291, 4600, 90, 1268, 5446, 20913, 2149, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 14421, 62, 46616, 13, 3575, 392, 48999, 63, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 271, 407, 9177, 329, 18022, 8189, 23340, 40754, 6407, 8, 628, 220, 220, 220, 825, 11593, 13564, 62, 46616, 7, 46616, 25, 35946, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 4277, 10088, 357, 13159, 12, 600, 81, 1040, 291, 737, 37227, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 25339, 674, 10088, 198, 220, 220, 220, 220, 220, 220, 220, 611, 10088, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 5317, 81, 1040, 291, 12879, 815, 307, 3194, 1262, 11593, 13564, 62, 46616, 62, 600, 81, 1040, 291, 3419, 2474, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 493, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 10088, 1366, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 31054, 25633, 62, 25216, 62, 10468, 62, 17513, 51, 2943, 16820, 62, 31054, 25633, 58, 18843, 1352, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 12962, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3551, 7, 69, 1, 90, 46616, 13, 3575, 392, 92, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 47, 27143, 62, 18601, 2751, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 965, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 13290, 654, 318, 407, 9177, 1865, 287, 262, 18022, 8189, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 25559, 1859, 318, 407, 9177, 1865, 287, 262, 18022, 8189, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 12418, 41119, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 25559, 1859, 318, 407, 9177, 1865, 287, 262, 18022, 8189, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 277, 1, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 25559, 1859, 318, 407, 9177, 1865, 287, 262, 18022, 8189, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 3698, 5188, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 25559, 1859, 318, 407, 9177, 1865, 287, 262, 18022, 8189, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 10619, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 43521, 25633, 62, 2885, 7707, 7597, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 25559, 1859, 318, 407, 9177, 1865, 287, 262, 18022, 8189, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 7206, 29940, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 30074, 6770, 10088, 379, 17490, 3800, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 10088, 2099, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 277, 1, 30074, 10059, 1220, 555, 74, 13159, 10088, 2099, 0, 357, 2437, 10091, 1, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 370, 4061, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7203, 59, 77, 4943, 628, 220, 220, 220, 825, 3551, 7, 5239, 25, 965, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 37227, 12257, 274, 2420, 284, 2393, 13, 37227, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 6615, 13, 33295, 7, 5239, 1343, 366, 366, 8, 628, 220, 220, 220, 1303, 3497, 2723, 12879, 954, 13, 198, 220, 220, 220, 12879, 62, 9127, 796, 18896, 7, 10459, 13, 3575, 2024, 8, 628, 220, 220, 220, 1303, 9236, 10088, 6376, 422, 262, 2723, 13, 198, 220, 220, 220, 1459, 62, 46616, 62, 9630, 796, 657, 628, 220, 220, 220, 1303, 26299, 13, 198, 220, 220, 220, 1459, 62, 6615, 25, 7343, 58, 2536, 60, 796, 17635, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 517, 621, 6632, 12879, 287, 4732, 13, 198, 220, 220, 220, 611, 12879, 62, 9127, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 645, 12879, 287, 262, 2457, 30751, 4732, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 9858, 47, 4146, 25633, 11, 357, 12093, 12453, 7, 6978, 828, 352, 11, 352, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1858, 318, 645, 12879, 1043, 287, 1813, 2393, 706, 32096, 11, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 533, 345, 1813, 6565, 2393, 393, 2393, 1231, 7186, 12879, 35379, 6407, 8, 628, 220, 220, 220, 1303, 4946, 2393, 13, 198, 220, 220, 220, 18022, 8189, 62, 6978, 796, 3108, 1343, 27071, 70, 1659, 15630, 1, 198, 220, 220, 220, 2393, 11, 4808, 796, 467, 69, 430, 13, 7295, 13, 847, 13, 28311, 62, 9654, 62, 7753, 7, 26327, 8189, 62, 6978, 11, 366, 86, 1600, 6407, 8, 628, 220, 220, 220, 981, 1459, 62, 46616, 62, 9630, 1279, 12879, 62, 9127, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2893, 356, 407, 1057, 503, 286, 262, 2723, 12879, 1351, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 1459, 10088, 422, 262, 2723, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 25, 35946, 796, 2723, 13, 3575, 2024, 58, 14421, 62, 46616, 62, 9630, 60, 628, 220, 220, 220, 220, 220, 220, 220, 611, 1459, 62, 46616, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 28327, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 28327, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 13564, 62, 46616, 62, 600, 81, 1040, 291, 7, 14421, 62, 46616, 8, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 584, 10088, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 19430, 4277, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11593, 13564, 62, 46616, 7, 14421, 62, 46616, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 10791, 434, 1459, 6376, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 46616, 62, 9630, 15853, 352, 628, 220, 220, 220, 1303, 19430, 3951, 287, 2457, 2393, 13, 198, 220, 220, 220, 329, 1459, 62, 25558, 62, 1370, 287, 1459, 62, 6615, 25, 198, 220, 220, 220, 220, 220, 220, 220, 2393, 13, 13564, 7, 14421, 62, 25558, 62, 1370, 8, 628, 220, 220, 220, 1303, 13872, 2393, 13, 198, 220, 220, 220, 2393, 13, 19836, 3419, 198, 220, 220, 220, 1441, 18022, 8189, 62, 6978, 628, 198, 4299, 12260, 62, 26327, 8189, 7, 6978, 25, 965, 2599, 198, 220, 220, 220, 37227, 8393, 1769, 18022, 8189, 2393, 13, 37227, 628, 220, 220, 220, 1303, 6822, 326, 612, 318, 645, 2458, 287, 10088, 2099, 393, 28327, 13, 198, 220, 220, 220, 6818, 18896, 7, 18843, 1352, 6030, 8, 6624, 838, 11, 366, 5492, 4296, 7822, 329, 18022, 8189, 9706, 706, 4375, 649, 35946, 6030, 2474, 198, 220, 220, 220, 6818, 18896, 7, 5317, 81, 1040, 291, 8, 6624, 2579, 11, 366, 5492, 4296, 7822, 329, 18022, 8189, 9706, 706, 4375, 649, 2558, 81, 1040, 291, 2474, 628, 220, 220, 220, 611, 407, 3108, 13, 437, 2032, 342, 7, 1911, 70, 1659, 15630, 1, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 277, 1, 8979, 19990, 90, 6978, 92, 7879, 815, 423, 7552, 4600, 13, 70, 1659, 15630, 63, 329, 852, 10945, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 628, 220, 220, 220, 1303, 4946, 2393, 13, 198, 220, 220, 220, 2393, 11, 4808, 796, 467, 69, 430, 13, 7295, 13, 847, 13, 28311, 62, 9654, 62, 7753, 7, 6978, 11, 366, 81, 1600, 6407, 8, 628, 220, 220, 220, 1303, 29130, 1096, 10088, 16326, 13, 198, 220, 220, 220, 47125, 62, 404, 62, 83, 482, 641, 796, 17635, 198, 220, 220, 220, 329, 1627, 287, 2393, 13, 961, 6615, 33529, 198, 220, 220, 220, 220, 220, 220, 220, 1034, 62, 83, 482, 641, 796, 1627, 13, 35312, 7203, 366, 8, 198, 220, 220, 220, 220, 220, 220, 220, 329, 1034, 62, 30001, 287, 1034, 62, 83, 482, 641, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 1034, 62, 30001, 6624, 37082, 77, 1, 393, 1034, 62, 30001, 13, 33491, 7203, 33172, 366, 4943, 6624, 366, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 47125, 62, 404, 62, 83, 482, 641, 13, 33295, 7, 404, 62, 30001, 8, 628, 220, 220, 220, 1303, 968, 4732, 13, 198, 220, 220, 220, 30751, 62, 22866, 796, 23042, 263, 21947, 3419, 628, 220, 220, 220, 1303, 38240, 440, 12016, 284, 6179, 1352, 12879, 13, 198, 220, 220, 220, 1459, 62, 15630, 62, 46616, 62, 9630, 796, 657, 198, 220, 220, 220, 981, 1459, 62, 15630, 62, 46616, 62, 9630, 1279, 18896, 7, 15630, 62, 404, 62, 83, 482, 641, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 47125, 62, 46616, 796, 47125, 62, 404, 62, 83, 482, 641, 58, 14421, 62, 15630, 62, 46616, 62, 9630, 60, 198, 220, 220, 220, 220, 220, 220, 220, 611, 47125, 62, 46616, 6624, 43521, 25633, 62, 25216, 62, 10468, 62, 17513, 51, 2943, 16820, 62, 31054, 25633, 58, 18843, 1352, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 5974, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30751, 62, 22866, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 35946, 6030, 13, 47, 27143, 62, 12394, 7156, 1137, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 29130, 7, 30642, 6030, 13, 17513, 51, 2943, 16820, 11, 47125, 62, 46616, 11, 357, 6978, 11, 532, 16, 11, 532, 16, 828, 47125, 62, 46616, 828, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 493, 7, 15630, 62, 404, 62, 83, 482, 641, 58, 14421, 62, 15630, 62, 46616, 62, 9630, 1343, 352, 12962, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 15630, 62, 46616, 62, 9630, 15853, 362, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2555, 198, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 611, 47125, 62, 46616, 287, 11050, 51, 2943, 16820, 62, 31054, 25633, 62, 45, 29559, 62, 10468, 62, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 30751, 62, 22866, 13, 3575, 2024, 13, 33295, 7, 18843, 1352, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 35946, 6030, 13, 1268, 5446, 20913, 2149, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 29130, 7, 30642, 6030, 13, 17513, 51, 2943, 16820, 11, 47125, 62, 46616, 11, 357, 6978, 11, 532, 16, 11, 532, 16, 828, 47125, 62, 46616, 828, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 11050, 51, 2943, 16820, 62, 31054, 25633, 62, 45, 29559, 62, 10468, 62, 1268, 5446, 20913, 2149, 58, 15630, 62, 46616, 60, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 15306, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 27082, 35009, 11, 5855, 40778, 8189, 1600, 532, 16, 11, 532, 16, 828, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 30074, 10059, 18022, 8189, 12064, 532, 1391, 260, 1050, 7, 15630, 62, 46616, 38165, 40754, 6407, 8, 198, 220, 220, 220, 220, 220, 220, 220, 1459, 62, 15630, 62, 46616, 62, 9630, 15853, 352, 198, 220, 220, 220, 220, 220, 220, 220, 2555, 628, 220, 220, 220, 1303, 5660, 13, 198, 220, 220, 220, 30751, 62, 22866, 62, 10459, 796, 8090, 7, 48610, 62, 22866, 13, 3575, 2024, 8, 198, 220, 220, 220, 6179, 1352, 62, 5143, 7, 48610, 62, 22866, 62, 10459, 8, 628, 220, 220, 220, 1303, 13872, 2393, 13, 198, 220, 220, 220, 2393, 13, 19836, 3419, 628, 198, 2, 43749, 13, 198, 198, 4299, 537, 72, 62, 3919, 62, 853, 2886, 62, 18224, 62, 20500, 7, 46616, 25, 35946, 11, 2700, 62, 37023, 25, 20512, 796, 10352, 2599, 198, 220, 220, 220, 37227, 25156, 645, 7159, 3804, 4049, 3275, 284, 262, 43749, 13, 37227, 628, 220, 220, 220, 611, 10088, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2558, 81, 1040, 291, 35946, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 5994, 2198, 13, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 2558, 81, 1040, 291, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 63, 90, 1268, 5446, 20913, 2149, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 46616, 13, 3575, 392, 48999, 63, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 600, 81, 1040, 291, 815, 423, 517, 7159, 379, 262, 8931, 11, 475, 340, 373, 407, 9393, 2474, 8, 198, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 16876, 35946, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 5064, 63, 10088, 815, 423, 352, 4578, 379, 262, 8931, 11, 475, 340, 373, 407, 1043, 2474, 8, 198, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 8410, 35946, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 13047, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 63, 18227, 63, 10088, 815, 423, 352, 4578, 379, 262, 8931, 11, 475, 340, 373, 407, 1043, 2474, 8, 198, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 16185, 10088, 13, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 51, 2228, 284, 869, 645, 62, 853, 2886, 62, 18224, 62, 20500, 3419, 366, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1640, 10088, 326, 857, 407, 761, 7159, 0, 357, 6030, 2198, 263, 4049, 10091, 1, 628, 220, 220, 220, 1303, 1002, 356, 815, 2700, 8420, 13, 198, 220, 220, 220, 611, 2700, 62, 37023, 25, 198, 220, 220, 220, 220, 220, 220, 220, 8420, 7, 16, 8, 628, 198, 4299, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 7, 46616, 25, 35946, 11, 4578, 62, 9630, 25, 493, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 4036, 62, 4906, 25, 2099, 11, 2938, 62, 4906, 25, 2099, 11, 2700, 62, 37023, 25, 20512, 796, 10352, 2599, 198, 220, 220, 220, 37227, 25156, 10059, 4578, 2099, 3804, 4049, 3275, 284, 262, 43749, 13, 37227, 628, 220, 220, 220, 611, 10088, 13, 4906, 6624, 35946, 6030, 13, 1268, 5446, 20913, 2149, 25, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 318, 39098, 7, 46616, 13, 3575, 392, 11, 2558, 81, 1040, 291, 828, 366, 6030, 4049, 11, 30751, 1241, 4049, 1701, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 63, 90, 1268, 5446, 20913, 2149, 62, 9936, 47, 1546, 62, 10468, 62, 20608, 58, 46616, 13, 3575, 392, 48999, 63, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 600, 81, 1040, 291, 2938, 1391, 49140, 62, 9630, 92, 4578, 366, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 1462, 307, 351, 2099, 1391, 40319, 62, 4906, 5512, 475, 340, 468, 2099, 1391, 50039, 62, 4906, 92, 2474, 8, 198, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 5064, 25, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 63, 5064, 63, 10088, 2938, 2099, 1391, 40319, 62, 4906, 92, 475, 1392, 1391, 50039, 62, 4906, 92, 2474, 8, 198, 220, 220, 220, 1288, 361, 10088, 13, 4906, 6624, 35946, 6030, 13, 18227, 25, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 62, 19011, 1335, 7, 29391, 13, 34509, 5781, 11, 10088, 13, 30001, 13, 24886, 11, 366, 12331, 1600, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 277, 1, 63, 18227, 63, 10088, 2938, 2099, 1391, 40319, 62, 4906, 92, 475, 1392, 1391, 50039, 62, 4906, 92, 2474, 8, 198, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 10352, 11, 366, 51, 2228, 284, 869, 537, 72, 62, 49140, 62, 4906, 62, 18224, 62, 20500, 3419, 366, 3467, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 366, 1640, 6439, 10088, 0, 357, 6030, 2198, 263, 4049, 10091, 1, 628, 220, 220, 220, 611, 2700, 62, 37023, 25, 198, 220, 220, 220, 220, 220, 220, 220, 8420, 7, 16, 8, 628, 198, 4299, 537, 72, 62, 12102, 378, 62, 49140, 62, 31364, 7, 49140, 62, 31364, 25, 7343, 58, 2536, 12962, 4613, 7343, 58, 2536, 5974, 198, 220, 220, 220, 37227, 3254, 37051, 43749, 1822, 85, 357, 49140, 15879, 8, 37227, 628, 220, 220, 220, 1303, 6822, 326, 10811, 318, 597, 287, 262, 5923, 37094, 13, 198, 220, 220, 220, 6818, 18896, 7, 49140, 62, 31364, 8, 1875, 657, 11, 366, 1858, 318, 645, 2723, 357, 907, 489, 13, 9078, 8, 2393, 3108, 287, 262, 5923, 37094, 1, 628, 220, 220, 220, 1303, 3497, 4578, 15879, 1231, 2723, 7, 907, 489, 13, 9078, 8, 3108, 13, 198, 220, 220, 220, 4578, 62, 16737, 62, 34345, 25, 965, 796, 4578, 62, 31364, 58, 15, 60, 198, 220, 220, 220, 4578, 62, 31364, 796, 4578, 62, 31364, 58, 16, 47715, 628, 220, 220, 220, 1303, 3254, 20540, 5923, 37094, 13, 198, 220, 220, 220, 611, 18896, 7, 49140, 62, 31364, 8, 6624, 657, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 612, 318, 645, 7159, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 44506, 13, 26060, 62, 20500, 7, 49140, 62, 16737, 62, 34345, 8, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 5492, 1208, 2393, 3108, 284, 670, 351, 20262, 70, 1659, 393, 764, 70, 1659, 15630, 5299, 42501, 6407, 8, 198, 220, 220, 220, 1288, 361, 18896, 7, 49140, 62, 31364, 8, 6624, 352, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 2329, 530, 4578, 13, 628, 220, 220, 220, 220, 220, 220, 220, 611, 4578, 62, 31364, 58, 15, 60, 14512, 366, 16794, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 407, 1037, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 44506, 13, 26060, 62, 20500, 7, 49140, 62, 16737, 62, 34345, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 5492, 1208, 850, 21812, 706, 262, 2393, 3108, 40754, 6407, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 5438, 8748, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 44506, 13, 26060, 62, 20500, 7, 49140, 62, 16737, 62, 34345, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 29739, 13, 198, 220, 220, 220, 220, 220, 220, 220, 8420, 7, 15, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 8229, 3108, 355, 2723, 2393, 290, 1037, 357, 853, 85, 58, 15, 35944, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 14631, 1600, 4578, 62, 31364, 58, 15, 4357, 366, 8973, 198, 220, 220, 220, 1288, 361, 18896, 7, 49140, 62, 31364, 8, 6624, 362, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1475, 7254, 5923, 37094, 4129, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 1439, 12876, 13, 198, 220, 220, 220, 220, 220, 220, 220, 1441, 30138, 49140, 62, 31364, 11, 366, 8973, 198, 220, 220, 220, 1288, 361, 18896, 7, 49140, 62, 31364, 8, 6624, 513, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 743, 10574, 4578, 13, 628, 220, 220, 220, 220, 220, 220, 220, 611, 4578, 62, 31364, 58, 17, 60, 14512, 27444, 18217, 298, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 10574, 13, 628, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 44506, 13, 26060, 62, 20500, 7, 49140, 62, 16737, 62, 34345, 8, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 366, 52, 42072, 7159, 40754, 6407, 8, 628, 220, 220, 220, 1303, 8229, 2457, 5923, 37094, 13, 198, 220, 220, 220, 1441, 4578, 62, 31364, 628, 198, 4299, 537, 72, 62, 13000, 62, 4122, 33529, 198, 220, 220, 220, 37227, 21617, 966, 329, 262, 43749, 13, 37227, 628, 220, 220, 220, 1303, 3497, 290, 2198, 2546, 286, 537, 72, 4578, 15879, 13, 198, 220, 220, 220, 537, 72, 62, 49140, 62, 31364, 796, 537, 72, 62, 12102, 378, 62, 49140, 62, 31364, 7, 853, 85, 8, 198, 220, 220, 220, 6818, 18896, 7, 44506, 62, 49140, 62, 31364, 8, 6624, 513, 11, 366, 30074, 10059, 2546, 286, 4578, 15879, 526, 628, 220, 220, 220, 1303, 43749, 18634, 13, 198, 220, 220, 220, 537, 72, 62, 10459, 62, 6978, 11, 537, 72, 62, 7266, 21812, 11, 537, 72, 62, 18217, 298, 796, 537, 72, 62, 49140, 62, 31364, 198, 220, 220, 220, 537, 72, 62, 18217, 298, 25, 20512, 796, 20512, 7, 44506, 62, 18217, 298, 6624, 27444, 18217, 298, 4943, 628, 220, 220, 220, 1303, 19134, 3275, 13, 198, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 44506, 13, 86, 9571, 62, 20500, 3419, 628, 220, 220, 220, 1303, 8778, 2723, 290, 2198, 2546, 286, 340, 13, 198, 220, 220, 220, 9639, 62, 7753, 796, 6045, 198, 220, 220, 220, 611, 537, 72, 62, 7266, 21812, 287, 5855, 5143, 1600, 366, 34960, 1600, 366, 29412, 1600, 366, 39455, 1600, 366, 5589, 576, 1, 2599, 198, 220, 220, 220, 220, 220, 220, 220, 9639, 62, 7753, 796, 3440, 62, 10459, 62, 6738, 62, 7753, 7, 44506, 62, 10459, 62, 6978, 8, 198, 220, 220, 220, 220, 220, 220, 220, 6818, 18896, 7, 14578, 62, 7753, 8, 6624, 362, 11, 366, 30074, 10059, 1366, 422, 9639, 2393, 526, 628, 220, 220, 220, 611, 537, 72, 62, 7266, 21812, 6624, 366, 5143, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 6179, 378, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 10459, 11, 537, 72, 62, 22866, 796, 9639, 62, 7753, 628, 220, 220, 220, 220, 220, 220, 220, 6179, 1352, 62, 5143, 7, 44506, 62, 10459, 11, 537, 72, 62, 22866, 13, 31673, 62, 1525, 83, 451, 2433, 62, 7857, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 17912, 12360, 60, 9220, 19990, 90, 12093, 12453, 7, 44506, 62, 10459, 62, 6978, 38165, 7879, 373, 16173, 2474, 8, 198, 220, 220, 220, 1288, 361, 537, 72, 62, 7266, 21812, 6624, 366, 34960, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 4823, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 2723, 422, 9639, 2393, 13, 198, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 10459, 11, 4808, 796, 9639, 62, 7753, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 2980, 378, 4823, 2393, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 34960, 13, 13564, 7, 44506, 62, 10459, 11, 537, 72, 62, 10459, 62, 6978, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 17912, 12360, 60, 764, 26518, 2393, 19990, 90, 12093, 12453, 7, 44506, 62, 10459, 62, 6978, 8, 27422, 26518, 7879, 7560, 2474, 8, 198, 220, 220, 220, 1288, 361, 537, 72, 62, 7266, 21812, 6624, 366, 29412, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 21015, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 2723, 290, 4732, 422, 9639, 2393, 13, 198, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 10459, 11, 537, 72, 62, 22866, 796, 9639, 62, 7753, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 2980, 378, 21015, 2393, 13, 198, 220, 220, 220, 220, 220, 220, 220, 21015, 62, 8612, 378, 7, 44506, 62, 10459, 11, 537, 72, 62, 22866, 11, 537, 72, 62, 10459, 62, 6978, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 17912, 12360, 60, 764, 9078, 2393, 19990, 90, 12093, 12453, 7, 44506, 62, 10459, 62, 6978, 8, 27422, 9078, 7879, 7560, 2474, 8, 198, 220, 220, 220, 1288, 361, 537, 72, 62, 7266, 21812, 6624, 366, 39455, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 10285, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 2723, 422, 9639, 2393, 13, 198, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 10459, 11, 4808, 796, 9639, 62, 7753, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 360, 931, 3601, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 39455, 13, 39455, 7, 44506, 62, 10459, 13, 3575, 2024, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 17912, 12360, 60, 9220, 19990, 90, 12093, 12453, 7, 44506, 62, 10459, 62, 6978, 38165, 7879, 373, 10285, 10398, 2474, 8, 198, 220, 220, 220, 1288, 361, 537, 72, 62, 7266, 21812, 6624, 366, 5589, 576, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 17632, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3497, 2723, 422, 9639, 2393, 13, 198, 220, 220, 220, 220, 220, 220, 220, 537, 72, 62, 10459, 11, 537, 72, 62, 22866, 796, 9639, 62, 7753, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 3082, 576, 13, 198, 220, 220, 220, 220, 220, 220, 220, 18022, 8189, 62, 6978, 796, 17632, 62, 26327, 8189, 7, 44506, 62, 10459, 11, 537, 72, 62, 22866, 11, 537, 72, 62, 10459, 62, 6978, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 17912, 12360, 60, 9220, 19990, 90, 12093, 12453, 7, 44506, 62, 10459, 62, 6978, 38165, 7879, 373, 14102, 284, 19990, 90, 12093, 12453, 7, 26327, 8189, 62, 6978, 38165, 7879, 2474, 8, 198, 220, 220, 220, 1288, 361, 537, 72, 62, 7266, 21812, 6624, 366, 41049, 1298, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 428, 318, 12260, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 8393, 1133, 13, 198, 220, 220, 220, 220, 220, 220, 220, 12260, 62, 26327, 8189, 7, 44506, 62, 10459, 62, 6978, 8, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 611, 407, 537, 72, 62, 18217, 298, 25, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 3601, 7, 69, 17912, 12360, 60, 9220, 19990, 90, 12093, 12453, 7, 44506, 62, 10459, 62, 6978, 38165, 7879, 373, 10945, 2474, 8, 198, 220, 220, 220, 2073, 25, 198, 220, 220, 220, 220, 220, 220, 220, 1303, 1002, 6439, 850, 21812, 13, 628, 220, 220, 220, 220, 220, 220, 220, 1303, 16000, 13, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 10057, 82, 13, 44506, 13, 26060, 62, 20500, 7, 834, 7753, 834, 8, 198, 220, 220, 220, 220, 220, 220, 220, 467, 69, 430, 13, 7295, 13, 48277, 13, 20500, 7203, 12331, 1600, 277, 1, 20035, 850, 21812, 4600, 90, 44506, 62, 7266, 21812, 92, 63, 2474, 8, 628, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 198, 220, 220, 220, 537, 72, 62, 13000, 62, 4122, 3419, 198 ]
1.961445
70,238
# Global settings for photologue example project. import os DEBUG = TEMPLATE_DEBUG = True # Top level folder - the one created by the startproject command. TOP_FOLDER = os.path.abspath(os.path.join(os.path.dirname(__file__), '..')) ADMINS = () MANAGERS = ADMINS # Default dev database is Sqlite. In production I use postgres. DATABASES = { 'default': { 'ENGINE': 'django.db.backends.sqlite3', 'NAME': os.path.join(TOP_FOLDER, 'database.sql3') } } TIME_ZONE = 'UTC' # Language code for this installation. All choices can be found here: # http://www.i18nguy.com/unicode/language-identifiers.html LANGUAGE_CODE = 'en-gb' SITE_ID = 1 USE_I18N = True USE_L10N = True # TODO: setting this to True in Django 1.4 causes runtime warnings, when 1.4 # is end-of-lined in 2014 we can change this setting to True. USE_TZ = False MEDIA_ROOT = os.path.join(TOP_FOLDER, 'public', 'media') MEDIA_URL = '/media/' STATIC_ROOT = os.path.join(TOP_FOLDER, 'public', 'static') STATIC_URL = '/static/' # Additional locations of static files STATICFILES_DIRS = ( os.path.join(TOP_FOLDER, 'example_project/static'), ) # List of finder classes that know how to find static files in # various locations. STATICFILES_FINDERS = ( 'django.contrib.staticfiles.finders.FileSystemFinder', 'django.contrib.staticfiles.finders.AppDirectoriesFinder', ) # Make this unique, and don't share it with anybody. SECRET_KEY = '3p0f5q)l$=gt++#z0inpfh%bm_ujl6(-yogbzw2)(xea48@70d' # List of callables that know how to import templates from various sources. TEMPLATE_LOADERS = ( 'django.template.loaders.filesystem.Loader', 'django.template.loaders.app_directories.Loader', ) MIDDLEWARE_CLASSES = [ 'django.middleware.common.CommonMiddleware', 'django.contrib.sessions.middleware.SessionMiddleware', 'django.contrib.auth.middleware.AuthenticationMiddleware', 'django.contrib.messages.middleware.MessageMiddleware', ] ROOT_URLCONF = 'example_project.urls' from photologue import PHOTOLOGUE_TEMPLATE_DIR TEMPLATE_DIRS = ( os.path.join(TOP_FOLDER, 'example_project/templates'), PHOTOLOGUE_TEMPLATE_DIR ) TEMPLATE_CONTEXT_PROCESSORS = ( 'django.contrib.auth.context_processors.auth', 'django.contrib.messages.context_processors.messages', 'django.core.context_processors.debug', 'django.core.context_processors.i18n', 'django.core.context_processors.media', 'django.core.context_processors.static', 'django.core.context_processors.request', ) FIXTURE_DIRS = ( os.path.join(TOP_FOLDER, 'example_project/fixtures'), ) INSTALLED_APPS = [ 'django.contrib.auth', 'django.contrib.contenttypes', 'django.contrib.sessions', 'django.contrib.sites', 'django.contrib.messages', 'django.contrib.staticfiles', 'django.contrib.admin', 'photologue', 'example_project', 'south', ] SOUTH_TESTS_MIGRATE = False
[ 2, 8060, 6460, 329, 2825, 39795, 1672, 1628, 13, 198, 198, 11748, 28686, 198, 198, 30531, 796, 309, 3620, 6489, 6158, 62, 30531, 796, 6407, 198, 198, 2, 5849, 1241, 9483, 532, 262, 530, 2727, 416, 262, 923, 16302, 3141, 13, 198, 35222, 62, 37, 3535, 14418, 796, 28686, 13, 6978, 13, 397, 2777, 776, 7, 418, 13, 6978, 13, 22179, 7, 418, 13, 6978, 13, 15908, 3672, 7, 834, 7753, 834, 828, 705, 492, 6, 4008, 198, 198, 2885, 44, 20913, 796, 7499, 198, 198, 10725, 4760, 4877, 796, 5984, 44, 20913, 198, 198, 2, 15161, 1614, 6831, 318, 311, 13976, 578, 13, 554, 3227, 314, 779, 1281, 34239, 13, 198, 35, 1404, 6242, 1921, 1546, 796, 1391, 198, 220, 220, 220, 705, 12286, 10354, 1391, 198, 220, 220, 220, 220, 220, 220, 220, 705, 26808, 8881, 10354, 705, 28241, 14208, 13, 9945, 13, 1891, 2412, 13, 25410, 578, 18, 3256, 198, 220, 220, 220, 220, 220, 220, 220, 705, 20608, 10354, 28686, 13, 6978, 13, 22179, 7, 35222, 62, 37, 3535, 14418, 11, 705, 48806, 13, 25410, 18, 11537, 198, 220, 220, 220, 1782, 198, 92, 198, 198, 34694, 62, 57, 11651, 796, 705, 17429, 6, 198, 198, 2, 15417, 2438, 329, 428, 9988, 13, 1439, 7747, 460, 307, 1043, 994, 25, 198, 2, 2638, 1378, 2503, 13, 72, 1507, 782, 4669, 13, 785, 14, 46903, 1098, 14, 16129, 12, 738, 13350, 13, 6494, 198, 43, 15567, 52, 11879, 62, 34, 16820, 796, 705, 268, 12, 22296, 6, 198, 198, 50, 12709, 62, 2389, 796, 352, 198, 198, 19108, 62, 40, 1507, 45, 796, 6407, 198, 19108, 62, 43, 940, 45, 796, 6407, 198, 2, 16926, 46, 25, 4634, 428, 284, 6407, 287, 37770, 352, 13, 19, 5640, 19124, 14601, 11, 618, 352, 13, 19, 198, 2, 318, 886, 12, 1659, 12, 10837, 287, 1946, 356, 460, 1487, 428, 4634, 284, 6407, 13, 198, 19108, 62, 51, 57, 796, 10352, 198, 198, 30733, 3539, 62, 13252, 2394, 796, 28686, 13, 6978, 13, 22179, 7, 35222, 62, 37, 3535, 14418, 11, 705, 11377, 3256, 705, 11431, 11537, 198, 30733, 3539, 62, 21886, 796, 31051, 11431, 14, 6, 198, 198, 35744, 2149, 62, 13252, 2394, 796, 28686, 13, 6978, 13, 22179, 7, 35222, 62, 37, 3535, 14418, 11, 705, 11377, 3256, 705, 12708, 11537, 198, 35744, 2149, 62, 21886, 796, 31051, 12708, 14, 6, 198, 198, 2, 15891, 7064, 286, 9037, 3696, 198, 35744, 2149, 46700, 1546, 62, 34720, 50, 796, 357, 198, 220, 220, 220, 28686, 13, 6978, 13, 22179, 7, 35222, 62, 37, 3535, 14418, 11, 705, 20688, 62, 16302, 14, 12708, 33809, 198, 8, 198, 198, 2, 7343, 286, 1064, 263, 6097, 326, 760, 703, 284, 1064, 9037, 3696, 287, 198, 2, 2972, 7064, 13, 198, 35744, 2149, 46700, 1546, 62, 37, 12115, 4877, 796, 357, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 12708, 16624, 13, 19796, 364, 13, 8979, 11964, 37, 5540, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 12708, 16624, 13, 19796, 364, 13, 4677, 13470, 1749, 37, 5540, 3256, 198, 8, 198, 198, 2, 6889, 428, 3748, 11, 290, 836, 470, 2648, 340, 351, 9599, 13, 198, 23683, 26087, 62, 20373, 796, 705, 18, 79, 15, 69, 20, 80, 8, 75, 3, 28, 13655, 4880, 2, 89, 15, 259, 79, 69, 71, 4, 20475, 62, 84, 20362, 21, 32590, 88, 519, 65, 89, 86, 17, 5769, 87, 18213, 2780, 31, 2154, 67, 6, 198, 198, 2, 7343, 286, 869, 2977, 326, 760, 703, 284, 1330, 24019, 422, 2972, 4237, 13, 198, 51, 3620, 6489, 6158, 62, 35613, 4877, 796, 357, 198, 220, 220, 220, 705, 28241, 14208, 13, 28243, 13, 2220, 364, 13, 16624, 6781, 13, 17401, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 28243, 13, 2220, 364, 13, 1324, 62, 12942, 1749, 13, 17401, 3256, 198, 8, 198, 198, 44, 2389, 35, 2538, 33746, 62, 31631, 1546, 796, 685, 198, 220, 220, 220, 705, 28241, 14208, 13, 27171, 1574, 13, 11321, 13, 17227, 34621, 1574, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 82, 6202, 13, 27171, 1574, 13, 36044, 34621, 1574, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 18439, 13, 27171, 1574, 13, 47649, 3299, 34621, 1574, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 37348, 1095, 13, 27171, 1574, 13, 12837, 34621, 1574, 3256, 198, 60, 198, 198, 13252, 2394, 62, 4261, 5639, 1340, 37, 796, 705, 20688, 62, 16302, 13, 6371, 82, 6, 198, 198, 6738, 2825, 39795, 1330, 9370, 2394, 33462, 8924, 62, 51, 3620, 6489, 6158, 62, 34720, 198, 51, 3620, 6489, 6158, 62, 34720, 50, 796, 357, 198, 220, 220, 220, 28686, 13, 6978, 13, 22179, 7, 35222, 62, 37, 3535, 14418, 11, 705, 20688, 62, 16302, 14, 11498, 17041, 33809, 198, 220, 220, 220, 9370, 2394, 33462, 8924, 62, 51, 3620, 6489, 6158, 62, 34720, 198, 8, 198, 198, 51, 3620, 6489, 6158, 62, 10943, 32541, 62, 4805, 4503, 7597, 20673, 796, 357, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 18439, 13, 22866, 62, 14681, 669, 13, 18439, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 37348, 1095, 13, 22866, 62, 14681, 669, 13, 37348, 1095, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 7295, 13, 22866, 62, 14681, 669, 13, 24442, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 7295, 13, 22866, 62, 14681, 669, 13, 72, 1507, 77, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 7295, 13, 22866, 62, 14681, 669, 13, 11431, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 7295, 13, 22866, 62, 14681, 669, 13, 12708, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 7295, 13, 22866, 62, 14681, 669, 13, 25927, 3256, 198, 8, 198, 198, 47084, 51, 11335, 62, 34720, 50, 796, 357, 198, 220, 220, 220, 28686, 13, 6978, 13, 22179, 7, 35222, 62, 37, 3535, 14418, 11, 705, 20688, 62, 16302, 14, 69, 25506, 33809, 198, 8, 198, 198, 38604, 7036, 1961, 62, 2969, 3705, 796, 685, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 18439, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 11299, 19199, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 82, 6202, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 49315, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 37348, 1095, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 12708, 16624, 3256, 198, 220, 220, 220, 705, 28241, 14208, 13, 3642, 822, 13, 28482, 3256, 198, 220, 220, 220, 705, 38611, 39795, 3256, 198, 220, 220, 220, 705, 20688, 62, 16302, 3256, 198, 220, 220, 220, 705, 35782, 3256, 198, 60, 628, 198, 50, 2606, 4221, 62, 51, 1546, 4694, 62, 44, 3528, 49, 6158, 796, 10352, 628 ]
2.514706
1,156
# Learning rate scheduler
[ 2, 18252, 2494, 6038, 18173, 201, 198, 201, 198 ]
3.222222
9
import asyncio import dataclasses import itertools import logging import pathlib import sys import traceback import typing from typing import Any, Callable, Dict, FrozenSet, Iterable, Set, Text, Tuple, Type import gamla import immutables import toposort import typeguard from gamla.optimized import async_functions as opt_async_gamla from gamla.optimized import sync as opt_gamla from computation_graph import base_types, graph _toposort_nodes: Callable[ [base_types.GraphType], Tuple[FrozenSet[base_types.ComputationNode], ...] ] = opt_gamla.compose_left( opt_gamla.groupby_many(_get_edge_sources), opt_gamla.valmap( opt_gamla.compose_left(opt_gamla.map(base_types.edge_destination), set) ), _transpose_graph, toposort.toposort, opt_gamla.map(frozenset), tuple, ) _incoming_edge_options = opt_gamla.compose_left( graph.get_incoming_edges_for_node, gamla.after( opt_gamla.compose_left( opt_gamla.groupby(base_types.edge_key), opt_gamla.valmap(gamla.sort_by(gamla.attrgetter("priority"))), dict.values, opt_gamla.star(itertools.product), opt_gamla.map(tuple), ) ), ) _get_args_helper = opt_gamla.compose_left( opt_gamla.keyfilter(gamla.attrgetter("args")), dict.values, gamla.head, opt_gamla.maptuple(gamla.attrgetter("result")), ) _get_inner_kwargs = opt_gamla.compose_left( opt_gamla.keyfilter(base_types.edge_key), dict.items, opt_gamla.groupby(opt_gamla.compose_left(gamla.head, base_types.edge_key)), opt_gamla.valmap( opt_gamla.compose_left( gamla.head, gamla.second, gamla.head, gamla.attrgetter("result") ) ), ) _DecisionsType = Dict[base_types.ComputationNode, base_types.ComputationResult] _ResultToDecisionsType = Dict[base_types.ComputationResult, _DecisionsType] _IntermediaryResults = Dict[base_types.ComputationNode, _ResultToDecisionsType] class _NotCoherent(Exception): """This exception signals that for a specific set of incoming node edges not all paths agree on the ComputationResult""" NodeToResults = Callable[[base_types.ComputationNode], _ResultToDecisionsType] _get_kwargs_from_edges = opt_gamla.compose_left( opt_gamla.map(base_types.edge_key), opt_gamla.remove(gamla.equals(None)), tuple ) _ChoiceOfOutputForNode = Tuple[ Tuple[base_types.ComputationResult, _DecisionsType], base_types.ComputationNode, ] @gamla.curry _choice_to_value: Callable[ [_ChoiceOfOutputForNode], base_types.ComputationResult ] = opt_gamla.compose_left(gamla.head, gamla.head) _decisions_from_value_choices = opt_gamla.compose_left( gamla.concat, gamla.bifurcate( opt_gamla.compose_left( opt_gamla.map(opt_gamla.compose_left(gamla.head, gamla.second)), opt_gamla.reduce( opt_gamla.merge_with_reducer(_check_equal_and_take_one), immutables.Map(), ), ), opt_gamla.mapdict(opt_gamla.juxt(gamla.second, _choice_to_value)), ), opt_gamla.merge, ) _SingleNodeSideEffect = Callable[[base_types.ComputationNode, Any], None] def _dag_layer_reduce( f: Callable[ [_IntermediaryResults, FrozenSet[base_types.ComputationNode]], _IntermediaryResults, ] ) -> Callable[[base_types.GraphType], _IntermediaryResults]: """Directed acyclic graph reduction.""" return gamla.compose_left( _toposort_nodes, gamla.reduce_curried(f, immutables.Map()) ) _create_node_run_options = opt_gamla.compose_left( gamla.pack, gamla.explode(1), opt_gamla.mapcat( opt_gamla.compose_left( gamla.bifurcate( gamla.head, gamla.second, opt_gamla.star(lambda _, y, z: z(y)) ), gamla.explode(2), ) ), ) @gamla.curry _is_graph_async = opt_gamla.compose_left( opt_gamla.mapcat(lambda edge: (edge.source, *edge.args)), opt_gamla.remove(gamla.equals(None)), opt_gamla.map(gamla.attrgetter("func")), gamla.anymap(asyncio.iscoroutinefunction), ) to_callable_with_side_effect = gamla.curry( _to_callable_with_side_effect_for_single_and_multiple )(_type_check) # Use the second line if you want to see the winning path in the computation graph (a little slower). to_callable = to_callable_with_side_effect(gamla.just(gamla.just(None))) # to_callable = to_callable_with_side_effect(graphviz.computation_trace('utterance_computation.dot'))
[ 11748, 30351, 952, 198, 11748, 4818, 330, 28958, 198, 11748, 340, 861, 10141, 198, 11748, 18931, 198, 11748, 3108, 8019, 198, 11748, 25064, 198, 11748, 12854, 1891, 198, 11748, 19720, 198, 6738, 19720, 1330, 4377, 11, 4889, 540, 11, 360, 713, 11, 23673, 7248, 11, 40806, 540, 11, 5345, 11, 8255, 11, 309, 29291, 11, 5994, 198, 198, 11748, 9106, 5031, 198, 11748, 2296, 315, 2977, 198, 11748, 1353, 418, 419, 198, 11748, 2099, 14864, 198, 6738, 9106, 5031, 13, 40085, 1143, 1330, 30351, 62, 12543, 2733, 355, 2172, 62, 292, 13361, 62, 28483, 5031, 198, 6738, 9106, 5031, 13, 40085, 1143, 1330, 17510, 355, 2172, 62, 28483, 5031, 198, 198, 6738, 29964, 62, 34960, 1330, 2779, 62, 19199, 11, 4823, 628, 628, 198, 198, 62, 4852, 418, 419, 62, 77, 4147, 25, 4889, 540, 58, 198, 220, 220, 220, 685, 8692, 62, 19199, 13, 37065, 6030, 4357, 309, 29291, 58, 37, 42005, 7248, 58, 8692, 62, 19199, 13, 5377, 1996, 341, 19667, 4357, 2644, 60, 198, 60, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8094, 1525, 62, 21834, 28264, 1136, 62, 14907, 62, 82, 2203, 828, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 2100, 8899, 7, 198, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 8738, 62, 28483, 5031, 13, 8899, 7, 8692, 62, 19199, 13, 14907, 62, 16520, 1883, 828, 900, 8, 198, 220, 220, 220, 10612, 198, 220, 220, 220, 4808, 7645, 3455, 62, 34960, 11, 198, 220, 220, 220, 1353, 418, 419, 13, 4852, 418, 419, 11, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 7, 69, 305, 8247, 316, 828, 198, 220, 220, 220, 46545, 11, 198, 8, 628, 198, 198, 62, 259, 4976, 62, 14907, 62, 25811, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 4823, 13, 1136, 62, 259, 4976, 62, 276, 3212, 62, 1640, 62, 17440, 11, 198, 220, 220, 220, 9106, 5031, 13, 8499, 7, 198, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8094, 1525, 7, 8692, 62, 19199, 13, 14907, 62, 2539, 828, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 2100, 8899, 7, 28483, 5031, 13, 30619, 62, 1525, 7, 28483, 5031, 13, 35226, 1136, 353, 7203, 49336, 48774, 828, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 8633, 13, 27160, 11, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 7364, 7, 270, 861, 10141, 13, 11167, 828, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 7, 83, 29291, 828, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 10612, 198, 8, 198, 198, 62, 1136, 62, 22046, 62, 2978, 525, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 2539, 24455, 7, 28483, 5031, 13, 35226, 1136, 353, 7203, 22046, 4943, 828, 198, 220, 220, 220, 8633, 13, 27160, 11, 198, 220, 220, 220, 9106, 5031, 13, 2256, 11, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 76, 2373, 29291, 7, 28483, 5031, 13, 35226, 1136, 353, 7203, 20274, 4943, 828, 198, 8, 628, 628, 198, 198, 62, 1136, 62, 5083, 62, 46265, 22046, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 2539, 24455, 7, 8692, 62, 19199, 13, 14907, 62, 2539, 828, 198, 220, 220, 220, 8633, 13, 23814, 11, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8094, 1525, 7, 8738, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 28483, 5031, 13, 2256, 11, 2779, 62, 19199, 13, 14907, 62, 2539, 36911, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 2100, 8899, 7, 198, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9106, 5031, 13, 2256, 11, 9106, 5031, 13, 12227, 11, 9106, 5031, 13, 2256, 11, 9106, 5031, 13, 35226, 1136, 353, 7203, 20274, 4943, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 10612, 198, 8, 628, 198, 62, 10707, 3279, 6030, 796, 360, 713, 58, 8692, 62, 19199, 13, 5377, 1996, 341, 19667, 11, 2779, 62, 19199, 13, 5377, 1996, 341, 23004, 60, 198, 62, 23004, 2514, 10707, 3279, 6030, 796, 360, 713, 58, 8692, 62, 19199, 13, 5377, 1996, 341, 23004, 11, 4808, 10707, 3279, 6030, 60, 198, 62, 9492, 2379, 560, 25468, 796, 360, 713, 58, 8692, 62, 19199, 13, 5377, 1996, 341, 19667, 11, 4808, 23004, 2514, 10707, 3279, 6030, 60, 628, 198, 4871, 4808, 3673, 7222, 8334, 7, 16922, 2599, 198, 220, 220, 220, 37227, 1212, 6631, 10425, 326, 329, 257, 2176, 900, 286, 15619, 198, 220, 220, 220, 10139, 13015, 407, 477, 13532, 4236, 319, 262, 22476, 341, 23004, 37811, 628, 198, 198, 19667, 2514, 25468, 796, 4889, 540, 30109, 8692, 62, 19199, 13, 5377, 1996, 341, 19667, 4357, 4808, 23004, 2514, 10707, 3279, 6030, 60, 628, 198, 198, 62, 1136, 62, 46265, 22046, 62, 6738, 62, 276, 3212, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 7, 8692, 62, 19199, 13, 14907, 62, 2539, 828, 2172, 62, 28483, 5031, 13, 28956, 7, 28483, 5031, 13, 4853, 874, 7, 14202, 36911, 46545, 198, 8, 628, 198, 198, 62, 46770, 5189, 26410, 1890, 19667, 796, 309, 29291, 58, 198, 220, 220, 220, 309, 29291, 58, 8692, 62, 19199, 13, 5377, 1996, 341, 23004, 11, 4808, 10707, 3279, 6030, 4357, 2779, 62, 19199, 13, 5377, 1996, 341, 19667, 11, 198, 60, 628, 198, 31, 28483, 5031, 13, 66, 16682, 628, 628, 198, 62, 25541, 62, 1462, 62, 8367, 25, 4889, 540, 58, 198, 220, 220, 220, 685, 62, 46770, 5189, 26410, 1890, 19667, 4357, 2779, 62, 19199, 13, 5377, 1996, 341, 23004, 198, 60, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 28483, 5031, 13, 2256, 11, 9106, 5031, 13, 2256, 8, 198, 198, 62, 12501, 3279, 62, 6738, 62, 8367, 62, 6679, 1063, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 9106, 5031, 13, 1102, 9246, 11, 198, 220, 220, 220, 9106, 5031, 13, 65, 361, 333, 66, 378, 7, 198, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 7, 8738, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 28483, 5031, 13, 2256, 11, 9106, 5031, 13, 12227, 36911, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 445, 7234, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 647, 469, 62, 4480, 62, 445, 48915, 28264, 9122, 62, 40496, 62, 392, 62, 20657, 62, 505, 828, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 2296, 315, 2977, 13, 13912, 22784, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 11600, 7, 8738, 62, 28483, 5031, 13, 14396, 742, 7, 28483, 5031, 13, 12227, 11, 4808, 25541, 62, 1462, 62, 8367, 36911, 198, 220, 220, 220, 10612, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 647, 469, 11, 198, 8, 628, 628, 628, 628, 198, 198, 62, 28008, 19667, 24819, 18610, 796, 4889, 540, 30109, 8692, 62, 19199, 13, 5377, 1996, 341, 19667, 11, 4377, 4357, 6045, 60, 628, 628, 198, 198, 4299, 4808, 67, 363, 62, 29289, 62, 445, 7234, 7, 198, 220, 220, 220, 277, 25, 4889, 540, 58, 198, 220, 220, 220, 220, 220, 220, 220, 685, 62, 9492, 2379, 560, 25468, 11, 23673, 7248, 58, 8692, 62, 19199, 13, 5377, 1996, 341, 19667, 60, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 4808, 9492, 2379, 560, 25468, 11, 198, 220, 220, 220, 2361, 198, 8, 4613, 4889, 540, 30109, 8692, 62, 19199, 13, 37065, 6030, 4357, 4808, 9492, 2379, 560, 25468, 5974, 198, 220, 220, 220, 37227, 13470, 276, 936, 88, 565, 291, 4823, 7741, 526, 15931, 198, 220, 220, 220, 1441, 9106, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 220, 220, 220, 220, 4808, 4852, 418, 419, 62, 77, 4147, 11, 9106, 5031, 13, 445, 7234, 62, 22019, 2228, 7, 69, 11, 2296, 315, 2977, 13, 13912, 28955, 198, 220, 220, 220, 1267, 628, 198, 198, 62, 17953, 62, 17440, 62, 5143, 62, 25811, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 9106, 5031, 13, 8002, 11, 198, 220, 220, 220, 9106, 5031, 13, 20676, 1098, 7, 16, 828, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 9246, 7, 198, 220, 220, 220, 220, 220, 220, 220, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9106, 5031, 13, 65, 361, 333, 66, 378, 7, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9106, 5031, 13, 2256, 11, 9106, 5031, 13, 12227, 11, 2172, 62, 28483, 5031, 13, 7364, 7, 50033, 4808, 11, 331, 11, 1976, 25, 1976, 7, 88, 4008, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 10612, 198, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 9106, 5031, 13, 20676, 1098, 7, 17, 828, 198, 220, 220, 220, 220, 220, 220, 220, 1267, 198, 220, 220, 220, 10612, 198, 8, 628, 198, 198, 31, 28483, 5031, 13, 66, 16682, 628, 198, 198, 62, 271, 62, 34960, 62, 292, 13361, 796, 2172, 62, 28483, 5031, 13, 785, 3455, 62, 9464, 7, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 9246, 7, 50033, 5743, 25, 357, 14907, 13, 10459, 11, 1635, 14907, 13, 22046, 36911, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 28956, 7, 28483, 5031, 13, 4853, 874, 7, 14202, 36911, 198, 220, 220, 220, 2172, 62, 28483, 5031, 13, 8899, 7, 28483, 5031, 13, 35226, 1136, 353, 7203, 20786, 4943, 828, 198, 220, 220, 220, 9106, 5031, 13, 1092, 8899, 7, 292, 13361, 952, 13, 2304, 273, 28399, 8818, 828, 198, 8, 628, 628, 198, 1462, 62, 13345, 540, 62, 4480, 62, 1589, 62, 10760, 796, 9106, 5031, 13, 66, 16682, 7, 198, 220, 220, 220, 4808, 1462, 62, 13345, 540, 62, 4480, 62, 1589, 62, 10760, 62, 1640, 62, 29762, 62, 392, 62, 48101, 198, 5769, 62, 4906, 62, 9122, 8, 198, 198, 2, 5765, 262, 1218, 1627, 611, 345, 765, 284, 766, 262, 5442, 3108, 287, 262, 29964, 4823, 357, 64, 1310, 13611, 737, 198, 1462, 62, 13345, 540, 796, 284, 62, 13345, 540, 62, 4480, 62, 1589, 62, 10760, 7, 28483, 5031, 13, 3137, 7, 28483, 5031, 13, 3137, 7, 14202, 22305, 198, 2, 284, 62, 13345, 540, 796, 284, 62, 13345, 540, 62, 4480, 62, 1589, 62, 10760, 7, 34960, 85, 528, 13, 785, 1996, 341, 62, 40546, 10786, 10381, 590, 62, 785, 1996, 341, 13, 26518, 6, 4008, 628 ]
2.300254
1,965
from django.db import models from django.contrib.auth.models import User from django.utils import timezone # Create your models here.
[ 6738, 42625, 14208, 13, 9945, 1330, 4981, 198, 6738, 42625, 14208, 13, 3642, 822, 13, 18439, 13, 27530, 1330, 11787, 198, 6738, 42625, 14208, 13, 26791, 1330, 640, 11340, 628, 198, 2, 13610, 534, 4981, 994, 13 ]
3.648649
37
import torch import numpy as np import matplotlib.pyplot as plt import pandas as pd import seaborn as sns import sys import matplotlib font = {"size": 30} matplotlib.rc("font", **font) matplotlib.rcParams["text.usetex"] = True n_gene_sets_to_name = 2 results_df = pd.read_csv("./out/st_avg_gene_variance_gsea_results.csv", index_col=0) results_df["logpval"] = -np.log10(results_df.padj.values) plt.figure(figsize=(7, 7)) sns.scatterplot(data=results_df, x="NES", y="logpval", color="black", edgecolor=None) plt.xlabel("Enrichment score") plt.ylabel(r"$-\log_{10}$(p-val)") sorted_idx = np.argsort(-results_df.NES.values) for ii in range(n_gene_sets_to_name): gs_name = " ".join(results_df.pathway.values[sorted_idx[ii]].split("_")[1:]) plt.text( s=gs_name, x=results_df.NES.values[sorted_idx[ii]], y=results_df.logpval.values[sorted_idx[ii]], ha="right", ) plt.tight_layout() plt.savefig("./out/st_avg_gene_variance_gsea_results.png") plt.show() import ipdb ipdb.set_trace()
[ 11748, 28034, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 2603, 29487, 8019, 13, 9078, 29487, 355, 458, 83, 198, 11748, 19798, 292, 355, 279, 67, 198, 198, 11748, 384, 397, 1211, 355, 3013, 82, 198, 11748, 25064, 198, 198, 11748, 2603, 29487, 8019, 198, 198, 10331, 796, 19779, 7857, 1298, 1542, 92, 198, 6759, 29487, 8019, 13, 6015, 7203, 10331, 1600, 12429, 10331, 8, 198, 6759, 29487, 8019, 13, 6015, 10044, 4105, 14692, 5239, 13, 385, 316, 1069, 8973, 796, 6407, 198, 198, 77, 62, 70, 1734, 62, 28709, 62, 1462, 62, 3672, 796, 362, 198, 198, 43420, 62, 7568, 796, 279, 67, 13, 961, 62, 40664, 7, 1911, 14, 448, 14, 301, 62, 615, 70, 62, 70, 1734, 62, 25641, 590, 62, 70, 8583, 62, 43420, 13, 40664, 1600, 6376, 62, 4033, 28, 15, 8, 198, 43420, 62, 7568, 14692, 6404, 79, 2100, 8973, 796, 532, 37659, 13, 6404, 940, 7, 43420, 62, 7568, 13, 15636, 73, 13, 27160, 8, 198, 198, 489, 83, 13, 26875, 7, 5647, 7857, 16193, 22, 11, 767, 4008, 198, 82, 5907, 13, 1416, 1436, 29487, 7, 7890, 28, 43420, 62, 7568, 11, 2124, 2625, 37379, 1600, 331, 2625, 6404, 79, 2100, 1600, 3124, 2625, 13424, 1600, 5743, 8043, 28, 14202, 8, 198, 489, 83, 13, 87, 18242, 7203, 4834, 7527, 434, 4776, 4943, 198, 489, 83, 13, 2645, 9608, 7, 81, 1, 3, 12, 59, 6404, 23330, 940, 92, 3, 7, 79, 12, 2100, 8, 4943, 198, 198, 82, 9741, 62, 312, 87, 796, 45941, 13, 22046, 419, 32590, 43420, 62, 7568, 13, 37379, 13, 27160, 8, 198, 1640, 21065, 287, 2837, 7, 77, 62, 70, 1734, 62, 28709, 62, 1462, 62, 3672, 2599, 198, 220, 220, 220, 308, 82, 62, 3672, 796, 366, 27071, 22179, 7, 43420, 62, 7568, 13, 6978, 1014, 13, 27160, 58, 82, 9741, 62, 312, 87, 58, 4178, 60, 4083, 35312, 7203, 62, 4943, 58, 16, 25, 12962, 198, 220, 220, 220, 458, 83, 13, 5239, 7, 198, 220, 220, 220, 220, 220, 220, 220, 264, 28, 14542, 62, 3672, 11, 198, 220, 220, 220, 220, 220, 220, 220, 2124, 28, 43420, 62, 7568, 13, 37379, 13, 27160, 58, 82, 9741, 62, 312, 87, 58, 4178, 60, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 331, 28, 43420, 62, 7568, 13, 6404, 79, 2100, 13, 27160, 58, 82, 9741, 62, 312, 87, 58, 4178, 60, 4357, 198, 220, 220, 220, 220, 220, 220, 220, 387, 2625, 3506, 1600, 198, 220, 220, 220, 1267, 198, 198, 489, 83, 13, 33464, 62, 39786, 3419, 198, 489, 83, 13, 21928, 5647, 7, 1911, 14, 448, 14, 301, 62, 615, 70, 62, 70, 1734, 62, 25641, 590, 62, 70, 8583, 62, 43420, 13, 11134, 4943, 198, 489, 83, 13, 12860, 3419, 198, 11748, 20966, 9945, 198, 198, 541, 9945, 13, 2617, 62, 40546, 3419, 198 ]
2.164211
475
if __name__ == "__main__": parser = OptionParser() Runtime.add_options(parser) options, args = parser.parse_args() pid, players = load_config("{{VIFF_CONFIG_LOC}}") Zp = GF(find_prime(2**65, blum=True)) runtime_class = make_runtime_class( mixins=[ProbabilisticEqualityMixin, ComparisonToft07Mixin] ) pre_runtime = create_runtime(pid, players, 1, options, runtime_class=runtime_class) pre_runtime.addCallback(protocol, Zp) pre_runtime.addErrback(report_error) reactor.run()
[ 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 198, 220, 220, 220, 30751, 796, 16018, 46677, 3419, 198, 220, 220, 220, 43160, 13, 2860, 62, 25811, 7, 48610, 8, 198, 220, 220, 220, 3689, 11, 26498, 796, 30751, 13, 29572, 62, 22046, 3419, 198, 220, 220, 220, 46514, 11, 1938, 796, 3440, 62, 11250, 7203, 27007, 53, 29267, 62, 10943, 16254, 62, 29701, 11709, 4943, 198, 220, 220, 220, 1168, 79, 796, 34977, 7, 19796, 62, 35505, 7, 17, 1174, 2996, 11, 698, 388, 28, 17821, 4008, 198, 220, 220, 220, 220, 198, 220, 220, 220, 19124, 62, 4871, 796, 787, 62, 43282, 62, 4871, 7, 198, 220, 220, 220, 220, 220, 220, 220, 5022, 1040, 41888, 2964, 65, 14991, 2569, 36, 13237, 35608, 259, 11, 34420, 2514, 701, 2998, 35608, 259, 60, 198, 220, 220, 220, 1267, 198, 220, 220, 220, 662, 62, 43282, 796, 2251, 62, 43282, 7, 35317, 11, 1938, 11, 352, 11, 3689, 11, 220, 198, 220, 220, 220, 220, 220, 220, 220, 19124, 62, 4871, 28, 43282, 62, 4871, 8, 198, 220, 220, 220, 662, 62, 43282, 13, 2860, 47258, 7, 11235, 4668, 11, 1168, 79, 8, 198, 220, 220, 220, 662, 62, 43282, 13, 2860, 9139, 81, 1891, 7, 13116, 62, 18224, 8, 628, 220, 220, 220, 21905, 13, 5143, 3419, 198 ]
2.447964
221
"""project urls.""" from django.urls import path, re_path from project.views import ProjectListView, ProjectDetailView app_name = 'project' urlpatterns = [ path('', ProjectListView.as_view(), name='index'), re_path(r'(?P<uid>\w+)/', ProjectDetailView.as_view(), name='detail'), ]
[ 37811, 16302, 2956, 7278, 526, 15931, 198, 6738, 42625, 14208, 13, 6371, 82, 1330, 3108, 11, 302, 62, 6978, 198, 198, 6738, 1628, 13, 33571, 1330, 4935, 8053, 7680, 11, 4935, 11242, 603, 7680, 198, 198, 1324, 62, 3672, 796, 705, 16302, 6, 198, 198, 6371, 33279, 82, 796, 685, 198, 220, 220, 220, 3108, 10786, 3256, 4935, 8053, 7680, 13, 292, 62, 1177, 22784, 1438, 11639, 9630, 33809, 198, 220, 220, 220, 302, 62, 6978, 7, 81, 6, 7, 30, 47, 27, 27112, 29, 59, 86, 10, 20679, 3256, 4935, 11242, 603, 7680, 13, 292, 62, 1177, 22784, 1438, 11639, 49170, 33809, 198, 60, 198 ]
2.745283
106
from flask import Flask, render_template, redirect, url_for, request, session from flask_restful import Api from connect import config from routes.routes import initialize_routes from my_code.Process import RecommendMovie from read_file import get_user_id from read_file import get_rating app = Flask(__name__) api = Api(app) config() initialize_routes(api) @app.route("/") @app.route("/recommend") @app.route("/", methods=['POST']) @app.route("/movie") if __name__ == "__main__": app.secret_key = b'_5#y2L"F4Q8z\n\xec]/' app.run(debug=True) # app.run()
[ 6738, 42903, 1330, 46947, 11, 8543, 62, 28243, 11, 18941, 11, 19016, 62, 1640, 11, 2581, 11, 6246, 198, 6738, 42903, 62, 2118, 913, 1330, 5949, 72, 198, 6738, 2018, 1330, 4566, 198, 6738, 11926, 13, 81, 448, 274, 1330, 41216, 62, 81, 448, 274, 198, 198, 6738, 616, 62, 8189, 13, 18709, 1330, 30361, 25097, 198, 198, 6738, 1100, 62, 7753, 1330, 651, 62, 7220, 62, 312, 198, 6738, 1100, 62, 7753, 1330, 651, 62, 8821, 628, 198, 1324, 796, 46947, 7, 834, 3672, 834, 8, 198, 15042, 796, 5949, 72, 7, 1324, 8, 198, 11250, 3419, 198, 36733, 1096, 62, 81, 448, 274, 7, 15042, 8, 628, 198, 31, 1324, 13, 38629, 7203, 14, 4943, 628, 198, 31, 1324, 13, 38629, 7203, 14, 47335, 437, 4943, 628, 198, 31, 1324, 13, 38629, 7203, 14, 1600, 5050, 28, 17816, 32782, 6, 12962, 628, 198, 31, 1324, 13, 38629, 7203, 14, 41364, 4943, 628, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 198, 220, 220, 220, 598, 13, 21078, 62, 2539, 796, 275, 6, 62, 20, 2, 88, 17, 43, 1, 37, 19, 48, 23, 89, 59, 77, 59, 87, 721, 60, 14, 6, 198, 220, 220, 220, 598, 13, 5143, 7, 24442, 28, 17821, 8, 198, 220, 220, 220, 1303, 598, 13, 5143, 3419, 198 ]
2.648402
219
from PIL import Image, ImageDraw, ImageFont FONT = ImageFont.load_default()
[ 6738, 350, 4146, 1330, 7412, 11, 7412, 25302, 11, 7412, 23252, 198, 198, 37, 35830, 796, 7412, 23252, 13, 2220, 62, 12286, 3419 ]
3.304348
23