Split (1)

train · 91.7k rows

id int64 -9,219,242,258,151,489,000 9,222,561,684B	raw_text stringlengths 0 679k	clean_text stringlengths 0 100k	num_raw_tokens int64 0 494k	num_clean_tokens int64 0 22.8k	origin_id int64 -9,219,242,258,151,489,000 9,222,561,684B	profile stringclasses 9 values	stages_applied listlengths 1 6	difficulty float64 0 0.95	pair_ok bool 2 classes	url null
7,716,277,554,941,241,000	Social Media Marketing Engage Your Demographic, Create Quality Leads & Unleash the Potential of Social Media Marketing Drive Your Online Sales Today! Find Out How We Take 800 Likes and Turn Them Into 8,000 Unique and Quality Likes Through Our Social Media Management Process! Social Media Marketing NJ Get the best in Social Media Marketing (SMM) and Social Media Management with your new Social Media Marketing Company, Shoreline Media Marketing. Our team of experts can build and Optimize Social Media Campaigns to advertise your company on your Social Media sites. With the knowledge and expertise of Shoreline Media Marketing’s team of Social Media experts, we can design and implement strong Social Media campaigns into your Social websites to help gain more traffic and help with lead generation and effecting Social Media Marketing. Don’t let your Social Media go unnoticed. It’s so much more than just posting posts to a page. We combine the research and lead generating content that we put into all Web and SEO into our Social Media Marketing. We stand behind our technique. A PPC (Pay Per Click) company should concentrate on what they are good at PPC. A print or logo design company should concentrate on just that print or logo design. Social Media Management should be managed by a company that manages all of your Web, SEO, Marketing Automation, etc. that way all of the optimized content and enhancements can flow into your Social Media Platforms. Spark an Undeniable Buzz for Your Brand & Engage in a Fresh, New Social Media Marketing Strategy with Shoreline Media Marketing.” Benefits of Social Media Marketing, Management and Advertising • More online conversations about your brand • Low costs or even Free • Impact on Search Engine Rankings • Choose the location, gender, age, likes and interests, relationship status, workplace and education of your target audience. • Campaigns and professional Social Media Management can help you reach people on Facebook who are part of your target audience. If you have a Page on Facebook, Such things as Sponsored Stories help you share word-of-mouth recommendations more effectively. • Professional Managed and Optimized ad campaigns are more likely to perform better if it’s displayed to the people who are most likely to be interested in your product or service. When you target each ad to smaller, specific groups of people at one time you’ll be able to customize your ad so it’s more personalized and appealing to the audience you’re trying to reach. • Targeting campaigns as well as optimized content and posts can consist of Locations, Ages, Birthdays, Interests, Education, Connections and more. • Develop an advertising strategy customized for your business • Allow Shoreline to Provide personal tips on monitoring and optimizing your ad performance Social Media Marketing FREE Social Media Marketing E-Book Download our Social Media Marketing E-Book for FREE. Learn the basics of Social Media Marketing with Shoreline Media Marketing. You will receive your Social Media Marketing E-Book in your email within 2 minutes. [contact-form-7 404 "Not Found"] The Social Media Management Process The Shoreline Media Marketing Team will carefully analyze what you are doing through all of your Social Media sites. Once your sites are analyzed we then look at your competition. Doing this allows the Shoreline Team to put together a plan to effectively compete with what your competition is doing in their Social Media Marketing. Shoreline Media will put the knowledge and techniques that we have specialized in to help push your services, products and company effectively through all Social Media platforms. Social Media Page Management View The Social Media Marketing Process HERE Shoreline will then tie all of your Social Media into your website the correct way to be sure all visitors know where to find you. This will help increase Revenue and drive more customers to your business through multiple sites and Social Media Marketing campaigns. Shoreline Media Marketing’s social media marketing program is set up and even priced to help you and your business get started and manage their social marketing campaign. The Shoreline Media Marketing goal is to make the process of Internet marketing as easy for our clients as we can. You are in control of your entire Ad Campaign with your own login to The Shoreline Social management Platform. The platform is developed by Facebook to help manage and track all of your information, Social Ad Campaigns, Clicks, Offers, Claims and so much more. Shoreline will create your Social Media Ad Campaign and target the campaign to the results of our research. We will research the best demographic, what pages to target, what areas to target and more. Imagine being able to attract someone who is just talking about a specific service or product that you may sell or offer. Someone who has never heard of your company but turns into your new customer because they used a keyword that pertains to your business. The possibilities are endless when creating professional campaigns that work. Forbes has listed The Top 10 Benefits Of Social Media Marketing on their blog saying Because it appeared quickly, social media has developed a reputation by some for being a passing marketing interest, and therefore, an unprofitable one. The statistics, however, illustrate a different picture. According to Hubspot, 92% of marketers in 2014 claimed that social media marketing was important for their business, with 80% indicating their efforts increased traffic to their websites. And according to Social Media Examiner, 97% of marketers are currently participating in social media—but 85% of participants aren’t sure what social media tools are the best to use. Read The Top 10 Benefits of Social Media Marketing Here. Social Media Professional Shoreline Media NJ The image to the left shows ACTUAL CLIENT STATISTICS for some Social Media Marketing we administer for them. They have reached OVER 4,000 FACEBOOK LIKES to date. If you are selling products/services or just publishing content for ad revenue, social media marketing is a potent method that will make your site profitable over time. Those who ignore the efficacy of social media usually fall into three categories; the ones who don’t know much or anything about social media, the ones who are interested but don’t know how to use it and those who don’t believe in the value that a social media strategy can bring to any site or business. With a professional web design Shoreline Media Marketing can tie all of your social media sites into your websites. Have your website talk to Facebook, Twitter, and all of the other social media sites out there. Generate feeds throughout your website from all of your social media websites. Social Media & Social Marketing. What Is Social Media? The following is from Wikipedia on Social Media Marketing. “Social “Social media is an umbrella term that defines u an is mediathe various activities that integrate technology, of construction the social interaction and the construction of and , interaction social words and pictures.” Social Media Marketing is the process of promoting your site or business through Social Media channels. Social Media Marketing is also a powerful strategy that will get you links, attention, visitor feedback and a very large amount of traffic to your website. It can benefit you in so many ways. For example you can create personal pages for your business, Links and comments from you and other people in your network, blog integration with your website, discussions on any topic regarding your business,free marketing, everyday promotions and posts, event promotion, blog integration, images, and much much more. There is no other low-cost promotional method out there that will easily give you large numbers of visitors, some of whom may come back to your website again and again. Social Media Marketing, Professionals, NJ, NY, LA, FLActual Results. Over 8,000 UNIQUE and Quality Likes Facebook Messenger Ads Ad Campaigns Facebook Messenger Facebook Marketing Social Media Ads Facebook Messenger Ads – Target Audiences Through Facebook Messenger Facebook Messenger ads are the ad Campaigns that appear on the home tab in Facebook Messenger. You can target specific demographics through facebook messenger when creating your campaign. These ads will appear when someone is active on their personal Facebook Messenger app or browser. 1.3 billion people around the world spend time on Messenger interacting and conducting commerce with businesses and brands they love. Now with Facebook Messenger ads, they have an opportunity to discover experiences directly on their home tab. • Start conversations with people using click to Messenger ads • Manage conversations within the versatile Messenger Platform • Re-engage people with Sponsored Messages Read More on Facebook Messenger Ads Here What Our Clients Have To Say: Digital Solutions for the Modern Web 9 Years of GREAT work by a GREAT team! ALWAYS Exceeding expectations! Thank you! 9 Years of GREAT work by a GREAT team! ALWAYS Exceeding expectations! Thank you! Atlantic Leak Detection, Shoreline Media Marketing \| Atlantic Leak Detection Atlantic Leak Detection, Shoreline Media Marketing \| Atlantic Leak Detection It has led to MASSIVE exposure in the Clinton area and a tremendous amount of business for me. Without, Shoreline, my exposure would be limited. The internet is a virtual yellow pages and if you want visibility on your investment... Read More It has led to MASSIVE exposure in the Clinton area and a tremendous amount of business for me. Without, Shoreline, my exposure would be limited. The internet is a virtual yellow pages and if you want visibility on your investment (VOI), get with Joe at Shoreline. They are reliable, available and most importantly experts at there craft. I strongly suggest aligning with them. \| The Max Challenge – Clifton, NJ \| The Max Challenge – Clifton, NJ My company, K9 Resorts, is a franchise company and we have specific needs that Shoreline Media is able to take care of. They are the most accessible and responsive company we have delt with thus far and the results prove... Read More My company, K9 Resorts, is a franchise company and we have specific needs that Shoreline Media is able to take care of. They are the most accessible and responsive company we have delt with thus far and the results prove they know the Franchise industry. K9 Resorts, Shoreline Media Marketing \| Jason Parker, K9 Resorts K9 Resorts, Shoreline Media Marketing \| Jason Parker, K9 Resorts We had an outstanding Trial Class/Kick Off on January 5th and the instructors indicated that it was the biggest kick off ever for THE MAX Lewes DE. This was all thanks to The Shoreline Media Team. Running an amazing well... Read More We had an outstanding Trial Class/Kick Off on January 5th and the instructors indicated that it was the biggest kick off ever for THE MAX Lewes DE. This was all thanks to The Shoreline Media Team. Running an amazing well known franchise takes time and thanks to your team you are helping us make this happen!! Our memberships are up since we took over and momentum is positive. Thank YOU! \| Jerry, The Max Challenge – Lewes, DE \| Jerry, The Max Challenge – Lewes, DE One of the best Web, SEO and Social Media companies i have ever had! These guys are top notch. Amazing customer support and most of all amazing results. Joe and his team literally takes care of any area of our... Read More One of the best Web, SEO and Social Media companies i have ever had! These guys are top notch. Amazing customer support and most of all amazing results. Joe and his team literally takes care of any area of our web marketing. Our Arizona based business has seen a HUGE return! Worlock Heating and Air Conditioning, Shoreline Media Marketing \| Worlock Heat & AC Worlock Heating and Air Conditioning, Shoreline Media Marketing \| Worlock Heat & AC Can not thank you guys enough. Absolutely amazing work and what an unbelievable team. Their approach has had a huge return on our investment!!! Can not thank you guys enough. Absolutely amazing work and what an unbelievable team. Their approach has had a huge return on our investment!!! \| Appliance Parts America \| Appliance Parts America We have been with Shoreline for about 4 years now and there’s not one thing I would change. Every single year we see an increase in our return and never have to worry. The most professional team we have ever... Read More We have been with Shoreline for about 4 years now and there’s not one thing I would change. Every single year we see an increase in our return and never have to worry. The most professional team we have ever worked with AND we see them on a regular basis! Thank you team Shoreline Regency Memory Care Club, Shoreline Media Marketing \| Regency Memory Care Regency Memory Care Club, Shoreline Media Marketing \| Regency Memory Care Joe and the Shoreline team could not have done a better job with my website. The number of clients and friends who tell me on a daily basis how much they like my website is a testament to this fact!... Read More Joe and the Shoreline team could not have done a better job with my website. The number of clients and friends who tell me on a daily basis how much they like my website is a testament to this fact! They far exceeded all of my expectations, and their customer service is beyond belief.. Often times, I would get replies to my email questions within minutes! I rarely recommend companies to my friends, but I would recommend Joe and Shoreline Media any day of the week. Class people, highest quality product/service, and reliable. Cant beat that as far as I’m concerned . \| Brett Raskin, The Raskin Group \| Brett Raskin, The Raskin Group “This is my second Testimonial on Joe Sernio and Web Solutions NJ. Joe was recommended to me by a friend. When I met Joe, I was truly in a dilemma. The web designer I was using just disappeared into thin... Read More “This is my second Testimonial on Joe Sernio and Web Solutions NJ. Joe was recommended to me by a friend. When I met Joe, I was truly in a dilemma. The web designer I was using just disappeared into thin air and left me in a bind! Joe came to my rescue. Not only was he extremely helpful and very knowledgeable, but he understood my needs and worked with me regarding costs. He made several suggestions, all of which made a great deal of difference to the look of the site and the functionality! The website is so professional looking now and easy for me to access, make changes and do updates! Joe was truly a God send. I am thrilled with the new website and highly recommend Joe as he is reliable and conscientious!” \| Francine Girimonte Les Bijoux, LLC \| Francine Girimonte Les Bijoux, LLC “I have been working with Shoreline Media for several months from development and SEO to management of our website. They developed a very professional site that is easy to navigate and gets our top pieces of information in front ot... Read More “I have been working with Shoreline Media for several months from development and SEO to management of our website. They developed a very professional site that is easy to navigate and gets our top pieces of information in front ot the viewer right on the home page. The hardest part of a website is managing it and keeping it current. I started using Shoreline’s services approximately 2 months ago and have already noticed a ton more calls coming into our office from the website. To say the least their management of the site has been ideal. Any changes we make are done very efficiently and in a timely manner. I am very appreciative of there work and recommend there services highly.” \| Dr. Tom Gustafson The Active Healing Center \| Dr. Tom Gustafson The Active Healing Center “I just want to thank Shoreline Media Marketing for doing and continuing such a wonderful & Amazing job with my website and marketing and in a short time period. I already have seen huge jumps in visits since you implemented... Read More “I just want to thank Shoreline Media Marketing for doing and continuing such a wonderful & Amazing job with my website and marketing and in a short time period. I already have seen huge jumps in visits since you implemented your skills to get my sites up on the search engines pages. You have bent over backwards to make sure I was happy with my sites and you still update me with newer gadgets installed in my sites. Not only did you take a site that was so outdated and under utilized but you streamlined both of my businesses to get the most out of my business on the web. I thank you for your professionalism and I thank you for making my business look that much better.” \| George Lyristis The Bistro at Red Bank Zoe an American Bistro \| George Lyristis The Bistro at Red Bank Zoe an American Bistro “I have used Shoreline for both of my retail business’s..They are experts at what they do and always keep me informed along the way.. I have never worked with such a nice, professional, competent group as I have with Shoreline…... Read More “I have used Shoreline for both of my retail business’s..They are experts at what they do and always keep me informed along the way.. I have never worked with such a nice, professional, competent group as I have with Shoreline… Both my websites are extremely successful, and I owe it to Shoreline… I highly recommend and you will be extremely happy if you choose them..” \| Christie Maruka Fashion Fix \| Christie Maruka Fashion Fix “Dear Joe and Shoreline Media Marketing. Meredith is flying with her website. She has won two awards and is being honored for a third in the middle school. The County is also recognizing her efforts with a proclamation! They have... Read More “Dear Joe and Shoreline Media Marketing. Meredith is flying with her website. She has won two awards and is being honored for a third in the middle school. The County is also recognizing her efforts with a proclamation! They have also written an amazing article on her in The Colts Neck Journal. We will refer you forever!!! Please let us know how else we can show our appreciation and gratitude for your amazing work in getting Chain Reaction Reviews up and running. Thank you so so much. \| Liz and Meredith Gallagher \| Liz and Meredith Gallagher “I have worked with Joe and Shoreline Media for little over a year now. As a busy business owner and fitness coach at Strive Fitness Bootcamp finding the time to keep my site ranking on search engines and keeping it... Read More “I have worked with Joe and Shoreline Media for little over a year now. As a busy business owner and fitness coach at Strive Fitness Bootcamp finding the time to keep my site ranking on search engines and keeping it optimized is pretty time consuming. Joe and his staff have helped me so much from creating a kick butt website to simply getting people to our site and capturing more leads. Along with the site, Landing Pages, Squeeze pages and more the leads do not stop!! They have done an awesome job and I’m very happy with their service. \| Tom Babyak Owner, Strive Fitness Bootcamp \| Tom Babyak Owner, Strive Fitness Bootcamp “Highly recommend! Joe & his staff are very professional & knowledgeable. Great ideas & communication. I was also impressed with their patience & willingness to help a novice like myself. Thank you for all your hard work, I’m extremely happy... Read More “Highly recommend! Joe & his staff are very professional & knowledgeable. Great ideas & communication. I was also impressed with their patience & willingness to help a novice like myself. Thank you for all your hard work, I’m extremely happy with my website! \| Patti Fiasconaro Owner, Nursery Art Gallery \| Patti Fiasconaro Owner, Nursery Art Gallery “A huge THANK YOU to Joe and his team over at Shoreline Media. Not only is our website exactly what I wanted but their marketing strategies and Social Media implementation is working wonders for Tommy’s. Professional, Affordable and results. Thank... Read More “A huge THANK YOU to Joe and his team over at Shoreline Media. Not only is our website exactly what I wanted but their marketing strategies and Social Media implementation is working wonders for Tommy’s. Professional, Affordable and results. Thank you Shoreline Media” Tommy’s Coal Fired Pizza, Brick NJ, Red Bank NJ, Oakhurst NJ Tommy's Coal Fired Pizza, Shoreline Media Marketing \| Tommy’s Coal Fired Pizza Tommy's Coal Fired Pizza, Shoreline Media Marketing \| Tommy’s Coal Fired Pizza X Get Started. Amazing Customer Experience, Expert Development Teams and the very best in Web and SEO. That's the Shoreline difference. Are you ready to take your digital presence to the next level? Let's Talk Sea Shells Original Praliné Gift Wrapped Ballotin 250g Give a timeless classic in a luxurious hand wrapped offering. Impress and give with confidence because Sea Shells chocolates always make the right gift. £10.00 4 in stock (can be backordered) EAN: 5410976069010 Category: Tag: Product Description Need a perfect gift but don’t have the time? The convenient, ready to give Sea Shells Gift Wrapped Ballotin is perfect for that last minute gift and will bring joy to any chocolate lover. The ballotin is hand wrapped and contains 22 delicious Sea Shell chocolates with Guylian’s signature praliné filling. A stylish golden ribbon and a customizable booklet for a personal message make the present complete. Weight 250 g Dimensions 9.3 x 19 x 5.9 cm Amount per box Flavour , Ingredients FILLED BELGIAN CHOCOLATES (PRALINÉ) – INGREDIENTS: Sugar, HAZELNUTS (23%), whole MILK powder, cocoa butter, cocoa mass, emulsifier: SOYA lecithin, natural vanilla flavouring, Cocoa solids : chocolate 48% min., milk chocolate 34% min., white chocolate 25% min., Milk solids : milk chocolate 22% min, white chocolate 30% min, MAY CONTAIN OTHER TREE NUTS AND WHEAT Dietary • Kosher • Vegetarian Nutrition information per 100 gram Energy 2295 kJ 550 kcal Fats 34 g of which saturates 16 g Carbohydrate 52 g of which sugars 50 g Protein 7,6 g Salt 0,19 g Reviews There are no reviews yet. Be the first to review “Sea Shells Original Praliné Gift Wrapped Ballotin 250g” Your email address will not be published.	# Social Media Marketing ## Engage Your Demographic, Create Quality Leads & Unleash the Potential of Social Media Marketing Drive Your Online Sales Today! Find out how we take 800 likes and turn them into 8,000 unique and quality likes through our social media management process! --- ## Social Media Marketing NJ Get the best in Social Media Marketing (SMM) and Social Media Management with your new Social Media Marketing Company, Shoreline Media Marketing. Our team of experts can build and optimize social media campaigns to advertise your company on your social sites. With the knowledge and expertise of Shoreline Media Marketing’s team of social media experts, we can design and implement strong social media campaigns to help gain more traffic, lead generation, and effective social media marketing. Don’t let your social media go unnoticed. It’s more than just posting—it's combining research and lead-generating content from web and SEO into your social media marketing. We stand behind our technique: social media management should be handled by a company that manages your web, SEO, marketing automation, and more, so optimized content flows into your social platforms. > “Spark an undeniable buzz for your brand & engage in a fresh, new social media marketing strategy with Shoreline Media Marketing.” --- ## Benefits of Social Media Marketing, Management, and Advertising - More online conversations about your brand - Low costs or even free - Positive impact on search engine rankings - Advanced targeting: location, gender, age, interests, relationship status, workplace, education - Reach target audiences on Facebook with campaigns like Sponsored Stories - Professionally managed and optimized ad campaigns perform better by targeting specific groups - Customizable, personalized ad experiences based on demographics, interests, and connections - Develop a customized advertising strategy for your business - Personal tips on monitoring and optimizing your ad performance --- ## Free Social Media Marketing E-Book Download our Social Media Marketing E-Book for FREE. Learn the basics of social media marketing with Shoreline Media Marketing. You will receive your e-book in your email within 2 minutes. --- ## The Social Media Management Process 1. Analysis - Review all your social media sites - Evaluate competitor activities 2. Planning - Develop a plan to effectively compete and outperform 3. Implementation - Apply specialized techniques to push your services, products, and company across platforms 4. Integration - Tie social media into your website correctly to increase revenue and drive customers 5. Control & Reporting - You control your ad campaigns via our social management platform - Track campaigns, clicks, offers, claims, and more Our goal is to make internet marketing as easy as possible. Imagine attracting someone who mentions a product you sell and converting them into a customer. The possibilities are endless. --- ## Facebook Messenger Ads Facebook Messenger ads appear on the home tab in Messenger apps and browsers. You can target specific demographics, start conversations, and re-engage customers. - Start conversations with click-to-Messenger ads - Manage interactions within the Messenger Platform - Re-engage people with Sponsored Messages --- ## Top 10 Benefits of Social Media Marketing Forbes cites statistics from HubSpot and Social Media Examiner: - 92% of marketers in 2014 claimed social media marketing was important for their business - 80% saw increased website traffic - 97% are participating in social media, but 85% are unsure which tools to use _Read The Top 10 Benefits of Social Media Marketing on Forbes._ --- ## What Our Clients Have to Say Atlantic Leak Detection “9 Years of GREAT work by a GREAT team! ALWAYS exceeding expectations! Thank you!” K9 Resorts “My company is a franchise; Shoreline Media is the most accessible and responsive company we’ve dealt with. The results prove they know the franchise industry.” The Max Challenge – Lewes, DE “We had the biggest kick-off ever, thanks to Shoreline Media Team. Our memberships are up, momentum is positive.” Worlock Heating and Air Conditioning “One of the best web, SEO, and social media companies I have ever had! Amazing results and support.” Appliance Parts America “Can’t thank you guys enough. Absolutely amazing work and an unbelievable team with a huge ROI!” Regency Memory Care Club “We’ve been with Shoreline for 4 years. Every year we see an increase in ROI. The most professional team we’ve ever worked with.” The Raskin Group “Joe and the Shoreline team far exceeded expectations—their customer service is beyond belief.” Les Bijoux, LLC “Joe was a godsend. He understood my needs, delivered a professional site, and provided stellar support.” The Active Healing Center “Since using Shoreline’s management, calls to our office have increased significantly. Efficient and timely service.” The Bistro at Red Bank “Shoreline streamlined our businesses online and increased site visits. Their professionalism is unmatched.” Fashion Fix “I highly recommend Shoreline. They are experts, professional, and always keep me informed.” Chain Reaction Reviews “Meredith won awards and county recognition thanks to the website—Shoreline’s work is amazing!” Strive Fitness Bootcamp “Joe and his staff have helped me create an effective website, landing pages, and captured more leads.” Nursery Art Gallery “Joe & his staff are very professional. Great ideas, communication, and patience in helping a novice.” Tommy’s Coal Fired Pizza “Their marketing strategies and social media implementation are working wonders. Professional, affordable, and results-driven.” --- Get started today and elevate your digital presence with Shoreline Media Marketing! --- # Sea Shells Original Praliné Gift Wrapped Ballotin 250g Give a timeless classic in a luxurious hand wrapped offering. Impress and give with confidence because Sea Shells chocolates always make the right gift. Price: £10.00 Stock: 4 in stock (can be backordered) EAN: 5410976069010 --- ## Product Description Need a perfect gift but don’t have the time? The convenient, ready to give Sea Shells Gift Wrapped Ballotin is perfect for that last minute gift and will bring joy to any chocolate lover. The ballotin is hand wrapped and contains 22 delicious Sea Shell chocolates with Guylian’s signature praliné filling. A stylish golden ribbon and a customizable booklet for a personal message make the present complete. --- ## Specifications - Weight: 250 g - Dimensions: 9.3 × 19 × 5.9 cm - Amount per box: 22 chocolates --- ## Ingredients FILLED BELGIAN CHOCOLATES (PRALINÉ) – INGREDIENTS: Sugar, HAZELNUTS (23%), whole MILK powder, cocoa butter, cocoa mass, emulsifier: SOYA lecithin, natural vanilla flavouring, Cocoa solids: chocolate 48% min., milk chocolate 34% min., white chocolate 25% min., Milk solids: milk chocolate 22% min, white chocolate 30% min. MAY CONTAIN OTHER TREE NUTS AND WHEAT --- ## Dietary - Kosher - Vegetarian --- ## Nutrition Information (per 100 g) - Energy: 2295 kJ / 550 kcal - Fats: 34 g - of which saturates: 16 g - Carbohydrate: 52 g - of which sugars: 50 g - Protein: 7.6 g - Salt: 0.19 g	4,616	1,591	7,716,277,554,941,241,000	concat	[ "concat_full" ]	0.75	true	null
-208,291,770,493,603,100	Male Urology Male Urology Male urology involves the diagnosis and treatment of conditions in the urinary tract, kidneys, adrenal glands, bladder, urethra and the male reproductive organs. Here at Fitzwilliam Hospital we are delighted to work with a number of leading urology specialists. Our in-patient and day-case medical and surgical urology services are supported by a fully equipped ultra clean air theatre suite, the Braithwaite day unit is used for minor operations and an incontinence physiotherapy service. We perform a wide range of male urological procedures including: cystoscopy and urethrotomy, urodynamic tests, prostate screening, TURP, adult circumcision, vasectomy and its reversal, stress incontinence treatments and, benign scrotal lump surgery. If you are experiencing urinary system and reproductive tracts symptoms, then call us on 01733 261717 or contact us to book an appointment for an early diagnosis. Male urology services we provide Cystoscopy Cystoscopy is used to examine and treat symptoms and conditions inside your bladder and urinary system. During a cystoscopy your urologist inserts a thin tube with a light and a camera at one end, called a cystoscope, into your urethra and into your bladder. There are two types of cystoscope: • flexible cystoscope – a flexible tube is used to look inside your bladder. • rigid cystoscope – a thin, straight metal tube is used if your urologist needs to pass small surgical instruments into your bladder to obtain a tissue sample or to carry out treatment. A cystoscopy investigates urination problems including: incontinence, blood in your urine, pain when you urinate, frequently needing to urinate, not being able to urinate or only intermittently and, feeling that you haven’t fully emptied your bladder after going to the toilet. A cystoscopy may detect or monitor: a narrowed or blocked urethra, urinary tract infections, polyps (non-cancerous growths), an enlarged prostate gland, bladder stones, ureter problems and urinary tract cancers. Urethrotomy A urethrotomy is performed to widen a narrowed urethra, the tube that carries urine from your bladder to your penis. Narrowing of your urethra is usually caused by scar tissue forming following inflammation, an infection or an injury. A narrow urethra can result in a slow flow of urine, often with dribbling, pain, bleeding and infection. A urethrotomy is simple day case procedure carried out under a general or spinal anaesthetic. Your surgeon will pass a rigid cystoscope into your urethra and make a cut in the scar tissue to widen your urethra. Urodynamic tests Urodynamic tests check the function of your bladder and urethra. They help to investigate the cause of any urinary incontinence you may have. Testing is usually done in a room in the diagnostic services department. A special toilet called a flowmeter is used to measure how much and the flow of urine you pass. An ultrasound test afterwards shows how empty your bladder is. Fluid is then passed into your bladder at a controlled rate to measure the way your bladder works as it fills using catheters to run. We compare pressure inside and outside your bladder. Once your bladder is full, X-rays of your bladder may be taken. The flowmeter then monitors your flow of emptying your bladder. Prostate screening Here at Fitzwilliam Hospital we offer PSA, biopsies and rectal examinations to diagnose prostate cancer. A prostate specific antigen (PSA) blood test will detect a high level of PSA that can be a sign of cancer. However, your PSA level can be raised in prostate conditions that are not cancer so to be sure a biopsy would also be required. TURP (prostate surgery) A transurethral resection of the prostate (TURP) removes part of your prostate gland. Your urologist performs a TURP procedure if you have an enlarged prostate that is putting pressure on your bladder and urethra and, affecting your urination. This keyhole surgery is performed under general or spinal anaesthesia. It involves passing a thin metal tube with a light source, camera and loop of wire along your urethra to your prostate. The loop of wire is then heated to cut part of your prostate. Adult circumcision Adult circumcision is the surgical removal of your penis foreskin. It’s a reasonably simple operation that can be performed for religious, cultural and medical reasons. For medical reasons adult circumcision can treat: • phimosis - a tight foreskin. • recurrent balantis – recurrent inflammation and infection of the foreskin and head of your penis. • balanitis xerotica obliterans (BXO) - dermatological condition of your penis that causes phimosis and inflammation of your penis head. • paraphimosis - foreskin won’t return to its original position and your penis head becomes swollen and painful. • penile cancer. • Conservative treatments are often tried initially such as gels and creams before circumcision surgery. Circumcision surgery on the NHS has restrictions and waiting lists. We offer adult circumcision without restrictions or waiting. Vasectomy A vasectomy is a minor procedure that provides male sterilisation or permanent contraception. Under local anaesthetic your urologist seals your vas deferens tubes to stop sperm entering your semen. We offer conventional and no-scalpel vasectomies. A conventional vasectomy uses a scalpel to cut your skin on each side of your scrotum and to cut your tubes. The no-scalpel technique makes a tiny puncture hole in the skin of your scrotum to reach the tubes. Your urologist will discuss these in detail with you. A vasectomy on the NHS often involves waiting. Here at Fitzwilliam Hospital we offer vasectomies without waiting. Vasectomy reversal Vasectomy reversal is performed to reverse male sterilisation. It reconnects your vas deferens tubes that were sealed during a vasectomy. It is best to have a vasectomy reversal soon after a vasectomy for a greater chance of success. Vasectomy reversal isn't usually available on the NHS. Here at Fitzwilliam Hospital we can perform a vasectomy reversal if required. Benign scrotal lump surgery Benign scrotal lump surgery is an operation to remove a non-cancerous lump in your scrotum. The lump can be a hydrocele caused by fluid collecting in the thin sheath surrounding your testicle or, an epididymal cyst caused when fluid collects in your epididymis, a tube-like sperm store. It’s a day case procedure usually performed under general anaesthetic. Your surgeon makes a small cut in your scrotum. For a hydrocele, the fluid from the sheath will be removed and then the sheath will either be removed or stitched together. An epididymal cyst will either be removed whole or the ‘roof’ of the cyst cut and the fluid drained out. Get in touch Need some advice on a treatment price or booking an initial appointment. We're here to help. or PRIVATE PATIENT PLEDGE THE BEST OF CARE • Your choice of consultant • No cancellations • Appointments to suit you • 0% finance available • No waiting lists • Fixed price packages • Unlimited aftercare • Price Match Terms and conditions apply More Information 0% FINANCE AVAILABLE Spread the cost of your treatment • Fixed monthly payments over a term that enables you to budget • Loan money paid directly to Ramsay Health Care • A loan designed to put more expensive health procedures within easier reach • Simple Online application More Information Pricing Search Search for prices of treatments & procedures Search Now Keep up to date with the latest Ramsay Health care News. Contact Us Contact your local Ramsay hospital to book an appointment or for more information. Treatment may be covered by medical insurance and self pay packages are available on request. Posted 25 Days Ago Job ID: 1588552 34 quotes received Experienced Appointment Setter Fixed Price Quotes (34) · Premium Quotes (1) · Invited (8) · Hired (0) Send before: October 24, 2019 Send a Quote ***PLEASE REVIEW THIS ENTIRE EMAIL BEFORE RESPONDING TO THIS POSTING*** We need the assistance of a highly successful and ‘Experienced Appointment Setter’. Appointment Setter will need to work with us to develop a custom script that Appointment Setter is comfortable with. We will provide downl ... Show more Barry R United States	# Male Urology Male urology involves the diagnosis and treatment of conditions in the urinary tract, kidneys, adrenal glands, bladder, urethra and male reproductive organs. At Fitzwilliam Hospital we offer in-patient and day-case medical and surgical urology services, supported by: - A fully equipped ultra-clean air theatre suite - The Braithwaite Day Unit for minor operations - An incontinence physiotherapy service If you’re experiencing urinary or reproductive tract symptoms, call us on 01733 261717 or [contact us] to book an appointment. --- ## Our Male Urology Services ### 1. Cystoscopy A cystoscopy examines and treats the bladder and urinary system using a thin tube with a light and camera (cystoscope) inserted through the urethra. - Flexible cystoscope: a bendable tube for inspection - Rigid cystoscope: straight metal tube for taking tissue samples or treatment Indications include incontinence, blood in urine, pain, frequent or incomplete urination. It can detect urethral strictures, UTIs, polyps, enlarged prostate, bladder stones and cancers. ### 2. Urethrotomy A day-case procedure under general or spinal anaesthetic to widen a narrowed urethra (often due to scar tissue). A rigid cystoscope is used to cut the scar tissue and restore normal urine flow. ### 3. Urodynamic Tests These tests assess bladder and urethral function to investigate urinary incontinence. 1. Measure urine flow with a flowmeter 2. Ultrasound to check residual bladder volume 3. Fill bladder via catheter to compare internal and external pressures 4. Take X-rays and measure voiding flow ### 4. Prostate Screening - PSA blood test: elevated prostate-specific antigen may indicate cancer (but can rise in benign conditions) - Prostate biopsy and digital rectal examination for definitive diagnosis ### 5. TURP (Transurethral Resection of the Prostate) Keyhole surgery under general or spinal anaesthesia to remove part of an enlarged prostate that impedes urine flow. A resectoscope with a heated wire loop cuts away excess tissue. ### 6. Adult Circumcision Surgical removal of the foreskin for religious, cultural or medical reasons, including: - Phimosis (tight foreskin) - Recurrent balanitis or balanitis xerotica obliterans (BXO) - Paraphimosis - Penile cancer Conservative treatments (gels/creams) may be tried first. ### 7. Vasectomy Minor procedure for permanent male contraception. Under local anaesthetic, the vas deferens are sealed to block sperm: - Conventional vasectomy (scalpel) - No-scalpel vasectomy (tiny puncture) ### 8. Vasectomy Reversal Reconnects previously sealed vas deferens to restore fertility. Best performed soon after the original vasectomy for higher success rates. ### 9. Benign Scrotal Lump Surgery Day-case operation under general anaesthetic to remove non-cancerous scrotal lumps: - Hydrocele: fluid in the testicular sheath - Epididymal cyst: fluid in the epididymis The surgeon makes a small scrotal incision, drains/removes the fluid and repairs the sheath or cyst. --- Contact Us Call 01733 261717 or [email us] to discuss treatment options, pricing or to book your initial appointment. --- # Experienced Appointment Setter Job ID: 1588552 Quotes received: 34 Fixed Price Send before: October 24, 2019 --- ##### Description ***PLEASE REVIEW THIS ENTIRE EMAIL BEFORE RESPONDING TO THIS POSTING* We need the assistance of a highly successful and ‘Experienced Appointment Setter’. Appointment Setter will need to work with us to develop a custom script that Appointment Setter is comfortable with. We will provide downl ... Show more --- Client:** Barry R, United States	1,772	842	-208,291,770,493,603,100	concat	[ "concat_full" ]	0.75	true	null
-6,436,576,732,635,163,000	BLOG TOUR REVIEW AND EXCERPT: Between Now And Forever by Dylan Allen BNAF - BT banner “An electrifying love story filled with heart and heat. Definite five star read!” Jenika Snow, USA Today bestselling author Between Now and Forever, the first book in the all-new emotional and epic Forever Trilogy from Dylan Allen, is available now and FREE in Kindle Unlimited! FOREVER Real love stories, the ones worth telling, never end. He was searching for the truth. I was living a lie. Our paths should never have crossed. But, when we kissed it felt like destiny. Falling in love was messy. We broke rules we should have followed. We made promises we couldn’t keep. Forever felt impossible. Heartbreak was inevitable. Always would cost us everything. This is not a fairytale. This is a love story. My Review Heading into book one of Dylan Allen’s new trilogy, Between Now and Forever, I knew that my mental stability was going to be in flux as Allen’s hero and heroine illustrated just how chaotic and devastating love can be, especially when it’s between two people who are a bit broken in their own right. But the idea that being broken means that you’re alive is an intriguing one, and that’s exactly the story Allen tells…that’s exactly the life that Beth and Carter live, and that’s exactly why I knew that my heart was going to be put through the meat grinder as I witnessed the beginning of what Beth and Carter could be while also understanding that it wasn’t how they would allows be, and while I’m not a reader who can handle angst for angst sake, I never feel like Dylan Allen manufactures the drama or the pain in her stories…those emotions come from the machinations of other people and the messiness and devastation that can occur when you give someone power over you, whether it be your head, your heart, or your body. The idea of living behind a mask, keeping up a facade because that’s the only way one will be accepted will resonate with many readers, making them both angry and frustrated knowing that it shouldn’t matter who a person is on the outside or where they come from, but also acknowledging that it’s a common occurrence in contemporary society. But the fact that Carter and Beth truly ‘see’ each other and have clear pictures of who one another is and who they are together is what allows them to keep fighting for their forever, keep pushing forward in hopes that the obstacles that seem to always be in there way dissipate as they continue to overcome every road block put in their way. Because Beth and Carter’s story spans over three books, it’s clear that these two still have a difficult journey ahead – one that will test their strength, their dedication, and their love. But while it’s too early to tell if these two will make it through what’s between now and forever, the fact that their initial interaction seemed to sustain them for a signifiant amount of time, holding on to the feelings that seemed to consume when they first met provides readers with hope and makes it easier to handle the now…handle the heartache…handle the time apart…if when everything is said and down, they find not only their forever but their always as well. “‘Baby, real love stories—the ones worth telling—they never end.’” This is the last sentence of the Prologue in Dylan Allen’s newest release, Between Now and Forever, book one in her Forever trilogy, and while it’s said some time in the future, it drives home the fact that the hero and heroine of this three book series will eventually make it to their forever…they just need to be willing to hold onto one another as the entirety of their story is told in a span of many years and three books. During this time, they will undoubtedly have their struggles, want to give, and perhaps even spend time apart, and while those growing pains may be difficult on the characters as well as the readers who are immersed into their lives, what matters most…what Beth and Carter and readers need to keep telling themselves is that any story…any life doesn’t follow one specific path – the journey ebbs and flows, pushes and pulls, and while the ultimate goal is forever, there is no tried and true way to get there…no specific initiation that people need to go through…it’s just life, every delightful, dramatic, and devastating moment, all melded together to give the details of a life lived and the course that was followed however weathered and heartbreaking it may be. Forever may seem like a long time, but it takes hard work, dedication, and unconditional love to get there from the here and now. 4.5 Poison apples BNAF - AN Download your copy today or read FREE in Kindle Unlimited! Amazon: https://amzn.to/2oa3aHM Amazon Worldwide: http://mybook.to/Betweennowforever Amazon Paperback: https://amzn.to/2Vjpr1C Add to GoodReads: http://bit.ly/2LcXyE4⁣⁣ Excerpt “Keep it. A little something to remember me.” “So…are we, like, going to be like…boyfriend and girlfriend?” Her eyes are expectant and suddenly, breathing feels a little harder. Those words make me think of things like explanations and disappointment. I’m not sure that I can be intimate with anyone. And what happens when she finds out about everything? She’ll be horrified. Or when I start back on the show and that whole world crowds in on us… she’ll get tired of it and walk away. Or I’ll be weak and break even more of my own rules and end up hurting her. “Let’s not put any labels on it.” Her eyes lose some of their sparkle, but she smiles gamely. “Well, no matter what we call it, the last few days have been awesome. I know a side of myself that I didn’t before.” “How do you mean?” “I mean, now I know, that given the chance, I can sit down with people I don’t know and have a great conversation. I’ve never been anywhere, but here. And now I’m going to get to travel with you—even though I’ll be seeing it through your phone’s camera. Meeting you was really good luck.”Oh yeah…The cheesecake. I’m ruined. I brush my lips very lightly across hers and smile when she whimpers. God, I’m going to miss her. “I promise, I’ll call.” It doesn’t make my heart race to say it. “Don’t promise, Carter. Those are bound to be broken. Just do it.”Her eyes turn solemn and I see that she and disappointment are intimate friends. I want to break them up. About Dylan Allen Dylan Allen is a Texas girl with a serious case of wanderlust. A self-proclaimed happily ever junkie, she loves creating stories where her characters chase their own happy endings. When she isn’t writing or reading, eating or cooking, she and her family are planning their next adventure. Dylan Allen Connect with Dylan Facebook: https://www.facebook.com/authordylanallen/ Instagram: https://www.instagram.com/peddlerofpassion/ GoodReads: https://bit.ly/2KNeNe7 Pinterest: https://www.pinterest.com/dylanawrites/ Twitter: https://twitter.com/dylanallenwrit1 Book+Main: https://bookandmainbites.com/dylanallen Stay up to date with Dylan by joining her mailing list: http://bit.ly/2OcDm8M Leave a comment Filed under Uncategorized Leave a Reply Fill in your details below or click an icon to log in: WordPress.com Logo You are commenting using your WordPress.com account. Log Out / Change ) Google photo You are commenting using your Google account. Log Out / Change ) Twitter picture You are commenting using your Twitter account. Log Out / Change ) Facebook photo You are commenting using your Facebook account. Log Out / Change ) Connecting to %s This site uses Akismet to reduce spam. Learn how your comment data is processed. Winners of #FitFamSweat: Meet the Champions Who Braved the Shanghai Summer Heat WechatIMG37.jpeg If you have ever wondered what it would be like to workout inside of a sauna, you’ve had your chance these past few weeks. Shanghai has endured record high temperatures and stifling humidity, but this has not stopped FitFammers from hitting the ground hard. For those who work out at 6am we know these workouts are the great equalizer – we’ve all just rolled out of bed, in our most original, unaltered form, and pretty convinced we’ve made the right choice to leave our beds… now add in drenched in our own sweat (and possibly the sweat of others) and we’re all on the same level. In honor of the heat, we couldn’t help but ask FitFammers for their sweatiest moments, and boy did it get steamy. If you haven’t already, come sweat with us! After all, those who sweat together, stick together (no, seriously, you will literally stick together)! Winner of the best sweaty photo goes to: John Vallis John Vallis Second place: Xiao Chun Tang Xiao Chun Tang Third place: The 'Empty Streets' running crew leaving their mark!  The 'Empty Streets' running crew leaving their mark!	# BLOG TOUR REVIEW AND EXCERPT: Between Now And Forever by Dylan Allen > “An electrifying love story filled with heart and heat. Definite five star read!” > Jenika Snow, USA Today bestselling author Between Now and Forever, the first book in the all-new emotional and epic Forever Trilogy from Dylan Allen, is available now and FREE in Kindle Unlimited! ## FOREVER Real love stories, the ones worth telling, never end. - He was searching for the truth. - I was living a lie. - Our paths should never have crossed. - But, when we kissed it felt like destiny. - Falling in love was messy. - We broke rules we should have followed. - We made promises we couldn’t keep. - Forever felt impossible. - Heartbreak was inevitable. - Always would cost us everything. This is not a fairytale. This is a love story. --- ## My Review Heading into book one of Dylan Allen’s new trilogy, Between Now and Forever, I knew that my mental stability was going to be in flux as Allen’s hero and heroine illustrated just how chaotic and devastating love can be, especially when it’s between two people who are a bit broken in their own right. But the idea that being broken means that you’re alive is an intriguing one, and that’s exactly the story Allen tells…that’s exactly the life that Beth and Carter live, and that’s exactly why I knew that my heart was going to be put through the meat grinder as I witnessed the beginning of what Beth and Carter could be while also understanding that it wasn’t how they would always be. I’m not a reader who can handle angst for angst’s sake, but I never feel like Dylan Allen manufactures the drama or the pain in her stories—those emotions come from the machinations of other people and the messiness and devastation that can occur when you give someone power over you, whether it be your head, your heart, or your body. The idea of living behind a mask, keeping up a façade because that’s the only way one will be accepted, will resonate with many readers, making them both angry and frustrated knowing that it shouldn’t matter who a person is on the outside or where they come from, but also acknowledging that it’s a common occurrence in contemporary society. But the fact that Carter and Beth truly “see” each other and have clear pictures of who one another is and who they are together is what allows them to keep fighting for their forever, keep pushing forward in hopes that the obstacles that seem to always be in their way dissipate as they continue to overcome every roadblock put in their path. Because Beth and Carter’s story spans over three books, it’s clear that these two still have a difficult journey ahead—one that will test their strength, their dedication, and their love. But while it’s too early to tell if these two will make it through what’s between now and forever, the fact that their initial interaction seemed to sustain them for a significant amount of time, holding on to the feelings that seemed to consume them when they first met, provides readers with hope and makes it easier to handle the now…handle the heartache…handle the time apart…if, when everything is said and done, they find not only their forever but their always as well. > “‘Baby, real love stories—the ones worth telling—they never end.’” This is the last sentence of the Prologue in Dylan Allen’s newest release, Between Now and Forever, book one in her Forever trilogy, and while it’s said some time in the future, it drives home the fact that the hero and heroine of this three-book series will eventually make it to their forever…they just need to be willing to hold onto one another as the entirety of their story is told over many years and three books. Forever may seem like a long time, but it takes hard work, dedication, and unconditional love to get there from the here and now. Rating: 4.5 Poison apples --- ## Download Your Copy - Amazon US: https://amzn.to/2oa3aHM - Amazon Worldwide: http://mybook.to/Betweennowforever - Amazon Paperback: https://amzn.to/2Vjpr1C - Add to Goodreads: http://bit.ly/2LcXyE4 --- ## Excerpt > “Keep it. A little something to remember me.” > > “So…are we, like, going to be like…boyfriend and girlfriend?” > > Her eyes are expectant and suddenly, breathing feels a little harder. Those words make me think of things like explanations and disappointment. I’m not sure that I can be intimate with anyone. And what happens when she finds out about everything? She’ll be horrified. Or when I start back on the show and that whole world crowds in on us… she’ll get tired of it and walk away. Or I’ll be weak and break even more of my own rules and end up hurting her. > > “Let’s not put any labels on it.” > > Her eyes lose some of their sparkle, but she smiles gamely. “Well, no matter what we call it, the last few days have been awesome. I know a side of myself that I didn’t before.” > > “How do you mean?” > > “I mean, now I know, that given the chance, I can sit down with people I don’t know and have a great conversation. I’ve never been anywhere, but here. And now I’m going to get to travel with you—even though I’ll be seeing it through your phone’s camera. Meeting you was really good luck.” > > Oh yeah… The cheesecake. > > I’m ruined. I brush my lips very lightly across hers and smile when she whimpers. God, I’m going to miss her. > > “I promise, I’ll call.” It doesn’t make my heart race to say it. > > “Don’t promise, Carter. Those are bound to be broken. Just do it.” > > Her eyes turn solemn and I see that she and disappointment are intimate friends. I want to break them up. --- ## About Dylan Allen Dylan Allen is a Texas girl with a serious case of wanderlust. A self-proclaimed happily-ever junkie, she loves creating stories where her characters chase their own happy endings. When she isn’t writing or reading, eating or cooking, she and her family are planning their next adventure. ## Connect with Dylan - Facebook: https://www.facebook.com/authordylanallen/ - Instagram: https://www.instagram.com/peddlerofpassion/ - Goodreads: https://bit.ly/2KNeNe7 - Pinterest: https://www.pinterest.com/dylanawrites/ - Twitter: https://twitter.com/dylanallenwrit1 - Book+Main: https://bookandmainbites.com/dylanallen - Mailing List: http://bit.ly/2OcDm8M --- # Winners of #FitFamSweat: Meet the Champions Who Braved the Shanghai Summer Heat If you have ever wondered what it would be like to workout inside of a sauna, you’ve had your chance these past few weeks. Shanghai has endured record high temperatures and stifling humidity, but this has not stopped FitFammers from hitting the ground hard. For those who work out at 6 am we know these workouts are the great equalizer – we’ve all just rolled out of bed, in our most original, unaltered form, and pretty convinced we’ve made the right choice to leave our beds… now add in drenched in our own sweat (and possibly the sweat of others) and we’re all on the same level. In honor of the heat, we couldn’t help but ask FitFammers for their sweatiest moments, and boy did it get steamy. If you haven’t already, come sweat with us! After all, those who sweat together, stick together (no, seriously, you will literally stick together)! ## Winner of the best sweaty photo John Vallis ## Second place Xiao Chun Tang ## Third place The ‘Empty Streets’ running crew leaving their mark!	1,973	1,715	-6,436,576,732,635,163,000	concat	[ "concat_full" ]	0.75	true	null
6,408,346,339,019,881,000	Celebrity picadillo recipe Celebrity picadillo recipe It can be hard to count your calories all day long, and it s discouraging learn that earlier meals may not have left a whole lot of wiggle room for dinner celebrity eats italian-born, celeb fabio viviani has touched down tampa serve up soothing, packed-with-flavor italian cuisine his new osteria. Eggs are appropriate, but so is roast beef! :-) This weekend, why add some our traditional Caribbean brunch items menu enjoy delectable dining while staying courtyard miami airport. Around three months before Meghan Markle Prince Harry met, she was dating celebrity chef Cory Vitiello our hotel features two acclaimed restaurants near international if ve decided out whole30 restrictive 30-day diet eliminates dairy, grains, soy, legumes, added sugars, processed foods, and. David Jones unveils how their relationship gave her an thanks wave healthy delicious meal delivery programs, eating well never been easy. GET YOURSELF PAINTED IN PARADISE AT TATTOO Join guest body painter artists, including Sean Avram from Skin Wars, as they join the Paradise welcome the bare pantry show. Or any ground meat you handy in fridge family oriented cooking show. From musical icons sports stars legendary superheroes emerging let take look at celebrities didn t know were biracial although feature dishes my native country belize, also put ot. Butternut Squash Tomatillo Soup tomatillos lighter, citrus flavor an otherwise traditional, cold-weather soup traditional bahamian conch salad uniquely delicacy fresh spicy exciting mix flavors. Top off this soup with drizzle of try amazing recipe! beef, chicken, pork, or fish? after while, choices start seem same. Because easy good-for-you don mutually exclusive so about alligator? andrew zimmern, infamous host bizarre. Tags: Celebrity, picadillo, recipe, Celebrity picadillo recipeCelebrity picadillo recipeCelebrity picadillo recipe Multi Panel Sets Modern subject Words 29 Art & Photo Prints found. Our online store offers a wide selection of Art & Photo Prints Multi Panel Sets from Modern Words category . Strikingly beautiful and vivid Art & Photo Prints Multi Panel Sets will make a great addition to your home decor and will create a comfortable and soothing environment. We offer Modern Words Multi Panel Sets art prints of any style, type and theme! Print-Services.com provides swift shipping of Modern Words art prints and affordable prices, which makes purchasing art prints in our store the best choice for decorating your home. Filter Newsletter	# Celebrity picadillo recipe Tags: Celebrity, picadillo, recipe --- # Multi Panel Sets Modern subject Words 29 Art & Photo Prints found. Our online store offers a wide selection of Art & Photo Prints Multi Panel Sets from Modern Words category. Strikingly beautiful and vivid Art & Photo Prints Multi Panel Sets will make a great addition to your home decor and will create a comfortable and soothing environment. We offer Modern Words Multi Panel Sets art prints of any style, type and theme! Print-Services.com provides swift shipping of Modern Words art prints and affordable prices, which makes purchasing art prints in our store the best choice for decorating your home.	509	135	6,408,346,339,019,881,000	concat	[ "concat_full" ]	0.75	true	null
3,638,284,293,698,420,000	Stuck in BedStuck in Bed Author Topic: 29 weeks - on steroids, getting FFN test Tuesday (Read 1637 times) ritchiewoman • Newbie • * • Posts: 2 • View Profile 29 weeks - on steroids, getting FFN test Tuesday « on: July 04, 2009 at 01:17 AM » Hi everyone! I've been following some of you on Twitter when I was first put on modified bedrest in my first trimester. Now I just started my third trimester and I'm on modified bedrest again! So here's my story. I'm 38 years old. I have one child (a son via c-section - 4) and have had 6 miscarriages. This is pregnancy number 8. I have been on blood thinners since the beginning of my pregnancy because the doctors discovered I have a genetic disposition for blood clots, which were likely the cause of my many miscarriages. After I made it thru the first trimester, we thought I was basically in the clear and I went on to have a relatively uneventful 2nd trimester. The contractions started at 28 weeks - but they weren't regular and started after I took a longer than usual walk with the dog. So I drank water, called my doctor, and was told to not worry about it until I had more than four in a hour and they were regular. Then on Tuesday of this week, they started again at 3:30 in the afternoon, every 10 minutes, for 3 hours. After calling the nurse line, I was directed to L&D. I was monitored right away and started drinking water. They continued at every 10 minutes. They did a cervical exam and said I was 1 cm dialated. The doctor suggested steroid shots so after discussing it my husband and I agreed and I got the first of two shots. Finally, the contractions became irregular. But then I started bleeding pretty heavily. The doctor examined me and figured out that the bleeding wasn't active and was most likely due to the cervical exam, since I am on blood thinners and bleed easily. I went home to rest and returned the next night for my second steroid shot. They decided on Wednesday to not do another cervical exam because of the bleeding. Then the doctor suggested I do the Fetal Fibronectin test. Instead of waiting in the L&D for 24 hours to pass from my internal exam, I went home and then went into my doctor's office the next day to take the test there. When my doctor did the FFN test I still had leftover blood present so they couldn't send it in. I will go back on Tuesday and get the test taken then. In the meantime, I was given nifedipine 20mg capsules to control the contractions and I'm afraid to take them, even though 2 separate doctors said it was safe. The pharmacist talked to my husband for 20 minutes about how it's a class C. Then I read some of the side effects you all have had and I wonder if it's better to go thru the contractions. But doesn't stopping the contractions slow down labor? I'm pretty confused right now. I'm not on bedrest but every time I stand up I contract. I find myself feeling the worst in the afternoon. I'm drinking tons of water, laying on my left side, and doing hardly nothing. I already feel guilty for putting the additional burden on my husband who works so hard already, to take care of the house and the kid. Luckily I also have my mother in law here to help. I feel like so much is out of my control. I'm trying to be positive and keep this kid in me for as long as I possibly can but this lack of control is making me very nervous. Anyway, that's my story - I'll keep everyone posted on my status and I look forward to learning more about each of you. :) Amy National Candy Month Member Feature: The Blommer Chocolate Company \| EmailFacebookTwitter Throughout June NCA is celebrating National Candy Month (#NationalCandyMonth) by profiling some of the companies that make our industry great – from small candy shops to large firms engaged in cocoa processing like today’s featured member. In addition to serving as president and CEO of his family-run chocolate company, Peter is also the chairman of the National Confectioners Association. It has been a pleasure to work alongside of him this past year as we have helped bring the confectionery industry to a higher level of success and worked toward accomplishing our mission, vision and strategic goals. sealstrip Unwrapped education series	# 29 weeks – on steroids, getting FFN test Tuesday Hi everyone! I've been following some of you on Twitter when I was first put on modified bedrest in my first trimester. Now I just started my third trimester and I'm on modified bedrest again! So here's my story. I'm 38 years old. I have one child (a son via c-section – 4) and have had 6 miscarriages. This is pregnancy number 8. I have been on blood thinners since the beginning of my pregnancy because the doctors discovered I have a genetic disposition for blood clots, which were likely the cause of my many miscarriages. After I made it thru the first trimester, we thought I was basically in the clear and I went on to have a relatively uneventful 2nd trimester. The contractions started at 28 weeks – but they weren't regular and started after I took a longer than usual walk with the dog. So I drank water, called my doctor, and was told to not worry about it until I had more than four in an hour and they were regular. Then on Tuesday of this week, they started again at 3:30 in the afternoon, every 10 minutes, for 3 hours. After calling the nurse line, I was directed to L&D. I was monitored right away and started drinking water. They continued at every 10 minutes. They did a cervical exam and said I was 1 cm dilated. The doctor suggested steroid shots so after discussing it my husband and I agreed and I got the first of two shots. Finally, the contractions became irregular. But then I started bleeding pretty heavily. The doctor examined me and figured out that the bleeding wasn't active and was most likely due to the cervical exam, since I am on blood thinners and bleed easily. I went home to rest and returned the next night for my second steroid shot. They decided on Wednesday to not do another cervical exam because of the bleeding. Then the doctor suggested I do the Fetal Fibronectin test. Instead of waiting in the L&D for 24 hours to pass from my internal exam, I went home and then went into my doctor's office the next day to take the test there. When my doctor did the FFN test I still had leftover blood present so they couldn't send it in. I will go back on Tuesday and get the test taken then. In the meantime, I was given nifedipine 20 mg capsules to control the contractions and I'm afraid to take them, even though 2 separate doctors said it was safe. The pharmacist talked to my husband for 20 minutes about how it's a class C. Then I read some of the side effects you all have had and I wonder if it's better to go thru the contractions. But doesn't stopping the contractions slow down labor? I'm pretty confused right now. I'm not on bedrest but every time I stand up I contract. I find myself feeling the worst in the afternoon. I'm drinking tons of water, laying on my left side, and doing hardly nothing. I already feel guilty for putting the additional burden on my husband who works so hard already, to take care of the house and the kid. Luckily I also have my mother in law here to help. I feel like so much is out of my control. I'm trying to be positive and keep this kid in me for as long as I possibly can but this lack of control is making me very nervous. Anyway, that's my story – I'll keep everyone posted on my status and I look forward to learning more about each of you. :) Amy --- # National Candy Month Member Feature: The Blommer Chocolate Company Throughout June NCA is celebrating National Candy Month (#NationalCandyMonth) by profiling some of the companies that make our industry great – from small candy shops to large firms engaged in cocoa processing like today’s featured member. In addition to serving as president and CEO of his family-run chocolate company, Peter is also the chairman of the National Confectioners Association. It has been a pleasure to work alongside him this past year as we have helped bring the confectionery industry to a higher level of success and worked toward accomplishing our mission, vision and strategic goals.	962	850	3,638,284,293,698,420,000	concat	[ "concat_full" ]	0.75	true	null
3,181,126,031,902,525,000	Heck 6 British 97% pork sausages400g You have 0 of this in your trolley 3.2 out of 5 stars21 reviews Heck 6 British 97% pork sausages 0 in trolley Quantity of Heck 6 British 97% pork sausages in trolley 0 0 in trolley. Add to favourites or list Pork (97%) Sausages with Seasoning Gluten and dairy free. Juicy, lean and bursting with flavour. Bed down with rosemary roasties and rich onion gravy. British Pork Shoulder (97%), Seasoning (Salt, Rice Flour, Spices, Preservative (Sodium SULPHITE), Sugar, Antioxidant (Ascorbic Acid)) , Filled into Beef Collagen Casings Allergens refer to ingredients in BOLD Typical valuesPer 100g (grilled) Energy1182kJ Energy289kcal Fat21.9g Of which Saturates7.6g Carbohydrate1.2g Of which Sugars0.1g Protein20.3g Salt1.89g Origin Information • United Kingdom • Produced in the UK using British pork Allergy advice • Free From Dairy • Free From Gluten Cooking instructions General Remove all packaging before cooking. Cooking instructions are a guide only from chilled. Grill Place on the middle shelf under a pre-heated medium grill for 16 - 18 minutes. Turn occasionally. Oven cook Pre-heat oven to 190°C / Fan 170° / Gas Mark 5. Place in the middle of the oven and bake for 25-30 minutes. Turn occasionally. Ensure piping hot throughout before serving. Recycling ComponentMaterialRecyclable SleeveBlank TrayBlank Disclaimer Please note that while we take every care to make sure the product information displayed on our website is correct, product recipes are regularly changed. This may affect nutrition and allergen information therefore you should always check product labels and not rely solely on the information presented here. If you require specific advice on any Waitrose branded product, please contact our Customer Care Team. For all other products, please contact the manufacturer. This information is supplied for personal use only. It may not be reproduced in any way whatsoever without the prior consent of Waitrose Limited nor without due acknowledgement. Legal disclaimer Restaurants in Dubai » Bar » 200 400 Listing 19 Restaurants in Dubai » Bar » 200 400 Refine your search: Al Farran Cuisines: Arabic, Middle Eastern Cost for 2: Dhs, 200-400 Opening hours: 8:00 AM - 8:00 PM Al Manara Jumeirah Beach Residence (JBR) Habtoor Grand Beach Resort & Spa Jumeirah Beach, Ground Level Cuisines: International Cost for 2: Dhs, 200-400 Opening hours: 8:00 AM - 8:00 PM Al Murjan Dubai Marina Al Sufouh Road, Le Royal Meridien Beach Resort & Spa Cuisines: British, Tea Cost for 2: Dhs, 200-400 Opening hours: 5:00 AM - 10:00 PM Awtar Garhoud Grand Hyatt Dubai, Upper Atrium, Sheikh Rashid Road Cuisines: Lebanese Cost for 2: Dhs, 200-400 Opening hours: 7:00 PM - 3:00 AM Ayam Zaman Khalid Bin Al Waleed Royal Ascot Hotel, Mezzanine Level Cuisines: Lebanese, Mediterranean, Middle Eastern Cost for 2: Dhs, 200-400 Opening hours: 9:00 PM - 3:00 AM Baker Street Cafe Jumeirah Lake Towers (JLT) G08, Ground Level, Dubai Gate 1, Cluster Q Cuisines: Bakery, Breakfast, Ice Cream, Italian Cost for 2: Dhs, 200-400 Opening hours: 8:00 AM - 8:00 PM Buddha Bar Dubai Marina Tower 1, Ground Level, Grosvenor House, Al Sufouh Road Cuisines: Asian, Japanese, Sushi Cost for 2: Dhs, 200-400 Opening hours: 7:00 PM - 2:00 AM Izel World Trade Center Area Conrad Dubai, Sheikh Zayed Road Cuisines: Latin American Cost for 2: Dhs, 200-400 Opening hours: 12:00 PM - 12:00 AM Kebab Connection Satwa Al Mina Road Cuisines: Kebab, North Indian Cost for 2: Dhs, 200-400 Opening hours: 1:00 AM - 1:00 AM MAKE Business Hub Dubai Marina Al Fattan House, Jumeirah Beach Road Cuisines: Breakfast, International Cost for 2: Dhs, 200-400 Opening hours: 1:00 AM - 1:00 AM Pages	# Heck 6 British 97% Pork Sausages (400g) Pork (97%) Sausages with Seasoning Gluten and dairy free. Juicy, lean and bursting with flavour. Bed down with rosemary roasties and rich onion gravy. --- ## Ingredients - British Pork Shoulder (97%) - Seasoning (Salt, Rice Flour, Spices, Preservative (Sodium SULPHITE), Sugar, Antioxidant (Ascorbic Acid)) - Filled into Beef Collagen Casings > Allergens refer to ingredients in BOLD --- ## Typical Values (per 100g, grilled) \| Nutrient \| Amount \| \|---------------------------\|-----------\| \| Energy \| 1182 kJ \| \| Energy \| 289 kcal \| \| Fat \| 21.9 g \| \| of which Saturates \| 7.6 g \| \| Carbohydrate \| 1.2 g \| \| of which Sugars \| 0.1 g \| \| Protein \| 20.3 g \| \| Salt \| 1.89 g \| --- ## Origin Information - United Kingdom - Produced in the UK using British pork --- ## Allergy Advice - Free From Dairy - Free From Gluten --- ## Cooking Instructions General Remove all packaging before cooking. Cooking instructions are a guide only from chilled. Grill Place on the middle shelf under a pre-heated medium grill for 16–18 minutes. Turn occasionally. Oven cook Pre-heat oven to 190 °C / Fan 170 °C / Gas Mark 5. Place in the middle of the oven and bake for 25–30 minutes. Turn occasionally. Ensure piping hot throughout before serving. --- ## Recycling \| Component \| Material \| Recyclable \| \|-----------\|----------\|------------\| \| Sleeve \| – \| – \| \| Tray \| – \| – \| --- ## Disclaimer Please note that while we take every care to make sure the product information displayed on our website is correct, product recipes are regularly changed. This may affect nutrition and allergen information therefore you should always check product labels and not rely solely on the information presented here. If you require specific advice on any Waitrose branded product, please contact our Customer Care Team. For all other products, please contact the manufacturer. This information is supplied for personal use only. It may not be reproduced in any way whatsoever without the prior consent of Waitrose Limited nor without due acknowledgement. Legal disclaimer --- ## Al Farran - Cuisines: Arabic, Middle Eastern - Cost for 2: Dhs 200–400 - Opening hours: 8:00 AM – 8:00 PM ## Al Manara Jumeirah Beach Residence (JBR), Habtoor Grand Beach Resort & Spa, Jumeirah Beach, Ground Level - Cuisines: International - Cost for 2: Dhs 200–400 - Opening hours: 8:00 AM – 8:00 PM ## Al Murjan Dubai Marina, Al Sufouh Road, Le Royal Meridien Beach Resort & Spa - Cuisines: British, Tea - Cost for 2: Dhs 200–400 - Opening hours: 5:00 AM – 10:00 PM ## Awtar Garhoud, Grand Hyatt Dubai, Upper Atrium, Sheikh Rashid Road - Cuisines: Lebanese - Cost for 2: Dhs 200–400 - Opening hours: 7:00 PM – 3:00 AM ## Ayam Zaman Khalid Bin Al Waleed, Royal Ascot Hotel, Mezzanine Level - Cuisines: Lebanese, Mediterranean, Middle Eastern - Cost for 2: Dhs 200–400 - Opening hours: 9:00 PM – 3:00 AM ## Baker Street Cafe Jumeirah Lake Towers (JLT), G08 Ground Level, Dubai Gate 1, Cluster Q - Cuisines: Bakery, Breakfast, Ice Cream, Italian - Cost for 2: Dhs 200–400 - Opening hours: 8:00 AM – 8:00 PM ## Buddha Bar Dubai Marina, Tower 1 Ground Level, Grosvenor House, Al Sufouh Road - Cuisines: Asian, Japanese, Sushi - Cost for 2: Dhs 200–400 - Opening hours: 7:00 PM – 2:00 AM ## Izel World Trade Center Area, Conrad Dubai, Sheikh Zayed Road - Cuisines: Latin American - Cost for 2: Dhs 200–400 - Opening hours: 12:00 PM – 12:00 AM ## Kebab Connection Satwa, Al Mina Road - Cuisines: Kebab, North Indian - Cost for 2: Dhs 200–400 - Opening hours: 1:00 AM – 1:00 AM ## MAKE Business Hub Dubai Marina, Al Fattan House, Jumeirah Beach Road - Cuisines: Breakfast, International - Cost for 2: Dhs 200–400 - Opening hours: 1:00 AM – 1:00 AM	1,084	1,108	3,181,126,031,902,525,000	concat	[ "concat_full" ]	0.75	true	null
-7,403,881,231,700,862,000	70 images for uk london skyline sunset • 841-07206395 The Shard and Tower Bridge on the River Thames at sunset, London, England, United Kingdom, Europe Rights-Managed • 700-07729957 Panoramic View of Skyline and River Thames at Sunset, London, England Rights-Managed • 862-06825393 The City of London seen from Tower Bridge. From left to right: Walkie Talkie, Tower 42 and Gherkin. Rights-Managed • 841-07206394 The Shard and Tower Bridge on the River Thames at sunset, London, England, United Kingdom, Europe Rights-Managed • 700-07729955 Overview of Skyline and River Thames at Sunset, London, England Rights-Managed • 841-09194450 Houses of Parliament at sunset, UNESCO World Heritage Site, Westmister, London, England, United Kingdom, Europe Rights-Managed • 700-06531365 London Skyline at Sunset from the South Bank with St. Pauls Cathedral, London, UK Rights-Managed • 862-03353544 England,London. Tower Bridge. Rights-Managed • 6119-08278632 Houses of Parliament and the River Thames, London, England, United Kingdom, Europe Premium Royalty-Free • 640-05760951 UK, London, Skyline with Big Ben at dusk Premium Royalty-Free • 841-06444578 Sunset over Westminster Bridge, Houses of Parliament and Big Ben, UNESCO World Heritage Site, London, England, United Kingdom, Europe Rights-Managed • 640-05760952 UK, London, Skyline with Big Ben at dusk Premium Royalty-Free • 6119-09161808 Tower Bridge, St. Paul's Cathedral and the City skyline over the River Thames at sunset, London, England, United Kingdom, Europe Premium Royalty-Free • 862-08718639 Europe, United Kingdom, England, Middlesex, London, The Shard Rights-Managed • 700-06531364 London Skyline at Sunset from the South Bank with St. Pauls Cathedral, London, UK Rights-Managed • 700-02346412 Tower Bridge and Thames River at Dawn, London, England Rights-Managed • 613-07459649 big ben and houses of parliament Premium Royalty-Free • 700-02346407 Tower Bridge and Thames River at Dawn, London, England Rights-Managed • 700-02346411 Tower Bridge at Night, London, England Rights-Managed • 700-02346409 The Mary Axe Building and Tower 42 at Dusk, London, England Rights-Managed • 700-02346410 The Mary Axe Building and Tower 42 at Dusk, The Thames River in the Foreground, London, England Rights-Managed • 700-02346408 The Mary Axe Building and Tower 42 at Dusk, London, England Rights-Managed • 6106-05435133 Parliament and the London Eye, London Premium Royalty-Free • 6119-09147265 Tower bridge framing Canary Wharf at sunset, London, England, United Kingdom, Europe Premium Royalty-Free • 6119-08517961 The London Eye at sunset (Millennium Wheel), South Bank, London, England, United Kingdom, Europe Premium Royalty-Free • 862-03353547 England,London. Canary Wharf as seen from Tower Bridge. Rights-Managed • 841-02946144 HMS Belfast moored on the Thames, illuminated at dusk, London, England, United Kingdom, Europe Rights-Managed • 862-03352955 Sunrise over the Thames Barrier Rights-Managed • 841-02945044 Canary Wharf building in Docklands, London, England, United Kingdom, Europe Rights-Managed • 613-07459647 big ben and houses of parliament Premium Royalty-Free • 845-03463342 Battersea Power Station and Battersea Rail Bridge at Dawn, London. Rights-Managed • 841-07782169 Millennium Wheel stands with Big Ben and tour boat at sunset, London, England, United Kingdom, Europe Rights-Managed • 621-00740643 Tower Bridge, London, England Premium Royalty-Free • 841-02716399 Dali elephant sculpture silhouette with Westminster skyline beyond, London, England, United Kingdom, Europe Rights-Managed • 6119-08269834 National Maritime Museum with Canary Wharf in Dockland on skyline, Greenwich, London, England, United Kingdom, Europe Premium Royalty-Free • 851-02961551 Big Ben and Houses of Parliament,London,England,UK Rights-Managed • 862-03353546 England,London. Tower Bridge and a view to the City. Rights-Managed • 400-06696365 The iconic view of London - the famous pedestrian Millennium Bridge over the Thames with views of St. Paul's Cathedral in the warm rays of the setting sun Budget Royalty-Free & Subscription • 400-04635610 Vector illustration of London skyline at sunset with reflection on the Thames Budget Royalty-Free & Subscription • 700-00610427 London City Hall and the Tower Bridge at Dawn, London, England Rights-Managed • 400-06077909 Canary Wharf, skyscrapers of London's financial district Budget Royalty-Free & Subscription • 700-00610432 City Skyline With The Gherkin Building, London, England Rights-Managed • 700-00610430 London City Hall and the Tower Bridge at Dawn, London, England Rights-Managed • 845-03464456 City Hall at Sunrise, London Rights-Managed • 400-04158570 New London city hall at night from Thames river Budget Royalty-Free & Subscription • 841-02715954 Millennium Bridge, River Thames, London, England, United Kingdom, Europe Rights-Managed • 841-03034605 City Hall with Tower Bridge behind,London,England,United Kingdom,Europe Rights-Managed • 400-04158568 New London city hall at night with pedestrians on sidewalk Budget Royalty-Free & Subscription • 841-02918972 Houses of Parliament from the South Bank, London, England, United Kingdom, Europe Rights-Managed • 845-03464454 Canary Wharf Sunrise Over the River Thames in London Rights-Managed • 841-03035046 Dali elephant sculpture silhouette with Westminster skyline beyond,London,England,United Kingdom,Europe Rights-Managed • 845-02729693 Houses of Parliament at Sunset, Westminster, London. South Bank of the River Thames. Architect: Charles Barry A. W. N. Pugin Rights-Managed • 400-04566505 london skyline framed against sunset Budget Royalty-Free & Subscription • 862-08718638 Europe, United Kingdom, England, Middlesex, London, The Shard Rights-Managed • 862-08718637 Europe, United Kingdom, England, Middlesex, London, Sky Garden Observation Deck Rights-Managed • 862-08718636 Europe, United Kingdom, England, Middlesex, London, Sky Garden Observation Deck Rights-Managed • 841-09183724 Canary Wharf from Royal Victoria dock with Sunborn Hotel, Docklands, London, England, United Kingdom, Europe Rights-Managed • 841-09183723 Canary Wharf and City Square Mile panorama from Royal Victoria dock, Docklands, London, England, United Kingdom, Europe Rights-Managed • 841-09183722 Canary Wharf and City Square Mile cityscape from Royal Victoria dock, Docklands, London, England, United Kingdom, Europe Rights-Managed • 6119-09074958 Tower Bridge and City of London skyline from Butler's Wharf at sunset, London, England, United Kingdom, Europe Premium Royalty-Free • 841-09086026 Big Ben (the Elizabeth Tower) and busy traffic on Westminster Bridge at dusk, London, England, United Kingdom, Europe Rights-Managed • 841-09086020 Big Ben (the Elizabeth Tower), and busy traffic on Westminster Bridge at dusk, London, England, United Kingdom, Europe Rights-Managed • 862-08718635 Europe, United Kingdom, England, Middlesex, London, Leadenhall Building and 30 St Mary Axe Rights-Managed • 700-07729956 Panoramic View of Skyline and River Thames at Sunset, London, England Rights-Managed • 400-04448640 Fragment of the London Eye at night with motion and dark blue sky Budget Royalty-Free & Subscription • 862-03353553 England,London. View toward the city from Canary Wharf. Rights-Managed • 845-03464448 River Thames in London. Waterside docking for small Boats and pleasure cruisers Rights-Managed • 845-02729687 View of the River Thames from Richmond Hill. Late afternoon in Spring. Rights-Managed • 400-04448638 View of the london eye county hall and thames river. Budget Royalty-Free & Subscription • 845-02729696 Christmas Lights on Regent's Street, London. Rights-Managed Home / Schools in Azamgarh / Anwar Public School Anwar Public School Village & Post Godhana, Tehsil Phoolpur, Godhana, Azamgarh, Uttar Pradesh User's Rating: Not rated yet! Anwar Public School Sponsered Ads School Details principal Principal: Santosh Kumar Padhi manager Manager: N/A student Students: N/A teacher Teachers: N/A email [email protected] phone 09450754786 website N/A Please fill out the form below to contact the school directly. By clicking on 'Send Now!' above, you confirm that you accept the terms and conditions & privacy policy Simple & Powerful School Management System A software which includes everything your school will ever need Online Attendance Online staff attendance with IoT enabled device! Easy Communication Synch with your staff, students and parents. Fee Online No hussle for anybody. Sign up and start accepting fee online! Admissions It's so simple now. Get more admissions! and much more ..... Explore More!	Here’s the list converted to Markdown, with each image code and its description (license info removed): - 841-07206395: The Shard and Tower Bridge on the River Thames at sunset, London, England, United Kingdom, Europe - 700-07729957: Panoramic View of Skyline and River Thames at Sunset, London, England - 862-06825393: The City of London seen from Tower Bridge. From left to right: Walkie Talkie, Tower 42 and Gherkin. - 841-07206394: The Shard and Tower Bridge on the River Thames at sunset, London, England, United Kingdom, Europe - 700-07729955: Overview of Skyline and River Thames at Sunset, London, England - 841-09194450: Houses of Parliament at sunset, UNESCO World Heritage Site, Westmister, London, England, United Kingdom, Europe - 700-06531365: London Skyline at Sunset from the South Bank with St. Pauls Cathedral, London, UK - 862-03353544: England, London. Tower Bridge. - 6119-08278632: Houses of Parliament and the River Thames, London, England, United Kingdom, Europe - 640-05760951: UK, London, Skyline with Big Ben at dusk - 841-06444578: Sunset over Westminster Bridge, Houses of Parliament and Big Ben, UNESCO World Heritage Site, London, England, United Kingdom, Europe - 640-05760952: UK, London, Skyline with Big Ben at dusk - 6119-09161808: Tower Bridge, St. Paul's Cathedral and the City skyline over the River Thames at sunset, London, England, United Kingdom, Europe - 862-08718639: Europe, United Kingdom, England, Middlesex, London, The Shard - 700-06531364: London Skyline at Sunset from the South Bank with St. Pauls Cathedral, London, UK - 700-02346412: Tower Bridge and Thames River at Dawn, London, England - 613-07459649: big ben and houses of parliament - 700-02346407: Tower Bridge and Thames River at Dawn, London, England - 700-02346411: Tower Bridge at Night, London, England - 700-02346409: The Mary Axe Building and Tower 42 at Dusk, London, England - 700-02346410: The Mary Axe Building and Tower 42 at Dusk, The Thames River in the Foreground, London, England - 700-02346408: The Mary Axe Building and Tower 42 at Dusk, London, England - 6106-05435133: Parliament and the London Eye, London - 6119-09147265: Tower bridge framing Canary Wharf at sunset, London, England, United Kingdom, Europe - 6119-08517961: The London Eye at sunset (Millennium Wheel), South Bank, London, England, United Kingdom, Europe - 862-03353547: England, London. Canary Wharf as seen from Tower Bridge. - 841-02946144: HMS Belfast moored on the Thames, illuminated at dusk, London, England, United Kingdom, Europe - 862-03352955: Sunrise over the Thames Barrier - 841-02945044: Canary Wharf building in Docklands, London, England, United Kingdom, Europe - 613-07459647: big ben and houses of parliament - 845-03463342: Battersea Power Station and Battersea Rail Bridge at Dawn, London. - 841-07782169: Millennium Wheel stands with Big Ben and tour boat at sunset, London, England, United Kingdom, Europe - 621-00740643: Tower Bridge, London, England - 841-02716399: Dali elephant sculpture silhouette with Westminster skyline beyond, London, England, United Kingdom, Europe - 6119-08269834: National Maritime Museum with Canary Wharf in Dockland on skyline, Greenwich, London, England, United Kingdom, Europe - 851-02961551: Big Ben and Houses of Parliament, London, England, UK - 862-03353546: England, London. Tower Bridge and a view to the City. - 400-06696365: The iconic view of London - the famous pedestrian Millennium Bridge over the Thames with views of St. Paul's Cathedral in the warm rays of the setting sun - 400-04635610: Vector illustration of London skyline at sunset with reflection on the Thames - 700-00610427: London City Hall and the Tower Bridge at Dawn, London, England - 400-06077909: Canary Wharf, skyscrapers of London's financial district - 700-00610432: City Skyline With The Gherkin Building, London, England - 700-00610430: London City Hall and the Tower Bridge at Dawn, London, England - 845-03464456: City Hall at Sunrise, London - 400-04158570: New London city hall at night from Thames river - 841-02715954: Millennium Bridge, River Thames, London, England, United Kingdom, Europe - 841-03034605: City Hall with Tower Bridge behind, London, England, United Kingdom, Europe - 400-04158568: New London city hall at night with pedestrians on sidewalk - 841-02918972: Houses of Parliament from the South Bank, London, England, United Kingdom, Europe - 845-03464454: Canary Wharf Sunrise Over the River Thames in London - 841-03035046: Dali elephant sculpture silhouette with Westminster skyline beyond, London, England, United Kingdom, Europe - 845-02729693: Houses of Parliament at Sunset, Westminster, London. South Bank of the River Thames. Architect: Charles Barry A. W. N. Pugin - 400-04566505: london skyline framed against sunset - 862-08718638: Europe, United Kingdom, England, Middlesex, London, The Shard - 862-08718637: Europe, United Kingdom, England, Middlesex, London, Sky Garden Observation Deck - 862-08718636: Europe, United Kingdom, England, Middlesex, London, Sky Garden Observation Deck - 841-09183724: Canary Wharf from Royal Victoria dock with Sunborn Hotel, Docklands, London, England, United Kingdom, Europe - 841-09183723: Canary Wharf and City Square Mile panorama from Royal Victoria dock, Docklands, London, England, United Kingdom, Europe - 841-09183722: Canary Wharf and City Square Mile cityscape from Royal Victoria dock, Docklands, London, England, United Kingdom, Europe - 6119-09074958: Tower Bridge and City of London skyline from Butler's Wharf at sunset, London, England, United Kingdom, Europe - 841-09086026: Big Ben (the Elizabeth Tower) and busy traffic on Westminster Bridge at dusk, London, England, United Kingdom, Europe - 841-09086020: Big Ben (the Elizabeth Tower), and busy traffic on Westminster Bridge at dusk, London, England, United Kingdom, Europe - 862-08718635: Europe, United Kingdom, England, Middlesex, London, Leadenhall Building and 30 St Mary Axe - 700-07729956: Panoramic View of Skyline and River Thames at Sunset, London, England - 400-04448640: Fragment of the London Eye at night with motion and dark blue sky - 862-03353553: England, London. View toward the city from Canary Wharf. - 845-03464448: River Thames in London. Waterside docking for small Boats and pleasure cruisers - 845-02729687: View of the River Thames from Richmond Hill. Late afternoon in Spring. - 400-04448638: View of the london eye county hall and thames river. - 845-02729696: Christmas Lights on Regent's Street, London. --- # Anwar Public School Address: Village & Post Godhana, Tehsil Phoolpur, Godhana, Azamgarh, Uttar Pradesh User’s Rating: Not rated yet! ## School Details - Principal: Santosh Kumar Padhi - Manager: N/A - Students: N/A - Teachers: N/A - Email: [email protected] - Phone: 09450754786 - Website: N/A	2,249	1,905	-7,403,881,231,700,862,000	concat	[ "concat_full" ]	0.75	true	null
6,797,294,635,468,468,000	English Русский Tiếng Việt Bahasa Indonesia Português Español العربية 中文 \| Mobile Site Tablet Site Browser > Ascend D2> UC Browser UC web browser for Huawei Ascend D2 Your phone model is: Huawei Ascend D2 Version for your phone is: UC Browser 12.13.2.1208 Updated date: 2019-10-15 Change phone model: UC Web Browser is a global leading mobile browser developed by UCWeb. Inc. It supports most mobile operating systems. UC Browser combines the advantage of proprietary U3 kernel and cloud technology. It supports HTML5 application perfectly. And its speedy, safe, smart and scalable. Download UC Browser for free to save your data usage and enjoy a new mobile browsing experience. Download Related Models UC Browser introduction UC Browser is the leading mobile internet browser with more than 400 million users across more than 150 countries and regions. This product is currently available on all major operating platforms in 7 different languages. UC Browser new features Huawei Ascend D2 introduction Huawei Technologies Co. Ltd. is a Chinese multinational networking and telecommunications equipment and services company headquartered in Shenzhen, Guangdong, China. It is the largest telecommunications equipment maker in the world, after having overtaken Ericsson. Huawei Ascend D2 is a touchscreen phone with Android v4.1 (Jelly Bean) operating system. It supports Single SIM, GSM. Huawei Ascend D2 gets a Full HD (1080 x 1920 pixels) screen, an 13 MP, Auto focus main camera supports Full HD @ 24, Stereo sound recording, Digital image stabilization, Optical image stabilization video recording. The phone can use Wi-Fi 802.11, a/b/g/n, Mobile Hotspot, Wi-Fi Direct, bluetooth v4.0, A2DP. Talktime Up to Hours(2G) is long enough for common use. 170 grams weight, 140 x 71 x 9.40 mm make it easy to take. NewsFlash!!! Singer; Naira Marley Finally Released From Prison Custody Naira Marley has been released from custody almost two weeks since he was awarded bail by the Justice who presided over his bail hearing at the Federal high court, Ikoyi. Marlians have now been thrown into a jubilant mood as the singer finally gets home since he was arrested last month in connection with internet fraud. Prior to the release of the singer, there were rumours which flew around on the internet that there wasn’t any government official willing to stand as a surety for the singer due to his criminal records which resulted in the singer’s release being delayed. However, his management debunked the rumour saying it was false as the only reason his release was delayed was because the EFCC and the court were unable to promptly process the final steps of his release. All of these are not important anymore as the singer now regains freedom after almost a month in the ‘wilderness.’ Leave a Reply Your email address will not be published. Required fields are marked *	# UC web browser for Huawei Ascend D2 Your phone model is: Huawei Ascend D2 Version for your phone is: UC Browser 12.13.2.1208 Updated date: 2019-10-15 UC Web Browser is a global leading mobile browser developed by UCWeb. Inc. It supports most mobile operating systems. UC Browser combines the advantage of proprietary U3 kernel and cloud technology. It supports HTML5 application perfectly. And its speedy, safe, smart and scalable. Download UC Browser for free to save your data usage and enjoy a new mobile browsing experience. ## UC Browser introduction UC Browser is the leading mobile internet browser with more than 400 million users across more than 150 countries and regions. This product is currently available on all major operating platforms in 7 different languages. ## Huawei Ascend D2 introduction Huawei Technologies Co. Ltd. is a Chinese multinational networking and telecommunications equipment and services company headquartered in Shenzhen, Guangdong, China. It is the largest telecommunications equipment maker in the world, after having overtaken Ericsson. Huawei Ascend D2 is a touchscreen phone with Android v4.1 (Jelly Bean) operating system. It supports Single SIM, GSM. Huawei Ascend D2 gets a Full HD (1080 x 1920 pixels) screen, an 13 MP, Auto focus main camera supports Full HD @ 24, Stereo sound recording, Digital image stabilization, Optical image stabilization video recording. The phone can use Wi-Fi 802.11, a/b/g/n, Mobile Hotspot, Wi-Fi Direct, bluetooth v4.0, A2DP. Talktime Up to Hours(2G) is long enough for common use. 170 grams weight, 140 x 71 x 9.40 mm make it easy to take. --- # Singer Naira Marley Finally Released From Prison Custody Naira Marley has been released from custody almost two weeks since he was awarded bail by the Justice who presided over his bail hearing at the Federal High Court, Ikoyi. Marlians have now been thrown into a jubilant mood as the singer finally gets home since he was arrested last month in connection with internet fraud. Prior to the release of the singer, there were rumours which flew around on the internet that there wasn’t any government official willing to stand as a surety for the singer due to his criminal records which resulted in the singer’s release being delayed. However, his management debunked the rumour saying it was false as the only reason his release was delayed was because the EFCC and the court were unable to promptly process the final steps of his release. All of these are not important anymore as the singer now regains freedom after almost a month in the ‘wilderness.’	620	566	6,797,294,635,468,468,000	concat	[ "concat_full" ]	0.75	true	null
2,448,664,344,895,063,000	Blog Leaf-Peeping Can Be About More Than the Leaves Leaf-peeping road trips do not have to be all about the leaves. There are plenty of other things that you can do while you are searching for some of the best peaks when it comes to the fall leaves. You just have to be knowledgeable and creative in your trip. Read More Categories: Comfort and Safety in the 2019 Hyundai Accent Even with vehicles that are fun and powerful in their performance, the safety of the driver and passengers is the most important factor to consider. The 2019 Hyundai Accent has features that can make you comfortable in this compact car. Our Pantili Hyundai technicians choose this because of the different comfort-based features. Read More Categories: Hyundai Elantra Performance Features The Hyundai Elantra is one of the top compact cars available. With its class-leading engines, transmission, and powertrain options, you'll love the way that the Elantra performs on the road. With fast acceleration and lots of power, the Elantra sedan offers a powerful 2.0-liter engine with four cylinders. It includes 147 horsepower and a CVT, which is a continuously variable transmission. Read More Categories: The Hyundai Veloster N is Designed For Handling One of the best things about the 2019 Hyundai Veloster N is that it has a few exclusive features. One feature has been designed just for the Veloster N. This enhances the performance of this particular vehicle in a way that is satisfying. You will experience responsive handling and an overall experience with the vehicle. Read More Categories: Ride In Style With The 2019 Hyundai Santa Fe The Hyundai Santa Fe has garnered plenty of attention since its debut years ago. This crossover SUV has also grown quite popular among a diverse mix of people. The 2019 Santa Fe is a remarkable vehicle because it can do so many things. In addition to that, this crossover provides many beneficial components. Read More Categories: Controlling Pet Hair in Your Car Pets are wonderful, but it's no fun being in the close quarters of a car with stray pet hairs floating in the air. Tame your pet's fur with a quick brushing before you embark on your journey. If your pet can ride in a crate, this is one of the better ways to keep the fur contained in one place. Read More Categories: How to Recognize Worn Out Vehicle Belts and Hoses You don't have to be a mechanic to know that vehicles need regular maintenance. This includes belts, which help parts like the alternator run efficiently, and hoses, which transfer fuel and other liquids through the car. When maintenance of these parts is lax, it could spell trouble. Read More Categories: The Hyundai Sonata Offers a Mellow Ride While it can be a great thing to have a vehicle that is going to give you a ton of thrilling rides, there are vehicles like the Hyundai Sonata which is more mellow. People who are more interested in a rather calm ride will benefit the most from this vehicle. The calmest of the engines is the 2.4-liter engine which gives you 185 horsepower. Read More Categories: The Latest Technology Finds a Home in the Hyundai Kona Striking good looks, excellent fuel economy, and a surprisingly spacious interior aren't the only great features you can expect from the Hyundai Kona. Superb technology is also integrated into every Kona, allowing you to stay connected, no matter where you roam. You can always expect to arrive at your destination with a fully-charged phone when you drive the Hyundai Kona. Read More Categories: Search found 1119 matches by cluedoking123 Thu Sep 19, 2019 4:21 pm Forum: General Discussion Topic: Clue Current Thoughts Replies: 1530 Views: 555719 Re: Clue Current Thoughts Jamie wrote: Tue Sep 03, 2019 7:47 am I've recently rewatched the UK series and also the French ones and they have revived my enthusiasm for mysteries and I'm working on a new set of TV mysteries using the Sims. Keep your eyes peeled! OMG! Amazing! That takes me back! I'll def. keep my eyes peeled :D by cluedoking123 Tue Sep 03, 2019 12:13 am Forum: General Discussion Topic: What would the Clue Characters sound like? Replies: 8 Views: 723 Re: What would the Clue Characters sound like? Frozone's wife being Mrs. Meadow-Brook tickled me pink :lol: by cluedoking123 Mon Aug 26, 2019 11:29 pm Forum: General Discussion Topic: Hasbro to axe the Hall? Replies: 20 Views: 1239 Re: Hasbro to axe the Hall? Totally came here to post this exact thing! haha! I was REAL tempted to vote for the drawing room! But in the end I couldn't let them get rid of the hall so I voted for the hall to get a new look...I HIGHLY doubt that's what will get chosen. by cluedoking123 Fri Jun 14, 2019 3:08 pm Forum: General Discussion Topic: Clue Trivia - Play it! Replies: 1382 Views: 419364 Re: Clue Trivia - Play it! Jonathan Green wrote: Fri Jun 14, 2019 9:40 am What's Madame Rose's full name in Master Detective? OMG! That is such a good question! :lol: I know where I could find the answer, but I don't want to cheat. Just know I see you sit and I appreciate you! by cluedoking123 Sat May 04, 2019 11:56 am Forum: General Discussion Topic: Clue: 13 Dead End Drive Replies: 23 Views: 10256 Re: Clue: 13 Dead End Drive I love this! 13 dead end drive was one of my favorites growing up! by cluedoking123 Sun Mar 24, 2019 6:17 pm Forum: General Discussion Topic: Miss Peach Replies: 8 Views: 1958 Re: Miss Peach That is a lot stronger! Well done! I always picture Miss Peach to be innocent looking, I like your more devious take =) by cluedoking123 Wed Mar 20, 2019 9:08 pm Forum: General Discussion Topic: Miss Peach Replies: 8 Views: 1958 Re: Miss Peach I think you're on the right track, but the art isn't very seamless. You're close though I think. by cluedoking123 Sat Mar 09, 2019 5:41 pm Forum: Miscellaneous Topic: Current Thoughts Replies: 5315 Views: 1071618 Re: Current Thoughts oh no! I'm so sorry, glad you are alright! Hope your bike get's better soon! =) by cluedoking123 Sat Feb 16, 2019 10:23 am Forum: General Discussion Topic: CLUE Movie Monopoly Game Replies: 3 Views: 1352 Re: CLUE Movie Monopoly Game is this real? by cluedoking123 Tue Jan 29, 2019 1:34 pm Forum: General Discussion Topic: Clue Current Thoughts Replies: 1530 Views: 555719 Re: Clue Current Thoughts You know what REALLY needs to happen? A version of the game with the cast from the movie! Why isn't this a thing? Now with it's cult following I feel like it needs to happen soon to appeal to our nostalgia before the risk of it possibly fading into obscurity with the younger generations. Maybe even... by cluedoking123 Mon Jan 14, 2019 4:19 pm Forum: Miscellaneous Topic: Murder at Blood Mansion Replies: 4 Views: 1705 Re: Murder at Blood Mansion Fair enough lol by cluedoking123 Fri Jan 11, 2019 12:10 pm Forum: General Discussion Topic: Clue Current Thoughts Replies: 1530 Views: 555719 Re: Clue Current Thoughts Is it just me or does Jamie Lee Curtis (a la this years Golden Globes) look eerily like the Super Sleuth Mrs. Peacock card? Image by cluedoking123 Fri Jan 11, 2019 9:03 am Forum: Miscellaneous Topic: Murder at Blood Mansion Replies: 4 Views: 1705 Re: Murder at Blood Mansion I am just now hearing about this game! I looks so cool! How dare you do such awful things to my wallet?! :lol: by cluedoking123 Fri Dec 28, 2018 7:00 pm Forum: General Discussion Topic: Favorite Miss Scarlett Replies: 14 Views: 3311 Re: Favorite Miss Scarlett Fab. My vote is still Lysette. She just really had the personality down. I also thought she looked it too. by cluedoking123 Fri Dec 28, 2018 12:44 am Forum: General Discussion Topic: Favorite Miss Scarlett Replies: 14 Views: 3311 Re: Favorite Miss Scarlett Man that was a tough call. Also shouldn't Nicole Van Dam be on that poll? Not that she's my vote but I do think she should be included. by cluedoking123 Fri Dec 14, 2018 2:22 pm Forum: General Discussion Topic: Clue Current Thoughts Replies: 1530 Views: 555719 Re: Clue Current Thoughts Zoo977 wrote: Tue Oct 09, 2018 9:34 pm Image Not seeing anything new here but gotta say, this felt really good to see in a store :D I LOVE 13 dead end drive! by cluedoking123 Sun Dec 02, 2018 7:20 pm Forum: General Discussion Topic: Cluedo Game Sign-Up! Replies: 18 Views: 3990 Re: Cluedo Game Sign-Up! No worries :D by cluedoking123 Mon Nov 26, 2018 11:28 am Forum: General Discussion Topic: New Clue Dr. Orchid 2nd Edition with Card Revealing Mirror Replies: 62 Views: 14273 Re: New Clue Dr. Orchid 2nd Edition with Card Revealing Mirror Just so y'all know, this edition is currently on sale on Amazon for $10! Happy Cyber Monday! :D by cluedoking123 Sat Nov 24, 2018 10:28 pm Forum: General Discussion Topic: Cluedo Game Sign-Up! Replies: 18 Views: 3990 Re: Cluedo Game Sign-Up! Prof. Plum :D	## Leaf-Peeping Can Be About More Than the Leaves Leaf-peeping road trips do not have to be all about the leaves. There are plenty of other things that you can do while you are searching for some of the best peaks when it comes to the fall leaves. You just have to be knowledgeable and creative in your trip. ## Comfort and Safety in the 2019 Hyundai Accent Even with vehicles that are fun and powerful in their performance, the safety of the driver and passengers is the most important factor to consider. The 2019 Hyundai Accent has features that can make you comfortable in this compact car. Our Pantili Hyundai technicians choose this because of the different comfort-based features. ## Hyundai Elantra Performance Features The Hyundai Elantra is one of the top compact cars available. With its class-leading engines, transmission, and powertrain options, you'll love the way that the Elantra performs on the road. With fast acceleration and lots of power, the Elantra sedan offers a powerful 2.0-liter engine with four cylinders. It includes 147 horsepower and a CVT, which is a continuously variable transmission. ## The Hyundai Veloster N is Designed For Handling One of the best things about the 2019 Hyundai Veloster N is that it has a few exclusive features. One feature has been designed just for the Veloster N. This enhances the performance of this particular vehicle in a way that is satisfying. You will experience responsive handling and an overall experience with the vehicle. ## Ride In Style With The 2019 Hyundai Santa Fe The Hyundai Santa Fe has garnered plenty of attention since its debut years ago. This crossover SUV has also grown quite popular among a diverse mix of people. The 2019 Santa Fe is a remarkable vehicle because it can do so many things. In addition to that, this crossover provides many beneficial components. ## Controlling Pet Hair in Your Car Pets are wonderful, but it's no fun being in the close quarters of a car with stray pet hairs floating in the air. Tame your pet's fur with a quick brushing before you embark on your journey. If your pet can ride in a crate, this is one of the better ways to keep the fur contained in one place. ## How to Recognize Worn Out Vehicle Belts and Hoses You don't have to be a mechanic to know that vehicles need regular maintenance. This includes belts, which help parts like the alternator run efficiently, and hoses, which transfer fuel and other liquids through the car. When maintenance of these parts is lax, it could spell trouble. ## The Hyundai Sonata Offers a Mellow Ride While it can be a great thing to have a vehicle that is going to give you a ton of thrilling rides, there are vehicles like the Hyundai Sonata which is more mellow. People who are more interested in a rather calm ride will benefit the most from this vehicle. The calmest of the engines is the 2.4-liter engine which gives you 185 horsepower. ## The Latest Technology Finds a Home in the Hyundai Kona Striking good looks, excellent fuel economy, and a surprisingly spacious interior aren't the only great features you can expect from the Hyundai Kona. Superb technology is also integrated into every Kona, allowing you to stay connected, no matter where you roam. You can always expect to arrive at your destination with a fully-charged phone when you drive the Hyundai Kona. --- ### Re: Clue Current Thoughts > I’ve recently rewatched the UK series and also the French ones and they have revived my enthusiasm for mysteries and I’m working on a new set of TV mysteries using the Sims. Keep your eyes peeled! OMG! Amazing! That takes me back! I’ll def. keep my eyes peeled :D --- ### Re: What would the Clue Characters sound like? > Frozone’s wife being Mrs. Meadow-Brook tickled me pink! :lol: --- ### Re: Hasbro to axe the Hall? Totally came here to post this exact thing! haha! I was REAL tempted to vote for the drawing room! But in the end I couldn’t let them get rid of the hall so I voted for the hall to get a new look... I HIGHLY doubt that’s what will get chosen. --- ### Re: Clue Trivia – Play it! > What’s Madame Rose’s full name in Master Detective? OMG! That is such a good question! :lol: I know where I could find the answer, but I don’t want to cheat. Just know I see you sin and I appreciate you! --- ### Re: Clue: 13 Dead End Drive I love this! 13 Dead End Drive was one of my favorites growing up! --- ### Re: Miss Peach That is a lot stronger! Well done! I always picture Miss Peach to be innocent looking, I like your more devious take =) --- ### Re: Miss Peach I think you’re on the right track, but the art isn’t very seamless. You’re close though, I think. --- ### Re: Current Thoughts Oh no! I’m so sorry, glad you are alright! Hope your bike gets better soon! =) --- ### Re: CLUE Movie Monopoly Game Is this real? --- ### Re: Clue Current Thoughts You know what REALLY needs to happen? A version of the game with the cast from the movie! Why isn’t this a thing? Now with its cult following I feel like it needs to happen soon to appeal to our nostalgia before the risk of it possibly fading into obscurity with the younger generations. Maybe even... --- ### Re: Murder at Blood Mansion Fair enough lol --- ### Re: Clue Current Thoughts Is it just me or does Jamie Lee Curtis (à la this year’s Golden Globes) look eerily like the Super Sleuth Mrs. Peacock card? --- ### Re: Murder at Blood Mansion I am just now hearing about this game! It looks so cool! How dare you do such awful things to my wallet?! :lol: --- ### Re: Favorite Miss Scarlett Fab. My vote is still Lysette. She just really had the personality down. I also thought she looked it, too. --- ### Re: Favorite Miss Scarlett Man, that was a tough call. Also shouldn’t Nicole Van Dam be on that poll? Not that she’s my vote but I do think she should be included. --- ### Re: Clue Current Thoughts Not seeing anything new here but gotta say, this felt really good to see in a store :D I LOVE 13 Dead End Drive! --- ### Re: Cluedo Game Sign-Up! No worries :D --- ### Re: New Clue Dr. Orchid 2nd Edition with Card Revealing Mirror Just so y’all know, this edition is currently on sale on Amazon for $10! Happy Cyber Monday! :D --- ### Re: Cluedo Game Sign-Up! Prof. Plum :D	2,312	1,430	2,448,664,344,895,063,000	concat	[ "concat_full" ]	0.75	true	null
-60,157,655,027,564,690	Travel Artists In Film \| Siobhan Watts of Bless The Weather in Hitchin England Artists In Film \| Siobhan Watts of Bless The Weather in Hitchin England Siobhan is someone who you might recognize my having talked about before here on the journal. I visited her in England last fall and took these portraits but she and I have been virtual friends for nearly eight years through our blogs and social media. She is quite definitely my favorite virtual-turned-real-life-friend and though my practice of doing that throughout my life baffles some people (you mean you’re going to somewhere you’ve never been to meet someone in person that you met online… that you don’t even know…) I have to say that it is that very openness that has invited what I would deem some of the dearest friends I have in this world. She has taught me many things in the way of bringing artistry and beauty to all that you do (we share love and vocations with photography and knitting for one thing, though she has many other talents besides). But one of the primary ways I’ve witnessed this is through her relationship with her daughter, Rory. Being a mother is a thing that in most societies, defines a woman once she becomes it. All-at-once she loses her identity as anything other than Mother. Motherhood is an incredible roll to have and embody. One I hope to have myself one day. Indeed, it is through my own spectacular Mother raising me in just the way she did that I have the view and independence I do in the world. If it weren’t for the way she helped shape my view of myself and others and the world around me, I wouldn’t view it as the miraculous and beautiful place that I do. Read More Folkling Vintage \| The California Coast Folkling Vintage \| The California Coast I have been in California for part of August, and while there I picked up a few vintage finds for folkling. Shooting these pieces while driving up the Pacific Coast Highway was such a fun artistic endeavor for me. It is combining many of my loves, photography, vintage, travel, all into one. I appreciate all of you who’ve supported Folkling over the last two years of its existence. It’s a venture that I get so much enjoyment out of and not only something I preach, but practice. I truly believe in the sustainability and ethical consciousness in buying secondhand first and appreciating that which already exists in the world. Additionally, you are fueling my life on The Road in more ways than one, and that’s a dream for which I cannot thank you enough. If you are interested in any of these pieces, shoot me a direct message through the Folkling instagram. Thank you to everyone who sees value in shopping slow. xo Read More To Walk In Beauty One of my pursuits in living here in New Mexico has entailed learning more about the Diné (Navajo) culture. I came across this blessing today which from my understanding is often traditionally sung during the process of weaving, in reference to Spider Woman, who is said to have first woven the universe and taught the Diné to spread the “Beauty Way” by creating beauty in their own life and thus encompassing the balance of mind, body and soul. It is also a part of the story that when Spider Woman discovered her abilities and after showing Spider Man, he created tools for her with which to weave out of the Juniper tree (read more here). A fact that seems even more meaningful to me due to my own fascination and interest in Juniper trees that primarily began sometime last year. (I don’t fully know why this feels meaningful exactly, other than the fact that I always take note when more than one interest seem to intersect with another…) The more I learn about this beautiful culture, the more I feel it has to teach us in so many ways. I thought I would share the blessing here with you today. I got chills reading it and cannot imagine how beautiful it must be in it’s original native tongue. Read More Hitchin England \| Siobhan Hitchin England \| Siobhan These are portraits of a dear friend of mine. She lives in England. We’ve been friends for about seven years, but met in person for the first time this year. Okay, there is more to this story… Siobhan and I have been internet friends through our blogs for longer than we’ve had Instagram. I remember having my blog on Blogger when she started following it, and I remember her blog, Bless The Weather, on Wordpress back when she was mostly knitting and only dabbling in taking photos. (For those of you who don’t know, she’s a kick ass full time photographer now.) We have come a long way in the development of our businesses, but more importantly our friendship. Read More View Single Post #4 Old 09-30-2004, 06:11 AM Bermaster Bermaster is offline Member Join Date: Oct 2001 Location: MA Posts: 220 Default Re: Errr? Ok. First off, I should mention I am primarily a PC user. On my PC, I am running Avid Pro Tools LE 6.5.1. We (my band) also has a Mac G4 which we use only for recording live jams (room microphones only with a 001). It is basically just to keep track off all our material we are working on when writing music. The process we use with our Mac is very redundent. The idea is this... - We show up to band practice - We run the script - We start jaming - We run another script (stop recording, bounce to disk (MP3), saves to a shared folder that is on our network that is linked to our web server) - We leave band practice and go home - Wake up the next morning, go to work, log into our web server, review our material from the night before - No questions asked, no talking about it, it just happens As of this moment we are very close to this goal. The only difference is that we do everything manually in Pro Tools. The reason for the scripting isn't just because we are lazy, but it would also keep things better organized. We wouldn't worry about file naming conventions, etc. The idea is to keep everything exact and automated to the point where we don't even have to think about it. Again, this idea might seem strange but this is just for our live jam setup. When we record for real, it is a different story altogether. Thanks. __________________ Brian Berman www.brian-berman.com Digi 002, Pro Tools LE 7 Reply With Quote	## Artists In Film \| Siobhan Watts of Bless The Weather in Hitchin England Siobhan is someone who you might recognize my having talked about before here on the journal. I visited her in England last fall and took these portraits but she and I have been virtual friends for nearly eight years through our blogs and social media. She is quite definitely my favorite virtual-turned-real-life-friend and though my practice of doing that throughout my life baffles some people (you mean you’re going to somewhere you’ve never been to meet someone in person that you met online… that you don’t even know…) I have to say that it is that very openness that has invited what I would deem some of the dearest friends I have in this world. She has taught me many things in the way of bringing artistry and beauty to all that you do (we share love and vocations with photography and knitting for one thing, though she has many other talents besides). But one of the primary ways I’ve witnessed this is through her relationship with her daughter, Rory. Being a mother is a thing that in most societies, defines a woman once she becomes it. All-at-once she loses her identity as anything other than Mother. Motherhood is an incredible roll to have and embody. One I hope to have myself one day. Indeed, it is through my own spectacular Mother raising me in just the way she did that I have the view and independence I do in the world. If it weren’t for the way she helped shape my view of myself and others and the world around me, I wouldn’t view it as the miraculous and beautiful place that I do. --- ## Folkling Vintage \| The California Coast I have been in California for part of August, and while there I picked up a few vintage finds for folkling. Shooting these pieces while driving up the Pacific Coast Highway was such a fun artistic endeavor for me. It is combining many of my loves, photography, vintage, travel, all into one. I appreciate all of you who’ve supported Folkling over the last two years of its existence. It’s a venture that I get so much enjoyment out of and not only something I preach, but practice. I truly believe in the sustainability and ethical consciousness in buying secondhand first and appreciating that which already exists in the world. Additionally, you are fueling my life on The Road in more ways than one, and that’s a dream for which I cannot thank you enough. If you are interested in any of these pieces, shoot me a direct message through the Folkling instagram. Thank you to everyone who sees value in shopping slow. xo --- ## To Walk In Beauty One of my pursuits in living here in New Mexico has entailed learning more about the Diné (Navajo) culture. I came across this blessing today which from my understanding is often traditionally sung during the process of weaving, in reference to Spider Woman, who is said to have first woven the universe and taught the Diné to spread the “Beauty Way” by creating beauty in their own life and thus encompassing the balance of mind, body and soul. It is also a part of the story that when Spider Woman discovered her abilities and after showing Spider Man, he created tools for her with which to weave out of the Juniper tree (read more here). A fact that seems even more meaningful to me due to my own fascination and interest in Juniper trees that primarily began sometime last year. (I don’t fully know why this feels meaningful exactly, other than the fact that I always take note when more than one interest seem to intersect with another…) The more I learn about this beautiful culture, the more I feel it has to teach us in so many ways. I thought I would share the blessing here with you today. I got chills reading it and cannot imagine how beautiful it must be in its original native tongue. --- ## Hitchin England \| Siobhan These are portraits of a dear friend of mine. She lives in England. We’ve been friends for about seven years, but met in person for the first time this year. Okay, there is more to this story… Siobhan and I have been internet friends through our blogs for longer than we’ve had Instagram. I remember having my blog on Blogger when she started following it, and I remember her blog, Bless The Weather, on Wordpress back when she was mostly knitting and only dabbling in taking photos. (For those of you who don’t know, she’s a kick ass full time photographer now.) We have come a long way in the development of our businesses, but more importantly our friendship. --- Author: Bermaster Ok. First off, I should mention I am primarily a PC user. On my PC, I am running Avid Pro Tools LE 6.5.1. We (my band) also have a Mac G4 which we use only for recording live jams (room microphones only with a 001). It is basically just to keep track of all our material we are working on when writing music. The process we use with our Mac is very redundant. The idea is this… ### Workflow - We show up to band practice - We run the script - We start jamming - We run another script (stop recording, bounce to disk (MP3), save to a shared folder that is on our network that is linked to our web server) - We leave band practice and go home - Wake up the next morning, go to work, log into our web server, review our material from the night before - No questions asked, no talking about it, it just happens As of this moment we are very close to this goal. The only difference is that we do everything manually in Pro Tools. The reason for the scripting isn’t just because we are lazy, but it would also keep things better organized. We wouldn’t worry about file naming conventions, etc. The idea is to keep everything exact and automated to the point where we don’t even have to think about it. Again, this idea might seem strange but this is just for our live jam setup. When we record for real, it is a different story altogether. Thanks. — Brian Berman www.brian-berman.com Digi 002, Pro Tools LE 7	1,377	1,285	-60,157,655,027,564,690	concat	[ "concat_full" ]	0.75	true	null
1,701,862,119,380,626,700	Super 8 by Wyndham O'Fallon Affordable Comfort in O'Fallon Non-smoking hotel convenient to the St. Louis Arch and St. Louis Zoo You can depend on our Super 8 O’Fallon hotel for a comfortable, affordable visit to the greater St. Louis area. You will enjoy our proximity to Lambert-St. Louis International Airport, as well as MidAmerica St. Louis Airport, just 27 and seven miles away, respectively. We are right off I-64 and minutes from Scott Air Force Base, McKendree University and the Metro Rec Plex. Make Your Stay Super Enjoy free breakfast, WiFi, and more Enjoy a free SuperStart Breakfast daily and free WiFi throughout the hotel. Take a dip in our seasonal outdoor pool or stroll our courtyard. Our non-smoking rooms provide ample space for relaxation. Guest rooms feature microwave, refrigerator, coffee maker, hairdryer, iron, and ironing board. Things to Do Enjoy golf, movies, and sightseeing in nearby St. Louis Visit Tamarack Golf Club and the Hills Golf Club to improve your swing. Less than 10 minutes away, catch a movie at the local cinema. If you are in the mood for sightseeing, St. Louis is a 20 minute drive. View the St. Louis Arch or visit the animals at the St. Louis Zoo. Local company headquarters include UStranscom, Mitre Corporation, Thrivent Financial for Lutherans, and Scott Air Force Base. Photos Pool at the Super 8 by Wyndham O'Fallon in OFallon, Illinois Super 8 by Wyndham O'Fallon hotel lobby in OFallon, Illinois Guest room at the Super 8 by Wyndham O'Fallon in OFallon, Illinois Map & Directions 1100 Eastgate Dr, OFallon, IL, 62269-3711 Amenities GROUP BOOKINGS Plan Your Group Travel With Us Book your wedding party, sports team, or other group travel at our hotel. Submit your request for information about special rates on blocks of rooms. Reviews Las Vegas Office 9205 West Russell Road Suite 240 Las Vegas, NV 89148 Money One of the keys to a sound financial strategy is spending less than you take in, and then finding a way to put your excess to work. A money management approach involves creating budgets to understand and make decisions about where your money is going. It also involves knowing where you may be able to put your excess cash to work. Have A Question About This Topic? Thank you! Oops! Once Upon a Goal Once Upon a Goal Do you know how to set up your financial goals for success? This knight does. Password Protection Strategies Password Protection Strategies Simple steps may help you foil hackers and protect your privacy. What Our Kids Can Teach us About Saving Money What Our Kids Can Teach us About Saving Money Would you guess that Millennials are effectively saving for retirement? Well, they are. How Big is Money? Learn a little about worldwide currency in this fun infographic Making Sense of U.S. Household Net Worth A look inside the U.S. government's statistics on household net worth. Spotting Credit Trouble The wise use of credit is a critical skill. These 10 questions will help you assess your skill level. The Lowdown on Those Free Credit Scores What’s the deal with your yearly free credit report? U.S. Personal Savings Rate What can be learned from the savings rate? Strategies For Managing Student Loan Debt Five strategies for managing your student debt. View all articles Doubling Your Money This calculator demonstrates the power of compound interest. What Is My Current Cash Flow? Assess whether you are running “in the black” or “in the red” each month. Historical Inflation This calculator shows how inflation over the years has impacted purchasing power. Paying Off a Credit Card Enter various payment options and determine how long it may take to pay off a credit card. View all calculators Your Cash Flow Statement A presentation about managing money: using it, saving it, and even getting credit. View all presentations The Power of Compound Interest Learn how to harness the power of compound interest for your investments. Once Upon a Goal Do you know how to set up your financial goals for success? This knight does. What Our Kids Can Teach us About Saving Money Would you guess that Millennials are effectively saving for retirement? Well, they are. The Cost of Procrastination Procrastination can be costly. When you get a late start, it may be difficult to make up for lost time. The Latte Lie and Other Myths Do you know these three personal finance sayings? Keeping Up with the Joneses Lifestyle inflation can be the enemy of wealth building. What could happen if you invested instead of buying more stuff? View all videos	# Super 8 by Wyndham O'Fallon ## Affordable Comfort in O'Fallon Non-smoking hotel convenient to the St. Louis Arch and St. Louis Zoo You can depend on our Super 8 O’Fallon hotel for a comfortable, affordable visit to the greater St. Louis area. You will enjoy our proximity to Lambert-St. Louis International Airport, as well as MidAmerica St. Louis Airport, just 27 and seven miles away, respectively. We are right off I-64 and minutes from Scott Air Force Base, McKendree University and the Metro Rec Plex. ## Make Your Stay Super ### Enjoy free breakfast, WiFi, and more Enjoy a free SuperStart Breakfast daily and free WiFi throughout the hotel. Take a dip in our seasonal outdoor pool or stroll our courtyard. Our non-smoking rooms provide ample space for relaxation. Guest rooms feature microwave, refrigerator, coffee maker, hairdryer, iron, and ironing board. ## Things to Do Enjoy golf, movies, and sightseeing in nearby St. Louis - Visit Tamarack Golf Club and the Hills Golf Club to improve your swing - Less than 10 minutes away, catch a movie at the local cinema - If you are in the mood for sightseeing, St. Louis is a 20-minute drive—view the St. Louis Arch or visit the animals at the St. Louis Zoo - Local company headquarters include UStranscom, Mitre Corporation, Thrivent Financial for Lutherans, and Scott Air Force Base ## Map & Directions 1100 Eastgate Dr, O’Fallon, IL 62269-3711 ## Amenities ### GROUP BOOKINGS Plan Your Group Travel With Us Book your wedding party, sports team, or other group travel at our hotel. Submit your request for information about special rates on blocks of rooms. --- # Las Vegas Office 9205 West Russell Road Suite 240 Las Vegas, NV 89148 ## Money One of the keys to a sound financial strategy is spending less than you take in, and then finding a way to put your excess to work. A money management approach involves creating budgets to understand and make decisions about where your money is going. It also involves knowing where you may be able to put your excess cash to work. ### Articles - Once Upon a Goal - Password Protection Strategies - What Our Kids Can Teach us About Saving Money - How Big is Money? - Making Sense of U.S. Household Net Worth - Spotting Credit Trouble - The Lowdown on Those Free Credit Scores - U.S. Personal Savings Rate - Strategies For Managing Student Loan Debt - View all articles ### Calculators - Doubling Your Money This calculator demonstrates the power of compound interest. - What Is My Current Cash Flow? Assess whether you are running “in the black” or “in the red” each month. - Historical Inflation This calculator shows how inflation over the years has impacted purchasing power. - Paying Off a Credit Card Enter various payment options and determine how long it may take to pay off a credit card. - View all calculators ### Presentations - Your Cash Flow Statement A presentation about managing money: using it, saving it, and even getting credit. - View all presentations ### Videos - The Power of Compound Interest Learn how to harness the power of compound interest for your investments. - Once Upon a Goal Do you know how to set up your financial goals for success? This knight does. - What Our Kids Can Teach us About Saving Money Would you guess that Millennials are effectively saving for retirement? Well, they are. - The Cost of Procrastination Procrastination can be costly. When you get a late start, it may be difficult to make up for lost time. - The Latte Lie and Other Myths Do you know these three personal finance sayings? - Keeping Up with the Joneses Lifestyle inflation can be the enemy of wealth building. What could happen if you invested instead of buying more stuff? - View all videos	987	889	1,701,862,119,380,626,700	concat	[ "concat_full" ]	0.75	true	null
2,732,335,985,506,410,000	Bolivar County Mugshots Search for Bolivar County MS mugshots. A mugshot search can help locate or find mugshots, search mugshots, confirm identity, and provide information on criminal history, criminal record, arrest records, criminal charges, misdemeanor charges, felony charges, felony convictions, jail bookings, incarceration records, crime photos, background check, and arrest charges. Bolivar County Police Departments are law enforcement agencies that are responsible for stopping crimes and performing investigations in order to protect the community. As part of this job, Police Departments in Bolivar County Mississippi arrest and process suspected criminals, including taking mugshots. These mugshots, which show the arrested individual, become part of the arrest record, which includes the individual's personal information, the criminal charges, and information about any jail bookings or trials that resulted from the arrest. Bolivar County mugshots can also be used to confirm an individual's identity when performing a background check. These mugshots may be available through the Police Department website. Cleveland City Police Department Cleveland MS 301 South Sharpe Avenue 38732 662-843-3611 Mound Bayou Police Department Mound Bayou MS 106 Green Street West 38762 662-741-2191 Rosedale Police Department Rosedale MS 304 Court St 38769 662-759-6813 Shaw Police Department Shaw MS 303 White Oak Street 38773 662-754-5741 Shelby City Police Department Shelby MS 300 East 3rd Avenue 38774 662-398-5155 Bolivar County Sheriff Departments are charged with policing and protecting a community by investigating and stopping crimes. As part of these law enforcement responsibilities, Sheriff Departments in Bolivar County Mississippi arrest and process suspected criminals, which can include taking mugshots. These Bolivar County mugshots show the suspected individual after the arrest, and they become part of the arrest record, which includes the individual's personal information, the criminal charge, and any jail bookings or court cases that resulted from the arrest. When performing a Bolivar County background check, mugshots can also be used to confirm an individual's identity. These mugshots may be accessible to the public through the Sheriff Department website. Bolivar County Sheriff's Office Cleveland MS 2792 Highway 8 38732 662-843-5378 Special days of the year Milk Chocolate Day- July 28 July 28 is the day we celebrate the existence of the sweet, addictive chocolate, the one that can not be stopped if you start - milk chocolate !!! This is one of the special days devoted to foods in the United States. Do not get confused with the general chocolate day of November 29. Nutritional value of milk chocolate (100 grams): Calories -547 Protein - 6.8 grams Carbohydrates - 58 grams Fats - 32 grams Of which saturated fat - 19.5 grams Cholesterol - 27 grams Sodium - 82 grams. Milk chocolate does not have the nutritional benefits of its brother, the dark chocolate, but it still has some proteins. According to the dietitian's recommendation, it is permissible to eat a bar of chocolate once a week. That's why you can quietly celebrate this day by eating chocolate milk of every kind, from a small chocolate bar or a bonbonniere to a whole pack of Chocolate, Milka, Swiss or whatever you like. Hiç yorum yok: Yorum Gönder	# Bolivar County Mugshots ## Police Departments - Cleveland City Police Department Cleveland, MS 301 South Sharpe Avenue 38732 662-843-3611 - Mound Bayou Police Department Mound Bayou, MS 106 Green Street West 38762 662-741-2191 - Rosedale Police Department Rosedale, MS 304 Court St 38769 662-759-6813 - Shaw Police Department Shaw, MS 303 White Oak Street 38773 662-754-5741 - Shelby City Police Department Shelby, MS 300 East 3rd Avenue 38774 662-398-5155 ## Sheriff’s Office - Bolivar County Sheriff's Office Cleveland, MS 2792 Highway 8 38732 662-843-5378 --- # Milk Chocolate Day – July 28 July 28 is the day we celebrate the existence of the sweet, addictive chocolate, the one that can not be stopped if you start – milk chocolate!!! This is one of the special days devoted to foods in the United States. Do not get confused with the general chocolate day of November 29. Nutritional value of milk chocolate (100 grams): \| Nutrient \| Amount \| \|-----------------------------\|--------------\| \| Calories \| 547 \| \| Protein \| 6.8 grams \| \| Carbohydrates \| 58 grams \| \| Fats \| 32 grams \| \| Of which saturated fat \| 19.5 grams \| \| Cholesterol \| 27 grams \| \| Sodium \| 82 grams \| Milk chocolate does not have the nutritional benefits of its brother, the dark chocolate, but it still has some proteins. According to the dietitian's recommendation, it is permissible to eat a bar of chocolate once a week. That's why you can quietly celebrate this day by eating chocolate milk of every kind, from a small chocolate bar or a bonbonniere to a whole pack of Chocolate, Milka, Swiss or whatever you like.	708	445	2,732,335,985,506,410,000	concat	[ "concat_full" ]	0.75	true	null
-5,395,305,127,178,331,000	Сегодня: 2019-10-17 Если о событии не сообщают Крестьянские ведомости — значит, события не было ПРОДАЕТСЯ три агропредприятия и два складских комплекса в Москве и Подмосковье, готовый бизнес с готовым сбытом. Звоните. ПРОДАЕТСЯ. "Все новости, за исключением цены на хлеб, бессмысленны и неуместны". Агробизнес начинается с Крестьянских ведомостей ПРОДАЕТСЯ три агропредприятия и два складских комплекса в Москве и Подмосковье, готовый бизнес с готовым сбытом. Звоните. ПРОДАЕТСЯ. Читают многих, цитируют Крестьянские ведомости Если в вашем доме Крестьянские ведомости - значит, у вас все дома! ПРОДАЕТСЯ три агропредприятия и два складских комплекса в Москве и Подмосковье, готовый бизнес с готовым сбытом. Звоните. ПРОДАЕТСЯ. Подтвержден диагноз АЧС в Благовещенском районе Амурской области. В подведомственный Россельхознадзору ФГБУ «Федеральный центр охраны здоровья животных» для проведения референтных лабораторных исследований 7 августа 2019 года поступили на исследование 8 проб биологического материала от свиней, отобранные в крестьянском (фермерском) хозяйстве (КФХ) гражданина села Усть-Ивановка Благовещенского района Амурской области. Материал для подтверждения диагноза АЧС направлен ГБУ АО «Амурская областная ветеринарная лаборатория». Лабораторная диагностика проведена аккредитованными по ГОСТ ИСО/МЭК 17025 методическими указаниями по выявлению генома вируса африканской чумы свиней методом полимеразной цепной реакции в режиме реального времени (разработчик ФГБУ «ВНИИЗЖ»), в результате которой во всех пробах обнаружен геном вируса АЧС. Исследования проведены в рамках исполнения п.10 «Плана действий по предотвращению заноса на территорию Российской Федерации африканской чумы свиней и ее распространения на территории Российской Федерации» (утв. распоряжением Правительства РФ №2048-р от 30 сентября 2016 г). Автор: KVEDOMOSTI.RU Источник новости Комментировать Авторизация Войти с помощью соц.сетей: Если вы по каким-то причинам не можете войти на сайт, воспользуйтесь функцией восстановления пароля или напишите администратору Регистрация Войти с помощью соц.сетей: Генерация пароля Menu Gender: Male Meaning of Springer: "jumper, leaper" Origin of Springer: English surname Springer Origin and Meaning The name Springer is a boy's name meaning "jumper, leaper". This lively, springy, rarely used surname name has an interesting history. For the English, German, Dutch and Ashkenazic Jews it was a nickname for a lively person or traveling entertainer, deriving from the words springen/springhen/shpringen, and in English it's also a topographical name for someone living near the source of a stream. An unusual option if you're seeking an out-of-the-ordinary 'er'-ending name. Though for some it might bring to mind Jerry Springer, or a Spaniel. 16 names similar to Springer These 16 names were selected by our users that were looking for other names like Springer. If you didn't find an alternative name that you like better than Springer, try our name generator. It allows you to go beyond the similarities of a name, which can provide a lot of inspiration! Find other names based on Springer using our baby name generator. Popularity - this week Famous People Named Springer Pop Culture References for the name Springer Comments dresdendoll Says: 2019-01-20T17:52:33 Distinctive and distinguished, evocative of the English countryside, old-fashioned flair, water connotation lends a cool and crisp feel, reflective of the time of year, perfect surname-as-a-first-name.	# 2019-10-17 ## Подтвержден диагноз АЧС в Благовещенском районе Амурской области В подведомственный Россельхознадзору ФГБУ «Федеральный центр охраны здоровья животных» для проведения референтных лабораторных исследований 7 августа 2019 года поступили на исследование 8 проб биологического материала от свиней, отобранные в крестьянском (фермерском) хозяйстве (КФХ) гражданина села Усть-Ивановка Благовещенского района Амурской области. Материал для подтверждения диагноза АЧС направлен ГБУ АО «Амурская областная ветеринарная лаборатория». Лабораторная диагностика проведена аккредитованными по ГОСТ ИСО/МЭК 17025 методическими указаниями по выявлению генома вируса африканской чумы свиней методом полимеразной цепной реакции в режиме реального времени (разработчик ФГБУ «ВНИИЗЖ»), в результате которой во всех пробах обнаружен геном вируса АЧС. Исследования проведены в рамках исполнения п. 10 «Плана действий по предотвращению заноса на территорию Российской Федерации африканской чумы свиней и её распространения на территории Российской Федерации» (утв. распоряжением Правительства РФ № 2048-р от 30 сентября 2016 г.). Автор: KVEDOMOSTI.RU Источник новости --- # Springer Gender: Male Meaning: "jumper, leaper" Origin: English surname ## Origin and Meaning The name Springer is a boy's name meaning "jumper, leaper". This lively, springy, rarely used surname name has an interesting history. For the English, German, Dutch and Ashkenazic Jews it was a nickname for a lively person or traveling entertainer, deriving from the words springen/springhen/shpringen, and in English it's also a topographical name for someone living near the source of a stream. An unusual option if you're seeking an out-of-the-ordinary 'er'-ending name. Though for some it might bring to mind Jerry Springer, or a Spaniel. ## Comments dresdendoll (2019-01-20): Distinctive and distinguished, evocative of the English countryside, old-fashioned flair, water connotation lends a cool and crisp feel, reflective of the time of year, perfect surname-as-a-first-name.	945	549	-5,395,305,127,178,331,000	concat	[ "concat_full" ]	0.75	true	null
-1,373,409,429,458,515,200	Michelle Soucy, Author at Concord Center Acupuncture and Herbal Medicine Berkey Water Purification Systems Clean water is one of the foundations of good health. Whether you rely on well water or municipal tap water, you and your family are continually subject to delays and fluctuations in water quality, standards and testing. Recent information regarding the contamination of local well and municipal water supplies by PFAS (perfluorinated chemicals) has shown us that often we are exposed to unrecognized toxins for many years before awareness of the problem even surfaces. These emerging toxins, such as PFAS, as well as a laundry list of other manufacturing chemicals, pesticides and pharmaceuticals have been found in drinking water and can adversely affect you and your family's health. With many of these contaminates being known carcinogens, endocrine disrupters or neurotoxins it is clear that it is impossible to be in good health without clean water. The Berkey® Water Purification systems are attractive table top purifications systems that are unmatched in their ability to provide you clean water for a low cost. With the ability to purify municipal water, well water and even lake, river or pond water for emergencies or camping, the Berkey® systems provide clean, affordable and healthy water for just 2 cents per gallon. And best of all, Berkey® purified water also tastes great! If you struggle to drink eight cups of water each day it often is because your water just tastes awful. By removing toxins and impurities you can have water that tastes so amazing that it makes you want to drink it! What Are Berkey® Water Purification Systems? The Berkey® Water Purification systems are gravity fed systems that utilize filtration elements that have a unique purification capability that is due to their unique structure. The micro-pores within the Black Berkey® Elements are so small that viruses and pathogenic bacteria are simply not able to pass through them. These elements remove greater than 99.999% of viruses and pathogenic bacteria, while also removing or dramatically reducing protozoa, trihalomethanes, inorganic minerals, heavy metals, pharmaceuticals, pesticides, VOCs, petroleum products, perfluorinated chemicals (PFAS), rust, silt, sediment and radiologicals. Unlike reverse osmosis filters, the Berkey® Water Purification systems are designed to not remove beneficial ionic minerals such as magnesium and calcium. Why We Love the Berkey® Water Purification Systems • It removes or greatly reduces viruses and pathogenic bacteria, protozoa, trihalomethanes, inorganic minerals, heavy metals, pharmaceuticals, pesticides, VOCs, petroleum products, perfluorinated chemicals (PFAS), rust, silt, sediment and radiologicals often far below detectable levels. For full detailed test results see: http://berkeywaterkb.com/black-berkey-purification-elements-test-results/ • It raises water pH. • It retains beneficial ionic minerals such as magnesium and calcium. • It is 100% gravity fed and therefore does not use electricity. • It is powerful enough to purify pond, lake or stream water, making it a critical item in your emergency preparedness kit. • It is easy to use and maintain. • The resulting water tastes great and is healthy for you. Berkey Products for Sale Berkey Water Purification Systems are for sale in our clinic. Below is a list of product available. Call 978-369-9400 or email to set up a time to come by and purchase the system that is right for you. By buying from us you will receive unparalleled customer service and assistance in choosing the right system for you and your family. Big Berkey System (2.25 gal.) The 2.25 gallon Big Berkey® System comes standard with 2 Black Berkey® Purification Elements and is ideal for 1-4 people for everyday use. Berkey Water Purification Massachusetts PFAS $299 Specifications: • Holds up to 2.25 gallons of purified water • Includes 2 Black Berkey® Purification Elements standard • Expandable to 4 Black Berkey® Purification Elements total • System is 8.5" in diameter x 19.25" in height • AISI 304 stainless steel construction Royal Berkey System (3.25 gal.) The 3.25 gallon Royal Berkey® System comes standard with 2 Black Berkey® Purification Elements and is ideal for 2-4 people for everyday use. Berkey Water Purification Massachusetts PFAS $330 Specifications: • Holds up to 3.25 gallons of purified water • Includes 2 Black Berkey® Purification Elements standard • Expandable to 4 Black Berkey® Purification Elements total • System is 9" in diameter x 23" in height • AISI 304 stainless steel construction Berkey® stainless steel chambers are assembled in the USA from US and imported parts. Black Berkey® Purification Elements are made and assembled in the USA. PFAS Berkey Water Filter Massachusetts The Benefits of Grass-Fed and Pasture-Raised Broth and Meat We suggest making and drinking homemade bone broth to many patients. Sip a hot cup of homemade bone broth daily or eat it regularly in a soup, gravy or stir-fry to improve and maintain all aspects of your health. Bone broth is a must for anyone suffering from digestive problems, fatigue, frequent colds, allergies, cancer or post-surgical recovery, tremors and tics, low libido, chronic low back pain, osteoporosis, arthritis, infertility, tooth decay, hair loss, memory loss and menopausal symptoms. Why is bone broth so good for you? Bone broth is rich in minerals, collagen and amino acids and it: 1. repairs your gut 2. boosts your immune system 3. improves energy 4. nourishes your brain and nervous system 5. nourishes bones, joints and connective tissue (aka muscles, tendons and ligaments) 6. strengthens teeth and hair 7. supports fertility Would you like to benefit from the healing benefits of bone broth, but can’t seem to find the time to make it? Don't worry... we have you covered! We now carry high quality Walden Local bone broth right at our clinic. Walden Local's collagen rich broth is made from local 100% grass-fed beef and pasture-raised chicken that has been slow-simmered for more than 12 hours with no added salt. Frozen quarts of broth are available at our clinic for $12/quart. Pick up this broth at your next appointment or email to arrange a time to stop by the clinic. Walden Local also offers monthly and bi-monthly shares (which include a customizable selection of local 100% grass-fed pasture-raised meats, broth, eggs and local fish that is delivered to your doorstep every month). Click here and use this link to get free bacon and eggs with your first share. (Be sure to let them know that Bhaird and Michelle referred you). Bring us your new member order confirmation before Oct 31, 2019 and we will give you $10 off your next acupuncture treatment as an added bonus! The membership can be paused at any time and you can exclude types and cuts of meat you don’t enjoy or prefer not to eat. What Makes Walden Local Meat and Broth Better I am overjoyed at the success of Walden Local. This company is the model for a healthy and sustainable food system that is beneficial to your body and the environment. I was vegetarian for 15 years when options for healthy, humanely raised and ecologically sustainable meat were scarce. But like many young women and children, a purely vegetarian diet was not what my body needed. Chinese Medicine showed me that moderate and regular amounts of meat (including red meat), along with beans, veggies and whole grains is what my body needed to be healthy. We find this to be true for many of our patients. There is a way to eat meat without destroying our planet and our health. Local, 100% grass-fed and pasture-raised meat is the solution. What are the benefits of 100% grass-fed meat? 1. Grass-fed meat is lower in fat but higher in antioxidants, nutrients and heart healthy omega-3's and conjugated linoleic acid (CLA). 2. Grass-fed farming methods actually help trap carbon in the pasture soil, thus offsetting the methane produce by the animals by capturing and building carbon within the soil. 3. The life of grass-fed livestock most closely mimics the life of their wild ancestors, making for happier animals. They get to live a happy life in the pastures rather than imprisoned in small pens or cages. 4. Locally raised meat also helps better support our farmers by putting a larger portion of the profits in their hands. As you can probably see from this list, the food we choose to put into our body and how it was raised affects not only our health, but the health of our local community and our planet. After twenty-five years of studying ecology, sustainable agriculture and Chinese Medicine, I’m am now hopeful as I hear a national dialogue around the need for local and sustainable agriculture as part of our healthcare and climate change solutions. Over the past five years Walden Local has “built the largest meat share cooperative model in the country, in partnership with some 75 different small farms right here in New England and New York, covering 7,143 acres of active pasture this year.” When you purchase $100 of Walden Local Meat, over $95 of that money stays in the local community, with $55 going directly to the farmers. This is compared to just $30 that will stay in the community if you purchase from a chain restaurant or store. Additionally, this year, Walden Local started donating 1% of their meat to local food charities, including Second Chance Foods in Brewster, NY, Food Link in Arlington, MA and the Greater Boston Food Bank. Poor food quality is one of the many tragedies of poverty and we are so pleased to support a company that is able to help support their community with high quality protein. And did we even mention how awesome the meat tastes?! Walden Local has some the of the best tasting beef, lamb, chicken, pork, sausages, bacon, broth and eggs that we’ve EVER tasted! If you need a recipe or cooking tips for grass-fed meat, talk to Bhaird next time you are in the clinic—he loves to talk food, cooking and grilling. Monthly shares are flexible and adjustable right from the Walden Local website. If you need more information on their meat shares we are happy to answer any questions you might have. Sign Up for a Share or Purchase Your Broth Today If you want to sign up for a share you can click here and use this link to receive free bacon and eggs with your first share. (Be sure to let them know that Bhaird and Michelle referred you.) Bring us your new member order confirmation before Oct 31, 2019 and we will give you $10 off your next acupuncture treatment as an added bonus! The membership is monthly or bi-monthly but you can pause it at any time. It is also customizable. You can exclude types and cuts of meat you don’t enjoy or prefer not to eat. If you are just looking for some awesome homemade broth, spare yourself the kitchen mess and pick some up at your next appointment or shoot us an email to setup a time to stop by the clinic. 3 Tips for Overcoming Anxiety Naturally If you struggle with anxiety, you know how hard it can be to relax and fully enjoy your life. You may have a lot of nervous energy but this nervous energy eventually consumes your healthy energy, leaving you feeling drained and on edge. As a result, you may be finding it difficult to be effective at work, at home and in your relationships. Maybe you're not sleeping well at night. Maybe your heart is racing. Maybe you're shaky and nervous. Maybe you're having panic attacks and not functioning much at all. Maybe you are tired of popping sleeping pills or taking anxiety meds—the pills just aren't effective or you hate the side effects. If this sounds like you, then you've come to the right place. There is a lot that you can do to start feeling better NOW. For over 13 years we've been working with patients who are struggling with some form of anxiety. We want to share with you some things that can help you reclaim your health and your life. Below are 3 quick tips for overcoming anxiety and getting to the root of problem without side effects. Tip 1 - Use the Power of Your Exhale Spend 5-10 minutes every morning, either in bed or sitting comfortably in chair, just noticing your breathing. Feel your breath move in and out of your body. Don't change your breathing. Just notice it and allow the breath to move in and out, naturally. You can place your hands over your belly, if that helps. Kids can lie down and place their favorite stuffy on their belly to help bring their attention to the feeling of the air coming into and out of their body. Now focus your attention on your exhale. Yes that's right. Really notice your exhales. You inhale and then you exhale... the breath goes out... it dissolves and dissipates into the room around you. You inhale again and then whoosh... your breath goes out...dissipating around you. You are not trying to breathe deeply. You are just trying to allow yourself to breathe naturally while paying particular attention to your exhales. If your breath is shallow and rapid due to anxiety, that is okay. Just keep paying particular attention to your exhale. When you notice that your mind is wandering, worrying or thinking, just bring your attention back to each exhale and the feeling of your chest or belly emptying with each breath out. Whatever you are thinking about or notice while you're breathing—don't worry or judge it—just let it be there and come back to focusing on each exhale. Now with each exhale, see if you can notice the space between breaths—after you exhale and before you inhale. What do you hear or smell or feel in those spaces? See if you can focus on the sensations of the moment. Are there birds chirping? Is the heat making noise? Does your chest feel tight? What scent is being carried by the air? Focus on what is happening right now and allow that to be okay. If you are constantly trying to escape the anxiety, it will just intensify. Instead allow yourself to be aware of each moment...each exhale and each space between breaths. Even if it is uncomfortable. With each exhale, you will be able to let some of the anxiety and stress go. You are not pushing it away. You are accepting what each moment brings and during your exhale, that moment can include letting go, just as you are letting go of each breath. Tip 2 - Nourish Your Nervous System When your body is not properly nourished, your ability to be calm and grounded can be greatly compromised. Healthy food nourishes your body so that it functions optimally on all levels—both the physical and the emotional level. Improper diet is often a common cause of chronic anxiety. It's important to eat a variety of warm and cooked foods. Foods which are important in treating or preventing anxiety include red meat, homemade broth, fish, whole cooked grains, beets, carrots, winter squash, avocados, dark green leafy vegetables, nuts, seeds and beans. Eat these whole foods daily. Calming teas such as chamomile and oat straw are nourishing to your nervous system and can be taken daily. Foods to avoid include caffeine and added sugar. Caffeine actually robs your body of nourishment and increases the release of stress hormones in your body. If you struggle with anxiety, you'll need to kick the caffeine habit for sure. Sugar also depletes your body by weakening your digestive system. When your digestive system is weak, then your body does not properly extract the nutrients from your food. Diets high in refined carbohydrates and sugar are usually greatly lacking in nutrients. This doesn't mean you shouldn't eat grains at all. In fact, many who struggle with anxiety can benefit from including more cooked whole grains (not processed) into their diet as long as they are also getting plenty of the vegetables and proteins listed above. Other non-food ways that you can nourish your nervous system is by getting enough sleep, taking warm baths and taking regular walks in nature. Tip 3 - Try Acupuncture We have helped hundreds of people with anxiety, using a combination of acupuncture together with the tips described above. Acupuncture reduces stress and anxiety by naturally downshifting and calming your nervous system. Recent studies show that acupuncture often outperforms pharmaceuticals and psychotherapy in the treatment of anxiety. In one study acupuncture provided twice the reduction in both anxiety and depression symptoms when compared to conventional treatments. Unlike over-the-counter or prescription medications, acupuncture has little to no side effects. With its holistic mind body approach, acupuncture has been treating emotional imbalances for over 3,000 years. Whether treating a physical ailment or an emotional ailment, acupuncture always looks at the whole person and takes both the physical and emotional into account when developing a individualized treatment plan. It may be surprising to you, but getting acupuncture is actually relaxing. Many people fall asleep during their treatment. Others go into a state of deep relaxation. Acupuncture downshifts your sympathetic nervous system. This means that acupuncture takes you out of "fight or flight" mode and puts you back into "rest and digest" mode. This is enormously helpful if you are suffering from anxiety or stress. Over time, acupuncture reprograms your body and teaches you how to relax, how to be present and how to let go. Below is a great example of how acupuncture helped one of our patients, we'll call him Jordan, with his severe anxiety. Jordan's Panic Attacks Jordan was 15 years old when he and his mom came to our clinic looking for help with severe anxiety. Jordan was struggling with daily panic attacks, cutting and depression. He was grappling with bullying at school and divorce at home. He was on a constant rotation of pharmaceuticals, but both he and his mom were not happy with the results and the side effects of these medications. During his first acupuncture treatment Jordan was able to relax deeply. With each successive treatment he would go into a state of deep relaxation that would help reset his nervous system, clear his mind and release pent up tension. After 8 treatments, Jordan was experiencing fewer panic attacks and fewer cutting episodes. However, there were good weeks and not as good weeks still. He and his mom were also still hoping to wean Jordan off the pharmaceutical medications. We decided to add herbal medicine to Jordan's treatment plan to further improve the results he was getting. Over the course of a year, we worked together weekly, with acupuncture and herbal medicine, to help support Jordan as he transitioned into adolescents and developed a healthy attitude toward himself and his circumstances. He incorporated the mindfulness techniques and dietary suggestions that he was given. By the end of our work together, Jordan was no longer taking pharmaceuticals and was no longer experiencing anxiety, panic attacks or cutting. Jordan did come back to our clinic several years later, after graduating from high school, for several months of acupuncture and herbal medicine. He had moved away from home and was having some anxiety due to the challenges of his new life on his own. Very quickly we were able to eliminate his anxiety and support him through this new phase of his life. Jordan's positive experience with acupuncture and herbal medicine at a young age gave him a tool box of effective holistic treatment options that he could come back to again and again, if necessary. Rather than meeting life's challenges with panic attacks and cutting, acupuncture's positive, holistic and healing experience greatly altered the course of his life for the better by offering him a naturally effective treatment option without unwanted side effects. He and his mom are most grateful. This is why we love what we do and we'd love to help you too! Here’s what to do next: The Ultimate Guide to Healing Your Body and Mind 1. Download our FREE eBook—The Ultimate Guide to Healing Your Body and Mind: 3 All-Natural Steps to Reclaiming Your Health Without Unwanted Side Effects. 2. Then call our office at (978) 369-9400 to schedule your Initial Acupuncture Treatment or click here to schedule online. 3. If you got value from this article, be sure to leave a comment below sharing your biggest insight. We'd really appreciate it! If you or your friend or family member would like to take advantage of a 20 free consult to discuss how we can help, just call our office at 978-369-9400 or email us and we will set up a time. We look forward to seeing you soon! 7 Signs You Need Acupuncture This Spring According to the Chinese calendar, spring begins in February each year, preceding the spring equinox by about a month and a half. In New England the signs of spring are still subtle during these early months. We’ll experience increased warmth, sunlight and bird songs as well as a stirring of energy within ourselves. In Chinese Medicine the spring season is closely associated with the energy of the Liver. Like the rising of sap in the trees or the pushing forth of bulbs from the earth, a similar transformation of potential energy begins to rise and activate within each one of us. This is our Liver Qi or energy and its increased stirring coincides with the beginning of spring, regardless of the weather outside. The Liver channel and organ system, in Chinese Medicine, encompasses far more than just the anatomical liver organ. It is a system of energy, both physical and spiritual, which governs a collection of functions within your body. These functions overlap with the anatomical liver, but they encompass much more than just that of your anatomical liver organ. When the Liver energy within you is not in balance, specific illnesses caused by the Liver worsen. You may have health issues that seem to pop up out of nowhere this spring, but in fact they have likely surfaced because they are caused by a Liver imbalance. For most people stress is the number one cause of Liver imbalances. Stress causes your Liver Qi to become restricted, leading to Liver Qi Stagnation. This imbalance in Liver energy is one of the most common patterns that we treat in our clinic. Acupuncture is incredibly effective at balancing the Liver and reducing stress. Acupuncture has been scientifically shown to treat many of the health problems listed below. If you can relate to any of the below statements, then it’s a good sign you will benefit from some regular acupuncture treatments this season. 1. You’re feeling angry, irritable, anxious or depressed One of the jobs of the Liver system in Chinese Medicine is to ensure the smooth circulation of Qi or energy within your body. If the Liver Qi is too strong, too hot or is stuck you may experience symptoms such as frustration, anger, irritability, anxiety or depression. This is because you are suffering from Liver Qi Stagnation, Liver Fire or Liver Yang Rising. When your Liver system is brought back into balance you will experience creativity, motivation and the ability to plan your life with clear vision and optimism. 2. You’re having trouble sleeping Another job of the Liver is to store Blood. If the Liver Qi is unbalanced or the Liver Blood is not properly nourished it will lead to difficulty falling asleep or waking up in the middle of the night, often between the hours of 1 AM – 3 AM. It can also lead to sleep walking, vivid dreams or a feeling of fear just before falling asleep. 3. You have migraines and headaches Both the Liver’s job of regulating Qi and storing Blood comes into play with most migraines and headaches. When Liver Blood and Yin are too weak or too hot, the Liver energy in your body cannot be properly grounded. This leads to Liver Yang Rising. This ungrounded Liver Yang energy rises up to your head too strongly and causes migraines, headaches and even nausea and high blood pressure. 4. Your digestive system is not happy In Chinese Medicine, nothing exists or operates in isolation. Each of the organs has specific ways that they are connected to and interact with other organ systems within your body. When your Liver Qi is not moving smoothly or is too strong it can invade or overact on your digestive system. This one of the most common causes of stomach pain, acid reflux, irritable bowel syndrome, hiatal hernia, diarrhea and constipation. 5. Your hormones are out-of-whack The Liver’s function of storing Blood makes it intimately connected to menstruation and hormone balance. Liver Qi or Blood that is not moving smoothly leads to menstrual problems such as menstrual cramps, clots in the menstrual blood, PMS and irregular cycles. Deficient Liver Blood can lead to long cycles, amenorrhea, infertility and fatigue. Liver imbalances also contribute to menopausal symptoms such as hot flashes. 6. You’re suffering from muscle spasms or tight muscles Another job of the Liver is to nourish the sinews. The sinews are made up of our tendons, ligaments and fascia. When Liver Blood is weak it cannot properly nourish this connective tissue and this leads to a tendency toward developing muscle spasms or muscle tightness and rigidity. 7. You’re experiencing eye problems, tremors or dizziness The Liver Channel connects to your eyes and depends upon Liver Blood for proper nourishment. An imbalance in Liver Blood will lead to bloodshot eyes, dry eyes and declining vision. When Liver Blood is weak it cannot properly control or ground the Liver energy. This leads to Liver Wind which causes involuntary movements of the body such as nystagmus and tremors. This is also the main cause of dizziness. How to balance your Liver for better health Acupuncture does an excellent job treating Liver imbalances, especially those listed above. Spring is a great time to add regular acupuncture treatments to your health and wellness regime. Those suffering from Liver imbalances find acupuncture restorative, therapeutic and even enjoyable. It’s not uncommon for patients to report a deep sense of relaxation during their treatment as well as better sleep and a renewed vision for their life after treatment. Decisions, tasks or changes that once seemed difficult or impossible can suddenly become effortless after acupuncture treatment. This is because acupuncture is really effective at reducing stress and getting your Qi unstuck. Other things you can do at home to take care of your Liver this season is to eat lots of lightly steamed dark green or bitter leafy vegetables, beets and other iron rich foods including modest servings of red meat, fish and poultry. Herbal teas that support and treat the Liver included chamomile and oatstraw which are good for reducing stress and helping with sleep. Mei gui hua (rose buds) and bo he (mint) are good for moving Liver Qi and treating stress, depression and PMS. Gou qi zi (gou ji berries) and nettles are great for nourishing blood. Ju hua (chrysanthemum flowers) are good at clearing heat from Liver for eye problems. Milk thistle and pu gong ying (dandelion root) are good for clearing toxins from the Liver. For all Liver imbalances it is important to minimize alcohol and caffeine, exercise daily and practice daily stress reduction techniques such as mindfulness meditation, stretching and gentle yoga. With this you will be able to shake the winter blues and put the joy back into your spring season. READY TO CREATE A HEALTHIER AND HAPPIER LIFE? 1. If you know that you’re ready for some acupuncture this season, then you can schedule by calling (978) 369-9400 or you can click here to Schedule Online anytime. 2. To schedule a FREE 20 minute consult, call us at (978) 369-9400. During your consult you will be able to meet one of our practitioners, see our clinic and discuss your health concerns one on one. This is a great way to determine if our approach is right for you! 3. Don’t forget to download our FREE eBook… The Ultimate Guide to Healing Your Body and Mind Download our FREE eBook—The Ultimate Guide to Healing Your Body and Mind: 3 All-Natural Steps to Reclaiming Your Health Without Unwanted Side Effects. Bodyscan Relaxation Meditation Stress is estimated to cause 80% of all illnesses. If stress isn’t the cause of the initial disease, it worsens whatever illnesses are already present. When you study the science that shows how stress causes disease, it's frightening. Chronic stress is detrimental to your health because the constant flood of stress hormones in your body eventually begins to disrupt your hormonal balance, weaken your digestion, create inflammation and depress your immune system. In this way, stress can cause or worsen heart disease, diabetes, high blood pressure, high cholesterol, migraines, infertility, anxiety, depression, insomnia, allergies, frequent colds and flu, asthma, autoimmune disease and even cancer. Regular acupuncture treatments combined with daily meditation are a powerful combination for reversing and managing stress. Both meditation and acupuncture create a relaxation response in your body. This relaxation response down-regulates the chronic "fight or flight" response of your nervous system and puts you back into "rest and digest" mode. Together acupuncture and meditation reverse the harmful effects of stress on your health. This helps you create greater resiliency in the face of your daily challenges. Taking the time for restorative and mindful practices such as meditation, stretching and relaxation is an important component in finding balanced health in this otherwise rushed and stressed-out world. Regular acupuncture treatments combined with daily meditation are a powerful combination for managing stress and reversing its negative effects. This is why we've created this Bodyscan Relaxation Meditation, so that you can take control of your health and begin reversing the effects of stress on your health. What is the Bodyscan Relaxation Meditation? The Bodyscan Relaxation Meditation will teach you how to cultivate a strong sense of relaxation and mind-body awareness. This is one of the several pillars to transforming your health. If you’ve tried meditation before and feel like you “just can’t do it,” I assure you that this style of meditation is completely doable. This 40 minute guided meditation will walk you through the whole process and teach you how to: • relax every part of your body • cultivate a strong mind-body connection • improve your body’s innate ability to heal itself The Bodyscan Relaxation Mediation is based on a fusion of ancient Qigong and mindfulness meditation principles. By starting at your head and working down to your feet, this grounding meditation will get you out of your head and into your body. It is perfect for anyone struggling with stress, migraines, chronic muscle tension or pain, high blood pressure, anxiety or sleep problems. After listening to this audio regularly, you'll will soon be able to scan through your body on your own (while at your desk, before you go to bed or anytime you feel stressed out) and quickly let go of pain or tension. Don't let stress destroy your life. Click the play button [ ▶︎ ] below to listen to the guided audio meditation and start reclaiming your health today! Ready to continue creating a healthier and happier life? The Ultimate Guide to Healing Your Body and Mind Download our FREE eBook—The Ultimate Guide to Healing Your Body and Mind: 3 All-Natural Steps to Reclaiming Your Health Without Unwanted Side Effects. Church Action eNewsletter Week of January 26, 2015 God calls us to some things we cannot do alone. Regional Council of Churches of Atlanta Weekly Church Action eNewsletter Week of January 26, 2015 1. The Big Read 2015 Lecture, tonight, Wednesday, Jan. 28, 7:00 p.m., Decatur Library Auditorium, featuring the award-winning playwright, Sarah Gubbins (who will join the discussion via closed circuit television) and members of the cast and crew of her new play. The discussion for the evening will center on the lasting influence of Carson McCullers' work and literary legacy. 7 Stages will premiere Sarah Gubbins 'play, How Carson McCullers Saved my Life, this February. Inspired by Georgia native McCullers' The Heart Is a Lonely Hunter. 2. Armed Forces Mission presents suicide prevention workshops in faith communities for people from all walks of life teaching skills that can make the difference for those a risk. These workshops build community within your congregation and bridges of hope for your greater community. Visit the website and consider hosting an I Will Interveneworkshop in your house of worship. www.iwillintervene.org. 3. Church organizations/medical mission teams are welcome to visit MedShare’s Distribution Center in Decatur for supplies for medical mission trips abroad. MedShare is a dedicated to the efficient recovery and redistribution of the surplus of medical supplies and equipment to those most in need. Teams outside Atlanta can order at the online system. For walk-in appointments, MedShare asks a donation of $75.00 for up to the first 50 pounds and $2.00 each additional pound. Online orders have a $3.00 donation per pound, plus shipping cost. Contact Kim Lawson, (404)537-5086 or [email protected] for more information, or go to www.medshare.org. 4. Black or White, opening Friday, Jan. 30, is the story of a grandfather (Kevin Costner) who is suddenly left to care for his beloved granddaughter. When the little girl’s paternal grandmother (Octavia Spencer) seeks custody, a legal battle ensues that forces the families to confront their true feelings on race, forgiveness, and understanding. Based on real events, the movie is a look at two seemingly different worlds, in which nothing is as simple as black or white. Allied Faith and Family has prepared a faith-based family discussion guide to accompany this film and they have graciously sent it to us to share with you. You can find the faith-based discussion guide here. A link to the trailer is here if you would like a sneak peek. 5. The Rev. Canon C. K. Robertson, Ph.D., Canon to the Presiding Bishop of The Episcopal Church, headquartered in New York, NY, is the featured preacher on Day1 this Sunday. Visit Day1.org to find your local broadcaster, listen, read the transcript, or explore the blogs, conversations, and other resources. 6. Empowerment Resource Center Joins Streetz 94.5 for a Health & Wellness Event at Greenbriar Mall, January 31, making healthcare resources more accessible and available. ERC will provide free HIV testing services. Counselors, doctors, dentists, health insurers will be on site. Come to Greenbriar Mall for the food, fun, and festivities and we party with a purpose. Noon to 5 with nutrition and weight loss help, screenings, physical fitness, prevention strategies, emotional health help, child/teen/family health. 7. Are you interested in making peace posters? One Billion Rising Art Workshop at East Lake Commons, Jan.31-Feb.1, will produce posters to be taken to the National Mall and displayed the weekend of July 4. Based on the Universal Declaration of Human Rights, the posters will find a home here in Atlanta between the Carter, King, and Center for Civil and Human Rights. If you or any groups are interested in this valuable project, please contact Diane at 678-918-1945 to register. For additional information, go toOnebillionrisingatlanta.net. 8. For seven years the Annual Atlanta Catholic Business Conference has offered an amazing outlet for connecting faith and work, St. Peter Chanel Catholic Church on February 7, from 9:00 a.m. to 3:30 p.m. Conference Theme for ACBC 2015 is “Living in the Trenches of Faith at Work.” Register here. 9. Recycling at Second Ponce de Leon Baptist Church, 2715 Peachtree Road NE Atlanta on Feb. 7, 10 a.m. to 3 p.m. electronics, metals, latex paints, visitwww.keepatlantabeautiful.org for more. 10. The Church Women United in Atlanta will celebrate Black History Month during the meeting on Friday, February 5, 9:45 a.m., at the Peachtree Christian Church, 1580 Peachtree Street NE, Atlanta 30309. The celebration will consist of a panel discussion on urgent topics of race relationships and the state of the family in America and is based on the new film, “Black or White” by Kevin Costner, opening January 28. For more information contact Mrs. C. Rainey, Vice President, at (770) 964-2912 or R.s.v.p. [email protected]. Come One, Come All. CWU is a movement and membership is open to all Christian women. 11. Georgia WAND, The Real State of the Union, Feb. 5, 6:30 p.m. reception, 1 p.m. event, Ben Hill UMC, 2099 Fairburn Rd. SW, Atlanta 30331, with Janice Mathis, Jay Bookman, Aurielle Marie Lucier, and Brittany Curry. How can we stop systemic and environmental violence at the root. R.s.v.p. to [email protected] with "RSVP REAL State" in the subject. 12. First Friday at First resumes on Friday, February 6, at 6:00 p.m. at the First Church Commons. Guest artists will be renowned jazz pianist, Geri Allen “Side by Side” with Dwight Andrews. Tickets are $10 per person and can be purchased at the door. Plan to come to First Friday at First for an evening of fine music, food, and fellowship! First Congregational Church of Atlanta, 105 Courtland Street NE, Atlanta 30303. 13. “Old Style Fish Fry” Mount Zion African Methodist Episcopal Church will present a benefit Fish Fry on Saturday, Feb., 7, from 10:30 a.m. to 3 p.m., at 2977 LaVista Road,Decatur 30033. For $10, you’ll receive three pieces of delicious fried fish, two side items (green beans, potato salad, or cole slaw) and bread. Drinks and baked goods are $1.00 each. Call (404)633-2288 to pre-order meals by Feb., 1 for your family or group. Visit www.mtzionamec.org. 14. A Ladies Afternoon Tea is scheduled from 2 to 4 p.m. Saturday, Feb. 7, at Church of the Annunciation, Marietta. In addition to tea, the event includes entertainment and a gift shop. Tickets are $15. For details, click here. 15. Faith Alliance of Metro Atlanta invites people of all faiths and traditions to a celebration of diversity and harmony in Atlanta as the 5th World Interfaith Harmony Week designated by the UN General Assembly draws to a close. The festivities will include music, food, and an international marketplace. Sunday, Feb. 8, from 3:00 – 5:30 p.m.,Temple Sinai, 5645 Dupree Drive, Sandy Springs 30327. $20 suggested donation. Register here. 16. Maria Valdes, a former staff soloist for All Saints' Episcopal Church, Atlanta, now with the San Francisco Opera, will perform at 7:30 p.m. Monday, Feb. 9, at All Saints' Atlanta. Tickets are $15 and $10 for students and seniors. For details and to purchase advance tickets, click here. 17. GALEO & the GALEO Latino Community Development Fund continue accepting applications for the GALEO Institute for Leadership, Class of 2015. The seminars are open to all persons, regardless of their racial or ethnic background. Diverse participants (18 years of age and older) are encouraged to apply. The sessions will be conducted in English. Participants will be selected based on their potential for leadership and their eagerness in implementing community projects and initiatives. The deadline to apply is Wednesday, Feb. 11, 2015, at midnight. Application. Limited scholarships are available. Contact [email protected] for more information on the scholarship. This leadership program is made possible in part by the Sapelo Foundation, University of Georgia-Fanning Institute, Georgia Power, and GALEO. 18. DMST Lobby Day, Join Georgia Cares, Street Grace, Wellspring Living, and youthSpark to raise a collective voice in the fight to end Domestic Minor Sex Trafficking. This year's legislative agenda will include advocating for the passage of a Safe Harbor Law. Thursday, February 12, 8:00 a.m., The Historic Freight Depot, 65 Martin Luther King, Jr. Drive SE, Atlanta 30303. Register. 19. Diversity in Disaster for Metro Atlanta Communities, presented by American Red Cross and Joseph’s Network with FAMA and TDG, join leaders from diverse faiths and civic groups to learn about the first 72 hours in response and how communities can work together across faiths to respond most effectively. February 12, 8:30 a.m. to 1 p.m., TheTemple, 1589 Peachtree Street NE, Atlanta. Please register for this free event at www.thefirst72.org . Lunch by Maggiano’s. 20. Vanderbilt University professor author Amy-Jill Levine will be in Gainesville Feb. 13-15 for a series of lectures. She will discuss her recent book, Short Stories by Jesus: The Enigmatic Parables of a Controversial Rabbi. The event will be held at Brenau University and is sponsored in cooperation with Gainesville's First Baptist and Grace Episcopalchurches. For more information and to register, click here. 21. The Natural Spirituality Regional Gathering is Feb. 13-15 in Toccoa. Participants from across the Southeast will gather to explore the intersection of dreams, synchronicity, and "the downward path of our walk with God," according to Darby Christopher. "We have fun while paying attention to the interconnected web of life. Lectures and workshops are geared toward both newcomers and old timers." For more information visit naturalspiritualityregionalgathering.com. 22. Renewal of Vows - Say “I do” again, February 14, 11 a.m., St. Paul's Episcopal Church, 306 Peyton Road Atlanta GA 30311. Light lunch reception to follow. Children are welcomed to accompany parents. Please R.s.v.p. to [email protected] by Feb 10. 23. “Silent Sky,” Atlanta native Lauren Gunderson’s riveting exploration of the life and career of celebrated astronomer Henrietta Swan Leavitt (1868-1921) takes us on a humorous, heartwarming and motivating journey as this one-of-a-kind superstar fearlessly asserts herself in the turn-of-the-century world of Harvard’s male-driven observatory, ultimately touching the wondrous outer reaches of our universe – proof that the human mind and heart truly knows no limits! Opening at Theatrical Outfit on Feb. 14. Call the Box Office for ticket information (678)528-1500. 24. Beginning in 2007, Baptist Women in Ministry invited Baptist churches to participate in Martha Stearns Marshall Month of Preaching by having a woman preach during the month of February. This annual event has been a deeply significant source of joy and discovery for many churches as they have celebrated the giftedness of women. This annual preaching month is named for Martha Stearns Marshall, an eighteenth-century Separate Baptist woman. Northside Drive Baptist Church will welcome Paula Clayton Dempsey, Director of Partnership Relations for the Alliance of Baptists, during the 11 a.m. service on Sunday, February 15. Dempsey has degrees from Meredith College and Southeaster Baptist Theological Seminary. She has served as a local church pastor, a director of Christian social ministries, a college chaplain, a hospice chaplain, coordinator of a spirituality center, and studied with Contemplative Outreach and The Shalem Institute. 25. Be on the lookout for more information on “Remembering the Shout” featuring the McIntosh County Shouters, on February 28, 6:00 p.m. at Hillside, 2450 Cascade Road, SW, Atlanta 30311. Central United Methodist Church and Hillside International Truth Center are bringing this treat to Atlanta. For more information, call 404-758-6811 or email [email protected] or visit www.HillsideInternational.org. 26. More of us are living longer than ever before. This creates unique challenges and opportunities for congregations around issues of transportation, affordable housing, services, support for caregivers. Come to an Atlanta Regional Commission event, Live Beyond Expectations, to share your ideas and learn from others, Thursday, March 5, 9 a.m.- 3.p.m. The Loudermilk Center for the Regional Community, 40 Courtland Street NE, Atlanta 30303 Register. 27. The Roswell United Methodist Church Preschool and Kindergarten semi-annual children’s consignment sale is Friday, March 6, 9 a.m. - 2 p.m., and Saturday, March 7, 8 a.m. - noon. There will be three overflowing rooms with more than 200 consignors and great prices on gently worn spring and summer children's clothing and accessories (newborn - size 14), as well as maternity clothing, baby equipment, nursery décor, play sets, books, videos, DVDs, toys, and much more. The sale is now accepting all major credit cards with a $3 processing fee. All consignors must pre-register, even those who have consigned before. Click on www.rumc.com/rumck to register to consign or volunteer. 28. Candler continues the yearlong celebration of its 100th birthday with “Prophetic Voices: Confronting Theological Challenges of the Next Century,” an academic conference, March 18-20. “Prophetic Voices” brings together a dozen renowned theologians from Candler and beyond, discussing theological imagination and the issue of secularization, the image of God in contemporary society, creation and care of the earth, and the kingdom of God and global pluralism. Featuring Candler’s Luke Timothy Johnson, Pulitzer Prize-winning author Marilynne Robinson (GileadLila), Cambridge University’s Janet Soskice, and Duke University’s Norman Wirzba, among others. The event is open to the public, but advance registration is required here. 29. Opening New Worlds: A conference for individuals with developmental disabilities, their families and congregations, March 21, 9:30 a m -4:30p.m., First Baptist Decatur, 308 Clairemont Avenue, Decatur, 30030. $20.00 Registration includes workshops and lunch; Registration deadline is March 11, 2015. Register here. This conference offers something for everyone: Individuals, Families and Congregations! For more information visit www.ddmga.org or www.wesleyglenministries.com Co-Sponsored by Developmental Disabilities Ministries, Inc. and Wesley Glen Ministries 30. Newnan First United Methodist Church will host the 3rd Annual I WILL INTERVENE CHALLENGE on March 23. This one day workshop is open to individuals from all walks of life and offers CE credit for mental health professionals. Thanks to the sponsor NFUMC registration has been greatly reduced. Suicide takes more lives each year than automobile accidents and is the third leading cause of death among teens. You can make a difference. Learn the skills that can save lives. In 2014 more than 1200 individuals accepted the challenge. Learn more or register today at www.iwillintervene.com. 31. Georgia Supportive Housing Association has sent a budget update. Find it here. 32. Peacebuilders Camp at Koinonia Farm is a unique overnight summer camp in rural south Georgia where youth ages 11 to 14 spend a week together learning how to work toward peace and justice. Campers enjoy farm life, play games and sports, go on field trips, learn about human rights, make new friends, and explore the stories of peacemakers past and present. Peacebuilders Camp registration has just opened for 2015! It is open to all middle schoolers! Session One (July 13-18) is for 11- and 12-year-olds. Session Two (July 20-25) is for 13- and 14-year-olds. Peacebuilders Camp operates on a sliding scale and strives to raise money to ensure that all campers can participate, no matter their family's financial situation. Click here to register! 33. The Center for Lifelong Learning is accepting applications for the 2015 Guthrie Scholars Cohort. This is an opportunity to engage in five days of independent study among a small group of clergy, educators, and church leaders on the campus of Columbia Theological Seminary in Decatur. Those selected are invited to pursue a topic of their choice that engages a pressing issue of the church from a Reformed perspective. Scholars are provided with a guest room and meals in the campus dining facilities, and will have access to the seminary library, chapel services, and fitness room. The dates are September 21-25. Applications must be make at the link below. They will be reviewed as they are received and the application process will close when the available spaces are filled. For additional information and the link to the application form, see the Guthrie Scholar Brochure or contactSarah Erickson (404)687-4526. 34. Do you know about Family Promise of Cobb County,a non-profit that uses a network of 13 interfaith congregations (churches, temples, mosques) to house homeless children and their families? Each congregation pledges to host up to 4 families (14 people) for one week, 4 times each year. The hosting congregation provides dinner at the house of worship and food for lunches and breakfasts. They also provide space for families to sleep on network-provided beds. Families move from one hosting congregation to the next on Sunday afternoons. This helps families, who find themselves temporarily homeless, to stay together and receive help and support within their own communities. Find out morewww.familypromise.org As is true of many affluent areas there is very little affordable housing available in Cobb County once the families have secured jobs (or higher-paying jobs) and saved for a security deposit. Family Promise is interested in finding out if anyone knows of affordable rental units or of a building/house/old church parsonage that could be rehabilitated by Family Promise volunteers and used as transitional housing for a family until they can find permanent affordable housing. Please contact Julie Binney, Family Promise of Cobb County, [email protected]. Peace, Ethel Ware Carter The Regional Council of Churches of Atlanta, Inc. [email protected] 404-201-6448 Views: 50 Comment You need to be a member of Regional Council of Churches of Atlanta to add comments! Join Regional Council of Churches of Atlanta Come sing with the combined choirs for the 15th Annual Ecumenical Thanksgiving Celebration, Thursday, Nov. 21, 7 p.m., Temple Kol Emeth, 1415 Old Canton Road, Marietta 30062. This dynamic evening is filled with humor, music, and inspiration— celebrating both unity and diversity. Any singer may join! No preparation necessary! All skill sets welcome! Just show up for three fun rehearsals. Details are here. #QuietingTheSilence: An Interfaith Mental Health Conversation. People of all faiths struggle with mental health and substance abuse issues. Join The Blue Dove Foundation for an interfaith conversation from different religious perspectives. Thursday, Oct. 17, 6:30 – 8:45 p.m. R.s.v.p. to thebluedovefoundation.org/interfaithevent.There is no charge for admission. Location will be shared upon R.s.v.p. Suitable for ages 18+ Harvest of Hope Intergenerational Apple Harvest of Hope ecumenical study, worship, and mission retreat program of the Society of St. Andrew.Find out more here. email [email protected] 2715 Peachtree Road NE Atlanta, GA 30305 Our Work Our History Officers & Staff Our Mission Directions & Map to Our Offices Find It Here Community Calendar -- Events of interest to the greater faith community. Membership -- Links to all RCCA member churches in Atlanta. Volunteer Opportunities -- Dozens of possibilities to be of service. Local Denominational Judicatories -- Websites and contact information. © 2019 Created by RCCAtl. Powered by Badges \| Report an Issue \| Terms of Service	# Berkey Water Purification Systems Clean water is one of the foundations of good health. Whether you rely on well water or municipal tap water, you and your family are continually subject to delays and fluctuations in water quality, standards and testing. Emerging toxins—PFAS (per- and polyfluoroalkyl substances), manufacturing chemicals, pesticides and pharmaceuticals—have been found in drinking water and can adversely affect health. Many of these contaminants are carcinogens, endocrine disruptors or neurotoxins. The Berkey® Water Purification Systems are attractive tabletop, gravity-fed systems that remove: - >99.999% of viruses and pathogenic bacteria - Protozoa, trihalomethanes, inorganic minerals, heavy metals - Pharmaceuticals, pesticides, VOCs, petroleum products, PFAS - Rust, silt, sediment and radiologicals Unlike reverse‐osmosis filters, they retain beneficial ionic minerals (magnesium, calcium) and raise water pH. They’re powerful enough to purify pond, lake or stream water—ideal for emergencies or camping—and cost as little as 2¢ per gallon. ## What Are Berkey® Water Purification Systems? - Gravity-fed design: No electricity required - Black Berkey® Elements: Micro-pores too small for viruses or bacteria - High capacity: Systems range from ~2.25 gal to larger units, expandable filtration - Durable construction: AISI 304 stainless steel chambers (assembled in USA) ## Key Benefits - Removes or greatly reduces a broad spectrum of contaminants, often below detectable levels - Retains health-supporting minerals - Easy to use and maintain - Excellent taste encourages hydration --- # The Benefits of Grass-Fed and Pasture-Raised Broth and Meat ## Why Bone Broth Is So Good for You Bone broth is rich in minerals, collagen and amino acids. Daily consumption can: 1. Repair your gut 2. Boost your immune system 3. Improve energy 4. Nourish brain and nervous system 5. Support bones, joints and connective tissue 6. Strengthen teeth and hair 7. Support fertility For best results, sip a hot cup of homemade bone broth or add it to soups and stews. ## What Makes 100% Grass-Fed, Pasture-Raised Meat Better 1. Lower in fat; higher in antioxidants, nutrients, omega-3s and CLA 2. Grass-fed methods help trap carbon in pasture soil 3. Livestock live outdoors, healthier and less stressed 4. Supports local farmers and communities Choosing sustainably raised meat nourishes your body, supports local economies and benefits the environment. --- # 3 Tips for Overcoming Anxiety Naturally If anxiety leaves you drained, on edge or dependent on meds, here are three all-natural steps to help you reclaim peace of mind: ## 1. Use the Power of Your Exhale - Spend 5–10 minutes each morning noticing your natural breath - Focus on each exhale and the space before the next inhale - When the mind wanders, gently return your attention to the exhale - Observe sensations—sounds, smells, bodily feelings—without judgment ## 2. Nourish Your Nervous System - Eat a variety of warm, cooked foods: red meat, homemade broth, fish, cooked grains, beets, winter squash, leafy greens, nuts/seeds and beans - Drink calming teas: chamomile, oat straw - Avoid caffeine and added sugar (they deplete nutrients and provoke stress) - Support rest: get enough sleep, take warm baths, walk in nature ## 3. Try Acupuncture - Down-shifts “fight-or-flight” into “rest-and-digest” - Scientifically shown to reduce anxiety and outperform some pharmaceuticals - Holistic approach: treats mind and body together - Many experience deep relaxation during treatment and improved sleep --- # 7 Signs You Need Acupuncture This Spring In Chinese Medicine, spring is governed by the Liver system (not just the anatomical liver). Stress commonly leads to Liver Qi stagnation. If you notice any of these signs, acupuncture may help: 1. Anger, irritability, anxiety or depression 2. Trouble sleeping, especially waking at 1 AM–3 AM 3. Migraines or headaches linked to tension or heat 4. Digestive issues: IBS, reflux, bloating, constipation or diarrhea 5. Hormonal imbalances: PMS, cramps, irregular or painful cycles 6. Muscle spasms or tightness in tendons, ligaments or fascia 7. Eye problems, tremors or dizziness from weak Liver Blood or Liver Wind At-home support: - Steam or sauté dark/bitter greens, beets, spring vegetables - Red meat or fish for blood nourishment (in moderation) - Teas: chamomile, oat straw, chrysanthemum, mint, rose buds, nettle --- # Bodyscan Relaxation Meditation Chronic stress disrupts hormones, digestion and immunity. Regular acupuncture plus daily meditation can reverse the “fight-or-flight” response. This Bodyscan Relaxation Meditation (≈40 min) combines Qigong and mindfulness: - Guides you from head to toe, deepening mind-body awareness - Helps you scan and relax each part of your body - Teaches you to release tension and cultivate inner calm Use it at your desk, before sleep, or whenever tension builds. A consistent practice will strengthen your body’s innate healing response. --- # Church Action eNewsletter Week of January 26, 2015 1. The Big Read 2015 Lecture Tonight, Wednesday, Jan. 28, 7:00 p.m., Decatur Library Auditorium, featuring the award-winning playwright, Sarah Gubbins (who will join the discussion via closed‐circuit television) and members of the cast and crew of her new play. The discussion for the evening will center on the lasting influence of Carson McCullers’ work and literary legacy. 7 Stages will premiere Sarah Gubbins’ play, _How Carson McCullers Saved My Life_, this February. Inspired by Georgia native McCullers’ _The Heart Is a Lonely Hunter_. 2. Armed Forces Mission Suicide Prevention Workshops Workshops in faith communities for people from all walks of life teaching skills that can make the difference for those at risk. These workshops build community within your congregation and bridges of hope for your greater community. Visit [iwillintervene.org](http://www.iwillintervene.org) and consider hosting an _I Will Intervene_ workshop in your house of worship. 3. MedShare Distribution Center Visits Church organizations/medical mission teams are welcome to visit MedShare’s Distribution Center in Decatur for supplies for medical mission trips abroad. MedShare is dedicated to the efficient recovery and redistribution of surplus medical supplies and equipment to those most in need. - Walk-in appointments: $75 donation for up to the first 50 lbs and $2.00 each additional pound. - Online orders: $3 donation per pound, plus shipping. Contact Kim Lawson, (404) 537-5086 or [email protected], or go to [medshare.org](http://www.medshare.org). 4. Black or White (Film Opening Jan. 30) The story of a grandfather (Kevin Costner) who is suddenly left to care for his beloved granddaughter. When the little girl’s paternal grandmother (Octavia Spencer) seeks custody, a legal battle ensues that forces the families to confront their true feelings on race, forgiveness, and understanding. Based on real events. Allied Faith and Family has prepared a faith-based family discussion guide: [Download guide](#). Trailer: [Watch here](#). 5. Day1 with Rev. Canon C. K. Robertson, Ph.D. Featured preacher on Day1 this Sunday. Visit [Day1.org](http://Day1.org) to find your local broadcaster, listen, read the transcript, or explore blogs and other resources. 6. Health & Wellness Event at Greenbriar Mall Empowerment Resource Center joins Streetz 94.5 for free HIV testing services, nutrition and weight‐loss help, screenings, physical fitness, prevention strategies, emotional health help, child/teen/family health. Date: Jan. 31, Noon–5 p.m. at Greenbriar Mall. 7. One Billion Rising Art Workshop Make peace posters to be taken to the National Mall and displayed the weekend of July 4. Posters based on the Universal Declaration of Human Rights. Jan. 31–Feb. 1 at East Lake Commons. Contact Diane at 678-918-1945 or visit [Onebillionrisingatlanta.net](http://Onebillionrisingatlanta.net). 8. Atlanta Catholic Business Conference Annual conference connecting faith and work. Date: Feb. 7, 9:00 a.m.–3:30 p.m., St. Peter Chanel Catholic Church. Theme: “Living in the Trenches of Faith at Work.” [Register here](#). 9. Recycling at Second Ponce de Leon Baptist Church Feb. 7, 10 a.m.–3 p.m. Accepting electronics, metals, latex paints. Visit [keepatlantabeautiful.org](http://www.keepatlantabeautiful.org) for more. 10. Church Women United Black History Month Celebration Friday, Feb. 5, 9:45 a.m., Peachtree Christian Church, 1580 Peachtree St. NE, Atlanta 30309. Panel discussion on race relationships and the state of the family in America, based on the film _Black or White_. Contact Mrs. C. Rainey, Vice President, (770) 964-2912 or [email protected]. 11. Georgia WAND: The Real State of the Union Feb. 5, 6:30 p.m. reception; 7:00 p.m. event, Ben Hill UMC, 2099 Fairburn Rd. SW, Atlanta 30331. With Janice Mathis, Jay Bookman, Aurielle Marie Lucier, and Brittany Curry. RSVP to [email protected] with “RSVP REAL State” in the subject. 12. First Friday at First Friday, Feb. 6, 6:00 p.m., First Church Commons, First Congregational Church of Atlanta, 105 Courtland St. NE. Guest artists: jazz pianist Geri Allen and Dwight Andrews. Tickets $10 at the door. 13. “Old Style Fish Fry” Benefit Mount Zion AME Church, 2977 LaVista Rd, Decatur 30033. Saturday, Feb. 7, 10:30 a.m.–3 p.m. $10 for three pieces of fried fish, two sides, and bread. Drinks and baked goods $1 each. Pre-order by Feb. 1: (404) 633-2288. Visit [mtzionamec.org](http://www.mtzionamec.org). 14. Ladies Afternoon Tea Saturday, Feb. 7, 2:00–4:00 p.m., Church of the Annunciation, Marietta. Includes entertainment and gift shop. Tickets $15. [Details here](#). 15. World Interfaith Harmony Week Celebration Sunday, Feb. 8, 3:00–5:30 p.m., Temple Sinai, 5645 Dupree Dr, Sandy Springs 30327. Music, food, international marketplace. Suggested donation $20. [Register here](#). 16. Maria Valdes in Concert Monday, Feb. 9, 7:30 p.m., All Saints’ Episcopal Church, Atlanta. Tickets $15; $10 students/seniors. [Purchase tickets](#). 17. GALEO Institute for Leadership, Class of 2015 Applications open to all persons 18 and older. Deadline: Wednesday, Feb. 11 at midnight. [Apply here](#). Limited scholarships available. Contact [email protected]. 18. DMST Lobby Day Thursday, Feb. 12, 8:00 a.m., The Historic Freight Depot, 65 Martin Luther King, Jr. Dr. SE, Atlanta 30303. Join Georgia Cares, Street Grace, Wellspring Living, youthSpark. Register [here](#). 19. Diversity in Disaster for Metro Atlanta Communities Feb. 12, 8:30 a.m.–1:00 p.m., The Temple, 1589 Peachtree St. NE, Atlanta. Free event; lunch by Maggiano’s. Register at [thefirst72.org](http://www.thefirst72.org). 20. Amy-Jill Levine Lecture Series Feb. 13–15 in Gainesville at Brenau University. Discussing _Short Stories by Jesus: The Enigmatic Parables of a Controversial Rabbi_. Co-sponsored by Gainesville’s First Baptist and Grace Episcopal Churches. [More info & register](#). 21. Natural Spirituality Regional Gathering Feb. 13–15 in Toccoa. Explore dreams, synchronicity, and “the downward path of our walk with God.” Visit [naturalspiritualityregionalgathering.com](http://naturalspiritualityregionalgathering.com). 22. Renewal of Vows Valentine’s Day, Feb. 14, 11:00 a.m., St. Paul’s Episcopal Church, 306 Peyton Rd, Atlanta 30311. Light lunch to follow. Children welcome. RSVP to [email protected] by Feb 10. 23. “Silent Sky” by Lauren Gunderson Opening Feb. 14 at Theatrical Outfit. A play about astronomer Henrietta Swan Leavitt (1868–1921). Call Box Office: (678) 528-1500. 24. Martha Stearns Marshall Month of Preaching Feb. 2015 at Northside Drive Baptist Church. Paula Clayton Dempsey preaches at the 11 a.m. service on Sunday, Feb. 15. Dempsey is Director of Partnership Relations for the Alliance of Baptists. 25. “Remembering the Shout” February 28, 6:00 p.m. at Hillside, 2450 Cascade Rd. SW, Atlanta 30311. Featuring the McIntosh County Shouters. Central United Methodist Church and Hillside International Truth Center present. For more information, call 404-758-6811 or email [email protected]. Visit [HillsideInternational.org](http://www.HillsideInternational.org). 26. Live Beyond Expectations Thursday, March 5, 9:00 a.m.–3:00 p.m., Loudermilk Center for the Regional Community, 40 Courtland St. NE, Atlanta 30303. An Atlanta Regional Commission event on aging, transportation, housing, caregiver support. [Register here](#). 27. Roswell UMC Preschool & Kindergarten Consignment Sale Friday, March 6, 9:00 a.m.–2:00 p.m. and Saturday, March 7, 8:00 a.m.–noon at Roswell UMC. Children’s clothing (newborn–size 14), maternity, toys, and more. Credit cards accepted ($3 processing fee). Consignors must pre-register: [rumc.com/rumck](http://www.rumc.com/rumck). 28. Prophetic Voices Conference March 18–20 at Columbia Theological Seminary in Decatur. A centennial academic conference on theological imagination, secularization, creation care, and global pluralism. Advance registration required: [Register here](#). 29. Opening New Worlds Conference March 21, 9:30 a.m.–4:30 p.m., First Baptist Decatur, 308 Clairemont Ave, Decatur 30030. For individuals with developmental disabilities, their families, and congregations. $20 (includes workshops and lunch). Registration deadline: March 11. [Register here](#). Co-sponsored by Developmental Disabilities Ministries, Inc. and Wesley Glen Ministries. 30. I WILL INTERVENE CHALLENGE March 23 at Newnan First United Methodist Church. One-day suicide-prevention workshop open to all; CE credit for mental health professionals. Thanks to sponsorship, registration is greatly reduced. Learn more/register at [iwillintervene.com](http://www.iwillintervene.com). 31. Georgia Supportive Housing Association Budget Update Find the update [here](#). 32. Peacebuilders Camp at Koinonia Farm Summer camp for youth ages 11–14 in rural south Georgia. Session One (July 13–18) for 11–12 year-olds; Session Two (July 20–25) for 13–14 year-olds. Sliding scale fees. [Register here](#). 33. Candler 2015 Guthrie Scholars Cohort September 21–25 at Columbia Theological Seminary, Decatur. Five days of independent study on a Reformed perspective topic. Guest room, meals, and library access provided. Apply as spaces fill. See the Guthrie Scholar Brochure or contact Sarah Erickson at (404) 687-4526. 34. Family Promise of Cobb County A network of 13 interfaith congregations houses homeless families temporarily. Each congregation hosts up to four families for one week, four times per year. Families receive meals and beds, moving from host to host on Sundays. Learn more: [familypromise.org](http://www.familypromise.org). Contact Julie Binney at [email protected] for information on affordable housing or transitional housing projects.	11,283	3,782	-1,373,409,429,458,515,200	concat	[ "concat_full" ]	0.75	true	null
-6,150,434,136,482,446,000	13 days in Japan Itinerary 13 days in Japan Itinerary Created using Inspirock Japan travel route planner This plan was created by another user. Make it your plan Route & dates 13 days in Japan Itinerary Start: Urayasu 1 Urayasu — 3 nights subway: 30min 2 Tokyo — 3 nights Drive: 3h 3 Hakone-machi — 1 night Drive: 4h 4 Kyoto — 5 nights train: 30min End: Osaka 3 nights Urayasu Urayasu © A city lying on Tokyo Bay, Urayasu used to stand separate from the giant metropolis next door, but now, even though it belongs to another prefecture, it seems part of the capital. Tokyo Disneyland has been added to your itinerary. Get ready for a full day of sightseeing on the 26th (Tue): discover the magic at Tokyo Disneyland. To find other places to visit, reviews, and tourist information, go to the Urayasu tour planner. If you are flying in from Malaysia, the closest major airports are Tokyo Haneda International Airport, Narita International Airport and Hyakuri Airport. November in Urayasu sees daily highs of 19°C and lows of 14°C at night. On the 28th (Thu), you'll travel to Tokyo. Things to do in Urayasu Theme Parks Highlights from your plan Tokyo Disneyland © Tokyo Disneyland Tokyo DisneySea © Tokyo DisneySea 3 nights Tokyo Tokyo © Tokyo holds the status of most populous metropolitan area in the world--a fact you'll find tangible as you walk the bustling streets and explore its diverse neighborhoods and cultures. Your day-by-day itinerary now includes Akihabara as well as Takeshita Street. Bring the kids along to Tokyo Metropolitan Government Buildings and Shinjuku Gyoen National Garden. The adventure continues: don't miss a visit to Meiji Jingu Shrine, pause for some photo ops at Hachiko, get your game on at Owl cafe Akiba Fukurou, and admire the landmark architecture of Tokyo Skytree. To find where to stay, ratings, maps, and other tourist information, you can read our Tokyo itinerary planner . Tokyo is just a stone's throw from Urayasu. Traveling from Urayasu in November, expect a bit cooler with lows of 11°C in Tokyo. On the 1st (Sun), you'll have the morning to explore before heading off to Hakone-machi. Things to do in Tokyo Neighborhoods Shopping Parks Highlights from your plan Owl cafe Akiba Fukurou © Owl cafe Akiba Fukurou Shinjuku Gyoen National Garden © Shinjuku Gyoen National Garden Tokyo Metropolitan Government Buildings © 1 night Hakone-machi Hakone-machi © Sitting at the foot of Mount Fuji, Hakone-machi has become a popular retreat from Tokyo for locals and tourists alike. Your day-by-day itinerary now includes Owaku-dani Valley as well as Mt. Fuji 5th Station. On the 1st (Sun), don't miss a visit to Mt. Fuji 5th Station, head outdoors with Kojiri Pass, and then make a trip to Owaku-dani Valley. On the 2nd (Mon), you'll have a packed day of sightseeing: observe the fascinating underwater world at Hakoneen Aquarium, trek along Hakone Stone‐paved Road, contemplate the long history of Hakone Shrine / Kuzuryu Shrine Singu, then contemplate the waterfront views at Lake Ashi (Ashinoko), and finally get engrossed in the history at Hakone Sekisho and Hakone Sekisho Museum. To see ratings, maps, photos, and tourist information, read Hakone-machi online tour itinerary maker . You can do a combination of train and bus from Tokyo to Hakone-machi in 1.5 hours. Other options are to drive; or take a bus. While traveling from Tokyo, expect a bit cooler days and about the same nights in Hakone-machi, ranging from highs of 8°C to lows of 5°C. Wrap up your sightseeing on the 2nd (Mon) to allow time to travel to Kyoto. Things to do in Hakone-machi Parks Historic Sites Museums Side Trip Mt. Fuji 5th Station Highlights from your plan Hakone Stone‐paved Road © Hakone Stone‐paved Road Lake Ashi (Ashinoko) © Lake Ashi (Ashinoko) Sengokuhara © Sengokuhara 5 nights Kyoto Kyoto © The national capital for over a thousand years, Kyoto retains much of the charm of old Japan, boasting numerous temples and shrines that seem completely untouched by the modern world. Your day-by-day itinerary now includes Nara Park, Todai-ji Temple and Dotonbori. Change things up with a short trip to Osaka Castle in Osaka (about 1h 10 min away). The adventure continues: take in the spiritual surroundings of Fushimi Inari-taisha Shrine, take in the pleasant sights at Arashiyama, step into the grandiose world of Nijo Castle, and steep yourself in history at Sanjusangendo Temple. To find maps, more things to do, reviews, and other tourist information, refer to the Kyoto attractions planning website . You can take a train from Hakone-machi to Kyoto in 4 hours. Other options are to drive; or do a combination of flight and train. While traveling from Hakone-machi, expect a bit warmer days and about the same nights in Kyoto, ranging from highs of 13°C to lows of 4°C. Finish your sightseeing early on the 7th (Sat) so you can take a train back home. Things to do in Kyoto Historic Sites Parks Shopping Side Trips Nara, Osaka Highlights from your plan Fushimi Inari-taisha Shrine © Fushimi Inari-taisha Shrine Nara Park © Nara Park Fuuka-Kimono © Fuuka-Kimono Similar Plans 16 days in Japan BY A USER FROM FRANCE November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, slow & easy, popular & hidden gems PREFERENCES: November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Slow & easy 14 days in Saitama, Hasuda & Tokyo BY A USER FROM UNITED KINGDOM November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, popular & hidden gems PREFERENCES: November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Medium 15 days in Japan BY A USER FROM AUSTRALIA November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, popular & hidden gems PREFERENCES: November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Medium 15 days in Japan BY A USER FROM UNITED STATES November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, popular & hidden gems PREFERENCES: November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Medium 16 days in Japan BY A USER FROM SINGAPORE December, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, hidden gems PREFERENCES: December, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Hidden gems PACE: Medium 14 days in Japan BY A USER FROM NEW ZEALAND May, kids, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, slow & easy, popular sights PREFERENCES: May, kids, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular sights PACE: Slow & easy 15 days in Tokyo BY A USER FROM THAILAND December, culture, relaxing, romantic, historic sites, shopping, slow & easy, hidden gems PREFERENCES: December, culture, relaxing, romantic, historic sites, shopping ATTRACTION STYLE: Hidden gems PACE: Slow & easy 11 days in Tokyo, Kyoto & Osaka BY A USER FROM UNITED STATES November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, popular & hidden gems PREFERENCES: November, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Medium 15 days in Japan BY A USER FROM UNITED KINGDOM September, culture, outdoors, relaxing, beaches, historic sites, museums, shopping, wildlife, popular & hidden gems PREFERENCES: September, culture, outdoors, relaxing, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Medium 16 days in Japan BY A USER FROM AUSTRALIA May, culture, outdoors, relaxing, romantic, historic sites, museums, wildlife, popular & hidden gems PREFERENCES: May, culture, outdoors, relaxing, romantic, historic sites, museums, wildlife ATTRACTION STYLE: Popular & hidden gems PACE: Medium 17 days in Japan BY A USER FROM GREECE October, culture, outdoors, relaxing, romantic, beaches, historic sites, shopping, wildlife, popular sights PREFERENCES: October, culture, outdoors, relaxing, romantic, beaches, historic sites, shopping, wildlife ATTRACTION STYLE: Popular sights PACE: Medium 16 days in Japan BY A USER FROM AUSTRALIA May, culture, outdoors, relaxing, romantic, historic sites, museums, wildlife, hidden gems PREFERENCES: May, culture, outdoors, relaxing, romantic, historic sites, museums, wildlife ATTRACTION STYLE: Hidden gems PACE: Medium View more plans Free Shipping and Returns open adclose ad up to 20% offShipping and Delivery Information You searched for Shoes Ballet ShoesREMOVE Ballet ShoesREMOVE Leather Ballet ShoesREMOVE Ballet PinkREMOVE Refine your search Age Group Adult Children Toddler Search by BrandBloch (10) Capezio (10) Sansha (1) So Danca (2) Theatricals (9) 1 Child Love Ballet Leather Ballet Slipper $19.50 Capezio Girls "Lily" Leather Full Sole Ballet Shoes Item: 212C $19.50 Capezio Womens "Lily" Leather Full Sole Ballet Slipper Item: 212W $20.99 was $23.00 Capezio Child "Love Ballet" Leather Ballet Slipper Item: 2035C Daisy Child Full Sole Leather Ballet Slipper Daisy Adult Full Sole Leather Ballet Slipper $17.99 was $19.00 Capezio "Daisy" Child Full Sole Leather Ballet Slipper Item: 205C $17.99 was $19.89 Capezio "Daisy" Adult Full Sole Leather Ballet Slipper Item: 205 1	# 13-Day Japan Itinerary Route & Travel Times - Urayasu → Tokyo: subway, 30 min - Tokyo → Hakone-machi: drive, 3 h - Hakone-machi → Kyoto: drive, 4 h - Kyoto → Osaka: train, 30 min --- ## Urayasu (3 nights) A city lying on Tokyo Bay, Urayasu used to stand separate from the giant metropolis next door, but now, even though it belongs to another prefecture, it seems part of the capital. ### Things to Do in Urayasu - Tokyo Disneyland - Tokyo DisneySea --- ## Tokyo (3 nights) Tokyo holds the status of most populous metropolitan area in the world—a fact you'll find tangible as you walk the bustling streets and explore its diverse neighborhoods and cultures. ### Highlights from Your Plan - Akihabara - Takeshita Street - Tokyo Metropolitan Government Buildings - Shinjuku Gyoen National Garden - Meiji Jingu Shrine - Hachiko - Owl cafe Akiba Fukurou - Tokyo Skytree --- ## Hakone-machi (1 night) Sitting at the foot of Mount Fuji, Hakone-machi has become a popular retreat from Tokyo for locals and tourists alike. ### Highlights from Your Plan - Owaku-dani Valley - Mt. Fuji 5th Station - Kojiri Pass - Hakoneen Aquarium - Hakone Stone‐paved Road - Hakone Shrine / Kuzuryu Shrine Singu - Lake Ashi (Ashinoko) - Hakone Sekisho and Hakone Sekisho Museum --- ## Kyoto (5 nights) The national capital for over a thousand years, Kyoto retains much of the charm of old Japan, boasting numerous temples and shrines that seem completely untouched by the modern world. ### Highlights from Your Plan - Fushimi Inari-taisha Shrine - Arashiyama - Nijo Castle - Sanjusangendo Temple ### Side Trips - Nara Park & Todai-ji Temple (Nara) - Dotonbori & Osaka Castle (Osaka) --- # Shipping and Delivery Information - Free Shipping and Returns - Up to 20% off --- ## Refine your search Age Group - Adult - Children - Toddler Brand - Bloch (10) - Capezio (10) - Sansha (1) - So Danca (2) - Theatricals (9) --- ## Products 1. Child Love Ballet Leather Ballet Slipper $19.50 2. Capezio Girls "Lily" Leather Full Sole Ballet Shoes Item: 212C $19.50 3. Capezio Womens "Lily" Leather Full Sole Ballet Slipper Item: 212W $20.99 (was $23.00) 4. Capezio Child "Love Ballet" Leather Ballet Slipper Item: 2035C 5. Daisy Child Full Sole Leather Ballet Slipper Daisy Adult Full Sole Leather Ballet Slipper $17.99 (was $19.00) 6. Capezio "Daisy" Child Full Sole Leather Ballet Slipper Item: 205C $17.99 (was $19.89) 7. Capezio "Daisy" Adult Full Sole Leather Ballet Slipper Item: 205	2,436	739	-6,150,434,136,482,446,000	concat	[ "concat_full" ]	0.75	true	null
-7,942,769,036,116,727,000	x Like our Facebook Page Early Times Newspaper Jammu, Leading Newspaper Jammu Breaking News : Let's go party tonight! Release of aides emboldens ousted PDP leader \| People defying threats to finish their pending businesses before winter sets in \| Fearing trouble: mainstream parties wind up legal cells \| BDC elections: Despite boycott call proxies of PDP, NC, Cong fighting each-others on many seats \| Farooq Abdullah's sister, daughter detained over Article 370 protests \| Hours after mobiles restored, SMS services blocked in Kashmir \| Apple with anti-India messages seized from Kathua \| LPG consumers of Kashmir at receiving end as gas subsidy denied to them due to snapping of internet \| Governor chairs Ist meeting of Jammu Cluster University Council \| Amid continued shelling, demand for bunkers gets louder \| Next Assembly polls turning point in J&K's history: Munish \| Will distribute my salary among needy' \| Quest for artificial limbs drains out maimed landmine victims \| Chief Secretary reviews developmental, security scenario \| Former JK CM Omar Abdullah Looks Like This Now! \| IGP Jammu reviews law & order, security arrangements \| Five day long youth festival 'Sangam 2019-20' concludes \| Innovation Day celebrated at JU \| GDC RS Pura inaugurates Guru Nanak Dev Ji birth' anniversary \| DPS Nagbani celebrates Blue Day \| Nothing changed for victimized KPs in last three decades: KPC \| Police-Public meet held \| SDPO Akhnoor, others donate blood \| GDC Udhampur organizes awareness programme on Sanitation \| RHS Bari Brahmana shines in Roller Skating Championship \| IECS Polytechnic conducts technical visits \| GCW Gandhi Ngr, MAM win bronze in Kho Kho \| Tiny Tots bring laurels to School \| 'Our Actions Are Our Future; Healthy Diets for A #Zero Hunger World' \| Views and counterviews of India-China war of 1962 \| Modi's Initiative of Ban on Single Use Plastic \| Pak troops resort to ceasefire violations despite US warning \| Woman killed as Pak heavily shells civilian areas along LoC in Poonch \| Militants hurled grenade in Pulwama, no casualties \| 15 detained in J&K over truck driver's killing \| Over 6,500 youth take part in recruitment drive \| Ensure honesty, integrity in appointment of Tribunal members: HC to GAD \| Govt constitutes Advisory Committee to formulate policies for selection of candidates to professional courses \| Div Com inspects sports stadium work, patient care at SDH \| Financial Commissioner discusses budget proposals with Administrative Secretaries \| Adhoc arrangements shall not continue for indefinite periods of time: HC \| Yuvtarang-2019 enters fourth day of Sanrachna segment \| Heart disease deaths rise in India by 34% in last 26 yrs: Dr H K Bali \| Parshuram's sixth incarnation reveals mythological soft reverence \| Archana Bhat selected for Newton Bhabha PhD Placement Programme \| YCET organizes guest lecture on computer security \| JMC organizes awareness on SWM \| Shiv Sena demands special package for industry \| Festivals connects people with their culture: Rajni Sethi \| One day farmers training camp organized \| Advisor Sharma for timely payments, quality check of works \| Pt Premnath Dogra deserves Bharat Ratna: Brig Gupta \| Mahila Congress protests statement of Haryana CM \| ACB registers DA case against Head Assistant PWD \| Stop purchasing medicines if not given to patients in hospitals: Citizens' Forum to Govt \| Security heightened in Kashmir after militant attacks \| Husband gets life imprisonment for killing wife \| NIT reopens in Srinagar after 2 months \| 2 killed, 6 injured in road accident \| TFWH demands removal of toll-plaza \| MJR-47 members appeal Governor to consider their demands \| Toll-plazas generates over Rs 30,000 Crore annually: NHAI \| Narcotic smuggler arrested \| Driver's killing, attack on orchard owner acts of frustration: Raman Suri \| Chairman of YRS donates Rs. 11,000 for marriage of poor girl \| BJP leaders hold meeting of party workers \| DDC Jammu reviews performance of banks at DLRC/DCC meeting \| ADGP Armed decorates mountaineer Ram Singh \| Police busts inter-state gang of thieves \| Police busts inter-state gang of thieves \| DDC visit Rajgarh, holds public grievances redressal camp \| Missing \| Eminent scientists deliver lectures on 2nd day in 5th J&K Agriculture Science Congress \| Punjabi wrestler Rishu wins Gole Panj Peer Dangal title \| Congess appoints DCC Jammu Rural Vice presidents \| Army conducts coaching classes for students of Doda \| PRF activists stage protest against Toll plaza \| PCC Chief demands abolish of Toll Plaza at Sarore \| DM Kishtwar imposes ban on bovine transportation, illegal extraction of stones \| Toll Plazas indicate anti-forces, anti India mindset: Director WDI \| BDC elections: DPEO Doda reviews preparedness \| JKPCC castigates toll-plaza \| DDC reviews progress on district CAPEX budget, CSSs \| Punjabi Lekhak Sabha releases Punjabi satire collection \| Pollution control Board organizes Awareness workshop on Sanitary waste management \| Special Yog-Shishak Nirman Shiver organized \| Hermann Gmeiner School organizes rally \| Ayurvedic Hospital organizes free medical camp \| Natrang to showcase 2 shows 'Gulab Gaatha \| DPS Jammu excels in CBSE TT tourney \| Two day conference of NZIEA held \| Kho-Kho tourney held at MVIS \| Block president of Congress resigns \| Teenage girl installs self-made bakery stall to contribute for 'Bharat Ke Veer' \| Back Issues news details India waited for 72 yrs for abrogation of Article 370 provisions in J-K: Singh 10/9/2019 11:45:41 PM Agencies New Delhi, Oct 9: Union Minister Jitendra Singh said on Wednesday that India waited for 72 years for the abrogation of Article 370 provisions in Jammu and Kashmir, and the Modi government''s decision is being celebrated by every Indian. Releasing a book on Article 370, written by 14-year-old Ayanna Kohli, Singh said the book is a vindication of the "gross mental agony and injustice suffered by the children" of her age group on account of the now abolished clause of the Constitution. "The Modi government''s decision to abrogate Article 370 had been awaited for the last 72 years. The decision has been celebrated by each and every Indian across the country, wherever I travelled in the last two months," he said. Complementing the young girl for her precocious feat, the Union Minister for PMO said the book is an illustrious documentation of how even a child, though not having been born or brought up in Jammu and Kashmir, has gone through a burdensome childhood because her father, an Army officer was constantly posted on duty to save the valley from the designs of Pakistan-sponsored terrorism. Singh, who hails from Jammu and Kashmir, said he has gone through the book, which can be also be described as a history based fiction written in the background of contemporary Kashmir scenario. The minister said he could visualise how much of churning and deep pain must have gone through the innocent mind of the young child, who then found an outlet in writing. Singh said the girl must have written through her unbiased conscience, introspecting on the genesis of the Kashmir terrorism, the hardships of Indian Army soldiers posted there and finally must have drawn the conclusion through her innocent mind about what could be the one basic remedy to get out of all this. He said Ayanna Kohli''s book -- In The Times of Article 370 -- must be read by every Indian, particularly aspiring and serving soldiers, journalists and the budding citizens of tomorrow''s India, which will be free from Article 370. The girl''s father, an Army officer, said he wanted the book to be released by the minister, not only because Singh is from Jammu and Kashmir, but more so because he is someone who has extensively worked and written on the subject of Article 370 for the last several years. The book also offers an account of the sacrifices made by Indian soldiers in the service of Kashmir and seeks to draw the inference that it was necessary to revoke Article 370 in order to bring lasting peace in Kashmir, a release said. Share This News with Your Friends on Social Network Comment on this Story Early Times Android App STOCK UPDATE BSE Sensex NSE Nifty CRICKET UPDATE Home About Us Top Stories Local News National News Sports News Opinion Editorial ET Cetra Advertise with Us ET E-paper J&K RELATED WEBSITES J&K Govt. Official website Jammu Kashmir Tourism JKTDC Mata Vaishnodevi Shrine Board Shri Amarnath Ji Shrine Board Shri Shiv Khori Shrine Board UTILITY Train Enquiry IRCTC Matavaishnodevi BSNL Jammu Kashmir Bank State Bank of India PUBLIC INTEREST Passport Department Income Tax Department JK CAMPA JK GAD IT Education Web Site Design Services EDUCATION Jammu University Jammu University Results JKBOSE Kashmir University IGNOU Jammu Center SMVDU Kmart Joe Boxer Plus Size Juniors' Plus V-Neck T-Shirt - New York, Size: 2XL, White Joe Boxer Plus Size Juniors' Plus V-Neck T-Shirt - New York, Size: 2XL, White $7.99 This juniors' plus V-neck T-shirt by Joe Boxer captures your fun sense of style. A New York-themed pattern of taxis, lipsticks, coffee and donuts decorates this top from the wide, feminine V-neck down to the straight hem. Crafted from incredibly soft jersey knit fabric, this short-sleeve tee gives you the comfort and breathability you love when you're keeping it casual. Size: 2X. Color: White. Age Group: Kids. Browse all deals at Kmart See more in Shirts * This offer may contain time-sensitive information and offers. Please check with Kmart to confirm actual price & availability. Top	# India waited 72 yrs for abrogation of Article 370 provisions in J-K: Singh 10/9/2019 11:45:41 PM \| Agencies New Delhi, Oct 9: Union Minister Jitendra Singh said on Wednesday that India waited for 72 years for the abrogation of Article 370 provisions in Jammu and Kashmir, and the Modi government’s decision is being celebrated by every Indian. Releasing a book on Article 370, written by 14-year-old Ayanna Kohli, Singh said the book is a vindication of the “gross mental agony and injustice suffered by the children” of her age group on account of the now abolished clause of the Constitution. > “The Modi government’s decision to abrogate Article 370 had been awaited for the last 72 years. The decision has been celebrated by each and every Indian across the country, wherever I travelled in the last two months,” he said. Complementing the young girl for her precocious feat, the Union Minister for PMO said the book is an illustrious documentation of how even a child, though not having been born or brought up in Jammu and Kashmir, has gone through a burdensome childhood because her father, an Army officer, was constantly posted on duty to save the valley from the designs of Pakistan-sponsored terrorism. Singh, who hails from Jammu and Kashmir, said he has gone through the book, which can also be described as a history-based fiction written in the background of the contemporary Kashmir scenario. The minister said he could visualise how much churning and deep pain must have gone through the innocent mind of the young child, who then found an outlet in writing. Singh said the girl must have written through her unbiased conscience, introspecting on the genesis of Kashmir terrorism, the hardships of Indian Army soldiers posted there, and finally must have drawn the conclusion through her innocent mind about what could be the one basic remedy to get out of all this. He said Ayanna Kohli’s book — _In The Times of Article 370_ — must be read by every Indian, particularly aspiring and serving soldiers, journalists and the budding citizens of tomorrow’s India, which will be free from Article 370. The girl’s father, an Army officer, said he wanted the book to be released by the minister, not only because Singh is from Jammu and Kashmir, but more so because he is someone who has extensively worked and written on the subject of Article 370 for the last several years. The book also offers an account of the sacrifices made by Indian soldiers in the service of Kashmir and seeks to draw the inference that it was necessary to revoke Article 370 in order to bring lasting peace in Kashmir, a release said. --- # Kmart Joe Boxer Plus Size Juniors' Plus V-Neck T-Shirt – New York - Size: 2XL - Color: White - Price: $7.99 - Age Group: Kids This juniors' plus V-neck T-shirt by Joe Boxer captures your fun sense of style. A New York–themed pattern of taxis, lipsticks, coffee and donuts decorates this top from the wide, feminine V-neck down to the straight hem. Crafted from incredibly soft jersey knit fabric, this short-sleeve tee gives you the comfort and breathability you love when you're keeping it casual.	2,102	686	-7,942,769,036,116,727,000	concat	[ "concat_full" ]	0.75	true	null
-8,593,517,832,109,491,000	برای هرچه بهتر و سریع لود شدن سایت مطبوعات فارس از مرورگر موزیلا فایرفاکس استفاده نمایید www.matboatfars.com سایت عکس - عکس مکث 24 - خبرگزاری عکس - عکسمکث24 - تصویر - عکسهای - عکسمکث - عکسهای روز - عکس مکث - فتو - عکسمکس - ایمج - پیکچر - photo - picture - عکسمکس24 - image - عکس در مطبوعات - مطبوعات در عکس - عکس و مطبوعات - مطبوعات و عکس - عکس مطبوعات - مطبوعات عکس - خبرگذاری عکس - عکس خبرگزاری - خبرگزاری مطبوعات فارس - خبرگذاری - خبر گزاری - خبر گذاری - عکس خبر - خبر عکس - روزنامه فارس - خبر فارس - عکس فارس - فارس عکس - شیراز عکس - عکس شیراز - خبرگذاری مطبوعات فارس - خبرگزاری مطبوعات فارس - فارس روزنامه - شیراز روزنامه - روزنامه شیراز - خبرگزاری عکس مطبوعات فارس - خبرگذاری عکس مطبوعات فارس - سایت مطبوعات شیراز - مطبوعات شیراز - شیراز مطبوعات - خبرگزاری مطبوعات شیراز - خبرگزاری فارس مطبوعات - خبرگذاری فارس مطبوعات - خبرگزاری سایت فارس - سایت خبری فارس - سایت خبری شیراز - سایت شیراز - شیراز سایت - اخبار فارس - فارس اخبار - اخبار شیراز - شیراز اخبار - خبر شیراز - عکس خبر - خبر عکس - خبرهای فارس - خبرهای شیراز - سایت فارس - خبر فارس - خبرفارس - فارسخبر - خبرشیراز - شیراز خبر - شیرازخبر - فارس خبر - شیرازعکس - توریسم و گردشگری - توریسم - توریست - گردشگری - هشدار - هشدار زیست محیطی - عکسهای گردشگری - site ax - site axmax - site axmax24 - saite axmax24 - saite ax - aksmaks24 - aksmaks - site matboatfars - saite matboatfars - matboatfars - Newspaper - khabar - news - farsnews - newsfars - matboatfarsnews - newsmatboatfars - fars news - news fars - matboatfars news - news matboatfars - photonews - newsphoto - photo news - news photo - عکس خبری - تصویر خبر - خبر تصویری - گزارش تصویری - عکسهای خبری - خبرهای تصویری - سایت خبری مطبوعات فارس - سایت عکس خبری مطبوعات فارس GOOGLE Mozilla Firefox- www.search.xco.ir-www.dl.agahipost.com www.matboatfars.coms search.jamasp.ir امروز شنبه 27 مهر 1398 برابر با : 19/10/2019 میلادی مصادف با : 1441/2/19 قمری (1397/1/14) پرداخت وام به تعدادی از فرهنگیان از اواخر این ماه معاون توسعه مدیریت و پشتیبانی وزیر آموزش‌ و پرورش از پرداخت وام به تعدادی از فرهنگیان از اواخر فروردین ماه امسال خبر داد. مطبوعات فارس/ علی الهیار ترکمن معاون توسعه مدیریت و پشتیبانی وزارت آموزش و پرورش در خصوص برنامه این وزارتخانه برای پرداخت وام به فرهنگیان، اظهار داشت: ما 2 تفاهم‌نامه با 2 بانک امضا کردیم. وی ادامه داد: یکی از تفاهم‌نامه ها با بانک ملی بود که مقرر شد از محل رسوب پول آموزش‌ و پرورش و اندوخته ای که بانک ملی می آورد، به فرهنگیان وام داده می شود. الهیار ترکمن اضافه کرد: ثبت نام ها در سامانه آموزش‌ و پرورش انجام شده است و از اواخر فروردین ماه، پرداخت وام بانک ملی با کارمزد 16 درصد آغاز می شود. وی با بیان اینکه تفاهم‌نامه دیگر با بانک رسالت است، افزود: بانک رسالت مدل پس انداز خوشه ای را دارد که این مدل به اضافه اعتباراتی در قالب وام با کارمزد 2 درصد برای فرهنگیان اجرا می شود. معاون توسعه مدیریت و پشتیبانی وزیر آموزش‌ و پرورش گفت: تفاهم‌نامه امضا شده است اما برای نحوه اجرایی شدن آن، باید با بانک مذاکره کنیم. هنوز نظری برای این خبر درج نشده است نام : ایمیل : متن نظر : کد روبرو را وارد کنید : اخبار مرتبط پرداخت مابه‌التفاوت افزایش «حقوق»‌ها و «وام» بازنشستگان از مرداد آشنايي كارشناسان دانشگاه پيام نور فارس با تغييرات جديد وام و ارزاق دانشجويي موافقت بانک مرکزی با وام جدید مسکن عوامل بیرونی سبب کاهش کیفیت شورای سوم شد اختصاص 3ميليارد ريال اعتبار جهت وام دانشجويي دانشجويان پيام نور فارس احتمال افزایش مبلغ وام مسکن شرایط اخذ وام دوباره خرید مسکن از سوی زوجین وام مسکن افزایش می‌یابد ثبت‌نام پرداخت «وام» بازنشستگان آغاز شد محدودیت ها در اعطای وام مسکن برداشته شد مزدوجین۹۲و۹۳تا آخر آذر وام ازدواج می‌گیرند احتمال افزایش وام ساخت مسکن تا 100 میلیون تومان یک زندانبان 5 زندانبان را کشت اقوام ایرانی میزبان هنرمندان صنایع دستی فارس می شوند اطلاعات بقاع متبرکه وامامزادگان ثبت خواهد شد عوامل موثر زیان آور محیط کار در آب منطقه ای فارس بررسی شد در راستای برنامه های عمرانی وفرهنگی وامور اجتماعی امسال 12 میلیارد تومان به ساخت فرهنگسراها اختصاص یافته است خانه های محلی جایگاهی برای رونق محله های محروم نمایش روبینسون و کروزو در سالن استاد هودی به روی صحنه رفت نشست هم اندیشی مسئولان ومربیان طرح ملی حفظ قرآن کریم برگزار شد هنرنمایی عاشیق های تبریز و خنیاگران بلوچ در شب موسیقایی شیراز "جشنواره موسیقی اقوام ایران" به ایستگاه آخررسید پرداخت 550 میلیارد ریال تسهیلات در راستای تحقق اقتصاد مقاومتی در فارس مسوولیت کارشناسان حقوقی در بنیاد مسکن توام با کار مضاعف است توقف کامل پرداخت وام ازدواج 5 میلیونی/فقط وام 3 میلیونی می‌دهیم آن تن چند گونه به خاک پشت پرده بازماندن زوج ها از دریافت تسهیلات ازدواج/ وامی که هزینه سفرهای استانی دولت دهم شد پرداخت وام ازدواج ازسرگرفته شد/ رفع مشکل پرداخت تسهیلات ازدواج جوانان شرط تأهل برای‌ تسهیلات ۸۰ میلیونی مسکن برداشته شد به جاي توزيع پول بايد به فكر ايجاد اشتغال برای جوانان باشيم فیلمسازی در استان فارس، نیاز به حمایت جدی برای بقا دارد آغاز به کار نخستین اندیشکده فرهنگی و مذهبی شیراز هنرمندان فارس در جشنواره بين المللي اقوام ايران زمين شركت كردند وام ۶۰ میلیونی خرید مسکن به بانک‌ها ابلاغ شد ‏وام ‎بازنشستگان 5 میلیونی شد جدول اقساط وام ۲۵ میلیونی برای ۲۱ مدل خودرو کارگران حداقل بگیر از وام‌های جدید محروم شدند برای دریافت وام خودرو به بانک‌ها نروید آخرین مهلت ثبت نام «وام ضروری» بازنشستگان اعلام شد ابهام در پرداخت وام 25 میلیونی خرید خودرو خطر در‌ کمین مچ‌ شماست! جزئیات وام ویژه دانشجویان مستعد کم بضاعت اعلام شد اقساط وام ۱۰۰ میلیونی مسکن بخشودگی جریمه دیرکرد وام‌های زیر 100 میلیون تومان پرداخت وام ازدواج سرعت گرفت نرخ سود وام 80 میلیونی مسکن به حداقل ممکن رسید جزئیات وام ۱۰تا50میلیونی خرید کالا وخدمات پرداخت وام به کارکنان بانک‌ها از منابع قرض‌الحسنه ممنوع شد برپایی دومین همایش پیوند ایرانی اسلامی اقوام کشور در شیراز افزایش بازپرداخت وام مسکن به ۱۵ سال در دستورکار قرار گرفت جزئیات قرارداد جدید بیمه تکمیلی بازنشستگان حذف وام خودرو، کالا و جعاله از بانک‌ها استعمال قلیان در مراکز عمومی ممنوع می شود محقق ایرانی راز استحکام بتن را کشف کرد وام ۴۵۰ میلیونی خرید مسکن به پرسنل نیروی انتظامی پرداخت می شود وام ۵۰ میلیونی کالا هم آمد پیشنهاد تلفیق وام ازدواج با کارت خرید کالا توقف وام ازدواج و سرگردانی زوج های جوان اجبار حضور ۲ ضامن برای وام ۱۰ میلیونی طرح های مسکن مهر در شهرهای زیر 25 هزار نفر جمعیت تا پایان سال به سرانجام می رسد مهلت بانک‌ها تمام شد اعطای وام 100 میلیون تومانی به دانشجویان کارآفرین تمام متقاضیان وام ازدواج تسهیلات ۱۰میلیونی می‌گیرند اجرايي شدن 2 طرح جديد از سوي بانك مسكن حذف تاریخ و تعداد ازدواج از شروط وام مسکن ۲ شرط پرداخت وام از محل اوراق حق تقدم برای زوجین حذف شد برکناری چند مدیر بانکی دیگر شرایط پرداخت حقوق، پاداش و وام به کارکنان بانک‌های دولتی نرخ سود وام ۱۸ درصد شد سودهای بانکی رسما ریخت دستگیری سربازان غایب تشدید می‌شود بانک‌هایی که وام ازدواج ۱۰ میلیونی می‎دهند وام دکتری فقط به دانشجویان روزانه تعلق می‌گیرد وام 70 میلیونی نوسازی بافت‌ فرسوده فوری// کشف عملیات انتحاری در تهران / دستگیری عوامل انتحاری احتمال افزایش مبلغ وام بازنشستگان دستور بانک مرکزی به پرداخت وام ازدواج ۲۰میلیونی وام مسکن روستایی افزایش یافت آغاز پرداخت وام 2 میلیون تومانی به بازنشستگان ثبت نام وام شهریه دانشجویان علمی کاربردی از اول تیرماه پرداخت وام 10 میلیونی ازدواج از ابتدای تابستان آغاز پرداخت وام خرید مسکن از فردا ميزان وام‌هاي دانشجويي افزايش يافت مرد ژله ای اعدام شد امکان پرداخت جریمه ریالی سربازی باوام بانکی وام ازدواج فورا 10 میلیون شد افزایش تسهیلات قرض‌الحسنه مددجویان از 15 به 20 میلیون تومان وام 10 میلیونی ازدواج قابل اجرا نیست جسد مجهول الهويه مرد 57 ساله را شناسايي كنيد طرح ویژه نعمت‌زاده برای پرداخت وام به بدهکاران بانکی امسال همه دانشجویان دکتری وام ویژه می گیرند زن كلاهبردار ميلياردي به آخر خط رسيد وام ازدواج 10 میلیون شد افزایش 100 میلیاردی وام دانشجویان دکتری در سال 95 وام ساخت مسکن ۱۵۰ میلیون تومان شد شرایط دریافت وام کم‌بهره از صندوق ذخیره فرهنگیان حذف یارانه 30 درصد مردم برای اشتغال‌زایی شیراز نوروز ۹۵ میزبان جشنواره اقوام ایرانی می‌شود شرط مالکیت «دانگی» در وام 160 میلیونی مبلغ وام ودیعه مسکن درتهران و ۶شهر بزرگ اعلام شد جزئیات وام‌های جدید مسکن/ نرخ سود کاهش یافت دریافت وام 40 میلیونی ازدواج دانشجویی اختصاص وام و زمین برای بازگشت به روستاها اعطای وام ازدواج 50 میلیون تومانی به دانشجویان برتر وام جعاله مسکن 20 میلیونی می شود چگونه زندگی‌ها را از طلاق واکسینه کنیم؟ چگونه زندگی‌ها را از طلاق واکسینه کنیم؟ کمک بلاعوض میلیونی برای خرید موتوربرقی ساخت اولین محافظ ضد میکروبی مسواک درجهان توزیع وام بافت‌های فرسوده بین 31 استان وام ۶۰ میلیونی مسکن ابلاغ شد وام ۱۰ میلیونی خرید کالا ناگهان ۶ میلیون تومان شد توسعه قرض‌ الحسنه در دستور کار بانک ملی مسکن اولی ها وام 80 میلیونی می گیرند عرضه کارت اعتباری 50 میلیونی در بانک ملی؛ به زودی ساخت باتری یون لیتیوم با الکترولیت آبی و ولتاژ بالا شناسایی عوامل داعش در استان سمنان وام 3 میلیونی برای بازنشستگان وام ۳ میلیون تومانی کم بهره به بازنشستگان اعطا می شود آغاز طرح توزیع خودرو لیزینگی برای فرهنگیان بازنشسته بیلبوردهایی برای وصول مطالبات دانشجویی از تروریست‌های دستگیر شده 100 کیلوگرم مواد منفجره به‌ دست آمده آغاز ثبت‌نام «وام ضروری» بازنشستگان کشوری از اول آبان هشدار سفارت ایران در آنکارا به مسافران شاغلان مشمول وام نمی‌شوند قیمت غذا برای دانشجویان کم‌بضاعت ارزان‌تر می‌شود اختصاص بودجه 20 میلیارد تومانی برای توسعه روستایی دستگیری عوامل اصلی تجمع «روز کوروش» در پاسارگاد شیراز پرونده عوامل گروه تکفیری دستگیرشده در جنوب فارس خارج از نوبت رسیدگی می شود اعطای وام 5 میلیارد تومانی بدون بهره به کارآفرینان مناطق محروم افزایش وام مسکن جوانان تا 110 میلیون ممنوعیت پرداخت وام با سود بالای 18 درصد ۱۵ مرکز ویژه خدمات دندانپزشکی فرهنگیان در کشور راه اندازی می شود تولید پلاستیک بسته‌بندی قابل تجزیه در طبیعت کلاهبرداری یک میلیارد و 300 میلیون تومانی از متقاضی وام قرعه‌کشی «وام ضروری» 3 میلیون تومانی بازنشستگان، فردا وام مسکن مهر ۴۰ میلیون تومان شد کیوسک دروغ‌سنج به کمک پلیس فرودگاه می‌آید تخلف ۳۹۷ مدیر نجومی‌بگیر محرز شد توقف وام دهی بانکها در آستانه شب عید پژواك سُرناي وحدت در شيراز ضریب هوشیاری آتش نشان شیرازی به 10 رسید شهروندان داوطلب سکونت در روستاها تسهیلات مسکن 5 درصد دریافت می کنند ششمین جشنواره ملی موسیقی اقوام ایرانی در شیراز آیین پایانی جشنواره ملی «سورنای وحدت» برگزار می شود آغاز پرداخت وام ۴۰میلیونی مسکن مهر به متقاضیان بانک مرکزی بخشش سود وام‌های خُرد را دور زد تصمیم ترامپ کنفرانس انجمن مطالعات جوامع فارسی‌ زبان را لغو کرد وام ۸۰ میلیونی ازدواج هم آمد آخرین فرصت دریافت تسهیلات400میلیون ریالی به متقاضیان مسکن مهر یک بانک هر شب از بانک مرکزی وام با ۳۴ درصد سود می گیرد اجرای طرح آرامش بهاری در امامزاده سیدحسین(ع) کازرون امهال سه ساله وام كشاورزان خسارت ديده در فارس وام خانه اولی‌ها ۲۰۰ میلیون تومان شد دولت به یک نفر وام ۳۰۰ میلیاردی صفر درصدی داده‌/ وام را در بانک گذاشته و ۱۵ میلیارد سود می‌گیرد وام مسکن نخبگان ۱۶۰ میلیون شد آثار صفدر دوام در بیست و یکمین نشست روزنامه نگار در زوم نقد شد وام تعمیر مسکن 2 برابر شد صندوق یکمی‌ها پشت درهای بسته بانک مسکن مهر 6 عامل داعش در فارس به زندان محکوم شدند مسکن روستایی وام 8 میلیونی می گیرد پرداخت وام از حساب یارانه بزودی در بانک‌های دولتی اجرای طرح ضربتی اعطای وام ازدواج ضمانت یارانه نقدی برای وام ازدواج تحقیقات مشترک دانشگاه های مانیتوبای کانادا و علوم پزشکی شیراز برای علت یابی سرطان شیراز میزبان چهلین دوره مسابقات سراسری قرآن کریم خواهد بود کاهش مجدد سود وام مسکن دستگاه تشخیص عوامل باکتریایی ایجاد عفونت راه‌اندازی شد وام 30میلیون تومانی برای مستمری بگیران تامین اجتماعی رشد قابل توجه افتتاح حساب صندوق یکم در فارس ابهام مهم وام خرید مسکن رفع شد اجراهای همگانی تئاتر فجر فارس تا ۱۸ شهریور ادامه دارد جرایم دیرکرد اقساط وام مسکن بخشوده می‌شود آغاز ثبت نام فراگير كارشناسي ارشد دانشگاه پيام نور فارس از روز يكشنبه 23 مهر ماه آغاز ثبت نام «وام ضروری» بازنشستگان از امروز اعطای وام به روستاییان با اخذ وثیقه آسان ترویج فرهنگ وقف نیاز به تبلیغ آگاهانه با کمک هنر و رسانه دارد ابلاغ اعتبار 166 میلیارد تومانی برای جبران خسارت ناشی از سیل در فارس وام دادن به استارتاپ‌ها خیانت به آنهاست مرحله اول و دوم وام ضروری بازنشستگان آذرماه پرداخت شد دوام سازه‌های بتنی بااستفاده ازپردازش تصویر احتمال افزایش وام ازدواج به ۱۵ میلیون تومان زمان اعلام نتايج آزمون كارشناسي ارشد فراگير در فارس پیشنهاد وام جدید مسکن برای زوج های جوان شرط بانک‌ها برای دادن وام ازدواج ۱۵میلیون تومانی جز دانشجویان مستضعف و مستعد، وام دانشجویی مابقی دانشجویان حذف خواهد شد پرداخت وام 80میلیونی بدون سپرده و اوراق چهارمين شعبه وامو در کشور افتتاح مي شود مرحله ششم وام ضروری پرداخت شد وام ویژه دکتری در سال جاری افزایش می‌یابد بافت های تاریخی شهرها باید حفظ شود سود وام صندق پس انداز مسکن کاهش یافت 98 میلیارد ریال به امورجوانان فارس اختصاص یافته است آغاز پرداخت وام مسکن به فرهنگیان افزایش سقف وام مسکن منتفی است محیط عامل بروز 90 درصد سرطان سینه است وام ۳۰۰ میلیونی برای روستائیان خبرهای خوش درباره پرداخت «وام» به بازنشستگان معاملات پیش فروش مسکن عملا قفل شد اختتامیه شعر اقوام در گراش برگزار می‌شود وام بدون سود به بیماران نیازمند اعطا می شود فعالیت ۶۰۰ تعاونی مسکن در استان فارس شناسایی دانش آموزی توسط مبلغان طرح بصیرت عاشورایی اقامه نماز ظهر عاشورا در 300 بقعه متبرکه استان فارس عاقبت عوامل تروریستی رژه اهواز آغاز پرداخت وام ضروری به بازنشستگان کشوری از هفتم مهر با عوامل تولید بنر مذموم شدیداً برخورد شود اهالی این روستا همگی پزشک هستند وام مسکن ارزان شد سود و جرائم وام مسکن روستایی بخشیده می شود گوهر بافت تاریخی شیراز قربانی بی مسئولیتی ششمین جشنواره عکاسی وقف کلید خورد بازداشت عوامل فیلم «کتک زدن دختر جوان» دولت تاکنون حدود 2 میلیارد دلار از روسیه وام گرفته است تصویب افزایش وام‌های دانشجویی در سال ۹۸ افزایش رقم وام ضروری بازنشستگان کشوری مدت بازپرداخت «وام ازدواج» ۶۰ ماهه شد جزئیات خبر خوش دولت برای ساکنان منطقه «سعدی» شیراز دلایل اصلی وقوع سیل در دروازه قرآن شیراز اعلام شد طرح های برتر مسابقه معماری قوام الدین در شیراز اجرایی می شود موافقت شورای پول و اعتبار با وام ۷ ساله سیل‌زدگان پرداخت تسهیلات به سیل زدگان بدون نیاز به کارمند، چک و سفته نیاز مبرم به تمام گروه های خونی در استان فارس وجود دارد شرایط پرداخت وام ۹ درصدی ساخت خانه اعلام شد مستاجران هم وام می‌گیرند مردم ۲۰ درصد بیشتر وام گرفتند اختصاص تسهیلات تا سقف 100 میلیون تومان به جوانان کارآفرین هزینه خرید وام مسکن افزایش یافت واریز ششمین مرحله «وام ضروری» به حساب بازنشستگان تا هفته اول مهر افزایش "وام ضروری" بازنشستگان کشوری به7 میلیون تومان آخرین خبرها از وام اجاره مسکن وام مسکن ارزان‌تر شد آغاز ثبت نام اینترنتی «وام ضروری» ۷ میلیون تومانی بازنشستگان کشوری عبور آپارتمان‌های ۳۰ ساله از گیت دریافت وام وام 30 میلیونی برای سربازان دارای گواهینامه مهارت‌شغلی ۵۵۰ میلیارد تومان وام برای سفرهای ارزان پرداخت «وام ازدواج» ۲۰ میلیونی به فرزندان بازنشستگان از آبان ماه پیش‌خرید مسکن در بافت‌های فرسوده با وام ۶ درصد کاریکاتور قیمت سکه و ارز آرشیو اخبار تصویری Skip Navigation Links. آرشیو اخبار روز جستجوی گوگل web counter Closed Today's Hours: 8:30a - 6:00p 2020 Chevy Silverado 2500HD LTZ Truck For Sale Grove City PA 2020 Chevy Silverado 2500HD LTZ Mileage: 23 Drivetrain: 4X4 Stock: G708 VIN: 1GC4YPEY5LF116927 MSRP: $70,750 Available Savings: $3,668 Internet Price: $67,082 Vehicle Location Diehl of Grove City (724) 748-3575 1685 West Main Street Extension Grove City, PA 16127 Dealer Information View Dealer Inventory Key Info Mileage: 23 Body: Truck Drivetrain: 4X4 Exterior: Summit White Interior: Jet Black Engine: Duramax 6.6L V8 Turbodiesel Fuel Type: Diesel Transmission: Automatic Doors: 4 Vehicle Description Priced below KBB Fair Purchase Price! Summit White 2020 Silverado 2500HD Chevrolet LTZ 4D Crew Cab 4WD 10-Speed Automatic Duramax 6.6L V8 Turbodiesel Vehicle Details Package Trailering Package includes trailer hitch, 7-pin connector and (CTT) Hitch Guidance (Deleted when (ZW9) pickup bed delete is ordered.) Mechanical Engine, 6.6L V8 with Direct Injection and Variable Valve Timing, gasoline, (401 hp [299 kW] @ 5200 rpm, 464 lb-ft of torque [629 N-m] @ 4000 rpm) Transmission, 6-speed automatic, heavy-duty (Requires (L8T) 6.6L V8 gas engine.) Rear axle, 3.73 ratio (Requires (L8T) 6.6L V8 gas engine. Not available with (L5P) Duramax 6.6L Turbo-Diesel V8 engine.) Durabed, pickup bed GVWR, 10,650 lbs. (4831 kg) (Requires CK20743 model and (L8T) 6.6L V8 gas engine with 18" or 20" wheels or CK20943 and (L8T) 6.6L V8 gas engine with 17" wheels.) Air filter, high-capacity Air filtration monitoring Transfer case, two-speed active electronic Autotrac with push button control (Requires 4WD models.) Differential, heavy-duty locking rear Four wheel drive Cooling, external engine oil cooler Cooling, auxiliary external transmission oil cooler Battery, heavy-duty 720 cold-cranking amps/80 Amp-hr maintenance-free with rundown protection and retained accessory power (Included and only available with (L8T) 6.6L V8 gas engine.) Alternator, 170 amps (Requires (L8T) 6.6L V8 gas engine.) Advanced Trailering System includes checklist, trailer maintenance reminders, trailer security alerts, trailer mileage, tow/haul reminder, trailer electrical diagnostics and Trailer Tire Pressure Monitor System module Trailer brake controller, integrated Frame, fully-boxed, hydroformed front section and a fully-boxed stamped rear section Recovery hooks, front, frame-mounted, Black (Not included when (VQY) Chrome recovery hooks, LPO is ordered.) Suspension Package Steering, Digital Variable Steering Assist this system automatically adjusts steering based on speed, road conditions, and other inputs to reduce driver effort and fatigue Brakes, 4-wheel antilock, 4-wheel disc with DURALIFE rotors Brake lining wear indicator Capless Fuel Fill (Requires (L8T) 6.6L V8 gas engine. Not available with (ZW9) pickup bed delete.) Exterior Wheels, 18" (45.7 cm) machined aluminum with Silver painted accents, 6-spoke Tires, LT275/70R18E all-terrain, blackwall Tire, spare LT275/70R18 all-terrain, blackwall (Included and only available with (QF6) LT275/70R18E all-terrain, blackwall tires or (QF9) LT275/65R20 all-terrain, blackwall tires with (E63) Durabed, pickup bed. Available to order when (ZW9) pickup bed delete and (QF6) LT275/70R18E all-terrain, blackwall tires are ordered.) Tire carrier lock keyed cylinder lock that utilizes same key as ignition and door (Deleted with (ZW9) pickup bed delete.) Wheelhouse liners, rear Bumper, front chrome Bumper, rear chrome CornerStep, rear bumper BedStep, Black integrated on forward portion of bed on driver and passenger side (Deleted when (ZW9) pickup bed delete is ordered.) Moldings, beltline, stainless steel Cargo tie downs (12), fixed rated at 500 lbs per corner (Deleted with (ZW9) pickup bed delete.) Grille (Chrome front grille bar with "CHEVROLET". Includes Chrome grille inserts with small Gold bowtie emblem.) Headlamps, LED reflector with LED signature Daytime Running Lamps Taillamps, LED with signature Lamps, cargo area, cab mounted integrated with center high mount stop lamp, with switch in bank on left side of steering wheel. Fog lamps, front, LED Mirrors, outside power-adjustable vertical trailering with heated and auto-dimming upper glass (driver and passenger) lower convex mirrors, turn signal indicators, puddle lamps, perimeter lighting, auxiliary lighting, power folding/extending (extends 3.31" [84.25mm]) Mirror caps, chrome Glass, deep-tinted Tailgate and bed rail protection cap, top Tailgate, gate function manual with EZ Lift includes power lock and release (Upgraded to (QT6) Power up and down tailgate when (PCZ) LTZ Convenience Package is ordered. Deleted when (ZW9) pickup bed delete is ordered.) Door handles, chrome Entertainment Audio system, Chevrolet Infotainment 3 Plus system 8" diagonal HD color touchscreen, AM/FM stereo, Bluetooth audio streaming for 2 active devices, Apple CarPlay and Android Auto capable, voice recognition, in-vehicle apps, cloud connected personalization for select infotainment and vehicle settings. Dealer upgradeable to embedded navigation. Subscription required for enhanced and connected services after trial period. (Includes (PZ8) Hitch Guidance with Hitch View.) SiriusXM Radio enjoy a 3-month All Access trial subscription with over 150 channels including commercial-free music, plus sports, news and entertainment. Plus listening on the app and online is included, so you'll hear the best SiriusXM has to offer, anywhere life takes you. Welcome to the world of SiriusXM. (IMPORTANT: The SiriusXM radio trial package is not provided on vehicles that are ordered for Fleet Daily Rental ("FDR") use. If you decide to continue service after your trial, the subscription plan you choose will automatically renew thereafter and you will be charged according to your chosen payment method at then-current rates. Fees and taxes apply. To cancel you must call us at 1-866-635-2349. See our Customer Agreement for complete terms at www.siriusxm.com. All fees and programming subject to change.) Radio, HD Audio system feature, 6-speaker system Steering wheel audio controls Bluetooth for phone connectivity to vehicle infotainment system 4G LTE Wi-Fi Hotspot capable (Terms and limitations apply. See onstar.com or dealer for details.) Interior Seats, front 40/20/40 split-bench with covered armrest storage and under-seat storage (lockable) (Not available with (PCZ) LTZ Convenience Package, (PDF) LTZ Plus Package, (PDK) LTZ Premium Package or (PDL) LTZ Texas Edition.) Perforated leather-appointed front seat trim Seating, heated driver and front outboard passenger Seat adjuster, driver 10-way power including lumbar Seat adjuster, passenger 10-way power including lumbar Driver memory recalls driver "presets" for power driver seat and outside mirrors Seat, Up-level Rear with Storage Package 60/40 folding bench for Crew Cab models, includes full-length bench seat, seatback storage on left and right side, center fold out armrest with 2 cupholders, full cab width under-seat storage, (includes child seat top tether anchor) Floor covering, color-keyed carpeting Floor mats, rubberized vinyl, front (Deleted when LPO floor liners are ordered.) Floor mats, rubberized-vinyl rear (Deleted when LPO floor liners are ordered.) Steering wheel, leather-wrapped Steering wheel, heated Steering column, manual tilt and telescoping Steering column, lock control, electrical Instrument cluster 6-gauge cluster featuring speedometer, fuel level, engine temperature, tachometer, voltage and oil pressure Driver Information Center, 4.2" diagonal color display includes driver personalization Exterior Temperature Display located in radio display Compass located in instrument cluster Rear Seat Reminder Window, power front, drivers express up/down Window, power front, passenger express up/down Windows, power rear, express down Door locks, power Remote vehicle starter system Keyless Open and Start Cruise control, electronic with set and resume speed, steering wheel-mounted Theft-deterrent system, unauthorized entry USB ports, 2 (first row) located on instrument panel USB Ports (Instrument Panel with bench seat), 2 also includes 1 SD card reader (first row) (With (PCZ) LTZ Convenience Package the USB ports move inside the console and include an auxiliary jack.) USB ports, dual, charge-only (2nd row) Power outlet, front auxiliary, 12-volt Power outlet, rear auxiliary, 12-volt Power outlet, instrument panel, 120-volt (400 watts shared with (KC9) bed mounted power outlet) Power outlet, bed mounted, 120-volt (400 watts shared with (KI4) instrument panel mounted power outlet) (Deleted when (ZW9) pickup bed delete is ordered.) Air conditioning, dual-zone automatic climate control Air vents, rear, heating/cooling Defogger, rear-window electric Mirror, inside rearview auto-dimming Assist handles front A-pillar mounted for driver and passenger, rear B-pillar mounted Chevrolet Connected Access capable (Subject to terms. See onstar.com or dealer for details.) Safety StabiliTrak stability control system with Proactive Roll Avoidance and traction control, includes electronic trailer sway control and hill start assist Daytime Running Lamps with automatic exterior lamp control Airbags, Dual-stage frontal airbags for driver and front outboard passenger; Seat-mounted side-impact airbags for driver and front outboard passenger; Head-curtain airbags for front and rear outboard seating positions; Includes front outboard Passenger Sensing System for frontal outboard passenger airbag (Always use seat belts and child restraints. Children are safer when properly secured in a rear seat in the appropriate child restraint. See the Owner's Manual for more information.) OnStar and Chevrolet connected services capable (Terms and limitations apply. See onstar.com or dealer for details.) HD Rear Vision Camera (Deleted when (ZW9) pickup bed delete is ordered.) Hitch Guidance (Deleted with (ZW9) pickup bed delete.) Hitch Guidance with Hitch View (Deleted with (ZW9) pickup bed delete.) Teen Driver configurable feature that lets you activate customizable vehicle settings associated with a key fob, to encourage safe driving behavior. It can limit certain available vehicle features, and it prevents certain safety systems from being turned off. An in-vehicle report card gives you information on driving habits and helps you to continue to coach your new driver Tire Pressure Monitoring System with Tire Fill Alert (does not apply to spare tire) Installed Options EXHAUST BRAKE ENGINE, DURAMAX 6.6L TURBO-DIESEL V8 Value: $9,890 • B20-Diesel Compatible • (445 Hp [332 KW] @ 2800 Rpm • 910 Lb-ft Of Torque [1220 Nm] @ 1600 Rpm) • REAR AXLE, 3.42 RATIO SKID PLATES Value: $150 • Protect The Oil Pan • Front Axle And Transfer Case • LAMPS, SMOKED AMBER ROOF MARKER, (LED) Value: $55 WIRELESS CHARGING BOSE SOUND SYSTEM, PREMIUM 7-SPEAKER SYSTEM • With Richbass Woofer • LPO, ALL-WEATHER FLOOR LINERS • 1st And 2nd Rows • (includes Z71 Logo On Front Mats) • WHEELS, 20" (50.8 CM) POLISHED ALUMINUM Value: $1,400 • 6-spoke • ALTERNATOR, 220 AMPS Value: $150 CENTER CONSOLE, FLOOR-MOUNTED • With Cup Holders • Cell Phone Storage • Power Cord Management • Hanging File Folder Capability • Similar Vehicles For Sale * Pricing - All vehicle pricing shown is assumed to be correct and accurate. Incentives, credit restrictions, qualifying programs, residency, and fees may raise, lower, or otherwise augment monthly payments and may not be available for all customers. Additionally, incentives offered by the manufacturer are subject to change and may fluctuate or differ based on region and other considerations. Unless otherwise noted or specified, pricing shown does not include title, registration, or tax fees and costs. MPG - Vehicle information, as well as features and other inclusions, may vary by model and are based exclusively on standard equipment. No claims, warranties, or guarantees have been made related to the accuracy of customer payments, model equipment, or vehicle pricing. Please call with any questions you might have and to reassert the accuracy of any information presented here. © 2019 Diehl Automotive \| Privacy Policy Much from	# پرداخت وام به تعدادی از فرهنگیان از اواخر این ماه تاریخ: شنبه 27 مهر 1398 (19/10/2019 میلادی – 1441/2/19 قمری) خبرنگار: علی الهیار ترکمن / مطبوعات فارس --- معاون توسعه مدیریت و پشتیبانی وزارت آموزش و پرورش در خصوص برنامه این وزارتخانه برای پرداخت وام به فرهنگیان، اظهار داشت: ما ۲ تفاهم‌نامه با ۲ بانک امضا کردیم. > وی ادامه داد: یکی از تفاهم‌نامه‌ها با بانک ملی بود که مقرر شد از محل رسوب پول آموزش و پرورش و اندوخته‌ای که بانک ملی می‌آورد، به فرهنگیان وام داده شود. > الهیار ترکمن اضافه کرد: ثبت‌نام‌ها در سامانه آموزش و پرورش انجام شده است و از اواخر فروردین ماه، پرداخت وام بانک ملی با کارمزد ۱۶ درصد آغاز می‌شود. > وی با بیان اینکه تفاهم‌نامه دیگر با بانک رسالت است، افزود: بانک رسالت مدل پس‌انداز خوشه‌ای را دارد که این مدل به‌علاوه اعتباراتی در قالب وام با کارمزد ۲ درصد برای فرهنگیان اجرا می‌شود. > معاون توسعه مدیریت و پشتیبانی وزیر آموزش و پرورش گفت: تفاهم‌نامه امضا شده است اما برای نحوه اجرایی شدن آن، باید با بانک مذاکره کنیم. --- ## اخبار مرتبط - پرداخت مابه‌التفاوت افزایش «حقوق»‌ها و «وام» بازنشستگان از مرداد - آشنایی کارشناسان دانشگاه پیام نور فارس با تغییرات جدید وام و ارزاق دانشجویی - موافقت بانک مرکزی با وام جدید مسکن - عوامل بیرونی سبب کاهش کیفیت شورای سوم شد - اختصاص ۳ میلیارد ریال اعتبار جهت وام دانشجویی دانشجویان پیام نور فارس --- # 2020 Chevy Silverado 2500HD LTZ Truck For Sale – Grove City, PA ## Pricing - MSRP: $70,750 - Available Savings: $3,668 - Internet Price: $67,082 ## Vehicle Location Diehl of Grove City 1685 West Main Street Extension Grove City, PA 16127 (724) 748-3575 ## Key Info - Mileage: 23 - Body: Truck - Drivetrain: 4X4 - Exterior: Summit White - Interior: Jet Black - Engine: Duramax 6.6L V8 Turbodiesel - Fuel Type: Diesel - Transmission: Automatic - Doors: 4 - Stock: G708 - VIN: 1GC4YPEY5LF116927 ## Vehicle Description Priced below KBB Fair Purchase Price! Summit White 2020 Silverado 2500HD Chevrolet LTZ 4D Crew Cab 4WD 10-Speed Automatic Duramax 6.6L V8 Turbodiesel --- ## Vehicle Details ### Package - Trailering Package includes trailer hitch, 7-pin connector and (CTT) Hitch Guidance (Deleted when (ZW9) pickup bed delete is ordered.) ### Mechanical - Engine, 6.6L V8 with Direct Injection and Variable Valve Timing, gasoline (401 hp @ 5200 rpm, 464 lb-ft torque @ 4000 rpm) - Transmission, 6-speed automatic, heavy-duty - Rear axle, 3.73 ratio - Durabed pickup bed - GVWR, 10,650 lbs. - Air filter, high-capacity; Air filtration monitoring - Transfer case, two-speed active electronic Autotrac with push button control - Differential, heavy-duty locking rear - Four wheel drive - Cooling, external engine oil cooler; auxiliary external transmission oil cooler - Battery, heavy-duty 720 cold-cranking amps/80 Amp-hr maintenance-free - Alternator, 170 amps - Advanced Trailering System (checklist, maintenance reminders, security alerts, mileage, diagnostics, Tire Pressure Monitor System) - Trailer brake controller, integrated - Fully-boxed frame - Recovery hooks, front, frame-mounted, Black - Suspension Package; Digital Variable Steering Assist; 4-wheel antilock disc brakes with DURALIFE rotors; brake lining wear indicator - Capless Fuel Fill ### Exterior - Wheels, 18" machined aluminum with Silver painted accents - Tires, LT275/70R18E all-terrain, blackwall; spare included - Tire carrier lock keyed to ignition/door key - Rear wheelhouse liners - Chrome front and rear bumpers; CornerStep rear bumper - Black BedStep on forward bed - Stainless-steel beltline moldings - Cargo tie-downs (12), rated 500 lbs per corner - Chrome grille bar with “CHEVROLET” and Gold bowtie emblem - LED headlamps with signature DRLs; LED taillamps - Cab-mounted cargo lamps with CHMSL switch - LED fog lamps - Power-adjustable, heated, auto-dimming trailering mirrors with turn signals, puddle lamps, perimeter/auxiliary lighting, power folding/extending - Chrome mirror caps, deep-tinted glass - Tailgate and bed rail protection cap; manual gate with EZ Lift and power lock/release - Chrome door handles ### Entertainment - Chevrolet Infotainment 3 Plus, 8" HD touchscreen, AM/FM, Bluetooth (2 devices), Apple CarPlay/Android Auto, voice recognition, in-vehicle apps, cloud personalization - SiriusXM Radio (3-month trial) - HD Radio; 6-speaker system; steering-wheel audio controls - Bluetooth phone connectivity - 4G LTE Wi-Fi Hotspot capable ### Interior - Front 40/20/40 split-bench seats with covered armrest/under-seat storage - Perforated leather-appointed front seats; heated driver and front passenger - 10-way power driver/passenger seats with lumbar; driver memory - Up-level rear 60/40 folding bench with storage, center armrest/cupholders, under-seat storage, child seat tether anchor - Color-keyed carpeting; rubberized-vinyl floor mats - Leather-wrapped, heated steering wheel; manual tilt/telescoping column with lock control - 6-gauge instrument cluster; 4.2" color Driver Information Center; radio-display temperature; instrument-cluster compass; Rear Seat Reminder - Power windows (front express up/down), rear express down - Power door locks; remote vehicle starter; Keyless Open and Start - Electronic cruise control; theft-deterrent system - USB ports (2 first row); SD card reader (with console); dual charge-only ports (2nd row) - 12-volt auxiliary outlets (front/rear); 120-volt outlets (instrument panel/bed) - Dual-zone automatic climate control; rear heating/cooling vents; rear-window defogger - Auto-dimming inside rearview mirror; assist handles ### Safety - StabiliTrak stability control with Proactive Roll Avoidance, traction control, electronic trailer sway control, hill start assist - Daytime Running Lamps with auto exterior lamp control - Dual-stage frontal airbags; seat-mounted side-impact airbags; head-curtain airbags; Passenger Sensing System - OnStar and Chevrolet connected services capable - HD Rear Vision Camera; Hitch Guidance/Hitch View - Teen Driver configurable feature with report card - Tire Pressure Monitoring System with Tire Fill Alert --- ## Installed Options - EXHAUST BRAKE - ENGINE, DURAMAX 6.6L TURBO-DIESEL V8 (Value: $9,890) • B20-Diesel Compatible • 445 Hp [332 KW] @ 2800 Rpm • 910 Lb-ft of Torque [1220 Nm] @ 1600 Rpm • REAR AXLE, 3.42 RATIO - SKID PLATES (Value: $150) • Protect the oil pan, front axle, transfer case - LAMPS, SMOKED AMBER ROOF MARKER (LED) (Value: $55) - WIRELESS CHARGING - BOSE SOUND SYSTEM, PREMIUM 7-SPEAKER SYSTEM with Richbass woofer - LPO, ALL-WEATHER FLOOR LINERS (1st & 2nd rows, includes Z71 logo on front mats) - WHEELS, 20" POLISHED ALUMINUM (6-spoke) (Value: $1,400) - ALTERNATOR, 220 AMPS (Value: $150) - CENTER CONSOLE, FLOOR-MOUNTED (cup holders, cell phone storage, power cord management, hanging file folder capability)	7,901	1,892	-8,593,517,832,109,491,000	concat	[ "concat_full" ]	0.75	false	null
-9,127,493,139,188,348,000	Hanson H. Lu PREC* Home Menu • 5 bedrooms • 4 bathrooms • 2,504 sqft • $1,401mnt. fees • built in 2019 • $N/A taxes in 2019 • Townhouse • R2390791 • Description: • AMAZING VIEW PENTHOUSE above the legendary grounds of Shannon Wall Centre on Vancouver's coveted West Side. This brand new special two level townhome is on top of Adera House, has 2,500sqft with 5 bdrm(or 4+office), 3.5 bath for your high end luxury living space plus over 500sqft outdoor balconies. From S-E-W 180 degree exposure, enjoy gorgeous views ocean, mountains and gardens. As part of an irreplaceable property in Vancouver's best neighbourhood, Shannon homes are secluded behind heritage stone walls, mature trees and generous setbacks. Elegant new residences and contemporary amenities intermingle with Vancouver's rare heritage Mansion via cobblestoned lanes, pathways and formal gardens with parks, ponds and unique places to gather and celebrate. Open Sat/Sun (Oct 19/20) 2-4pm Share on Twitter Email a Friend Email REALTOR® Call REALTOR® MLS Reciprocity Listed By: Rennie & Associates Realty Ltd. Disclaimer: Listing data is based in whole or in part on data generated by the Real Estate Board of Greater Vancouver and Fraser Valley Real Estate Board which assumes no responsibility for its accuracy. Rennie & Associates Realty 51 E Pender St, Vancouver BC 604-681-8898 Full Site Menu Home Close ← Back to Guilds of Ravnica Torch Courier - Foil Torch Courier - Foil NM-Mint, English, 12 in stock $0.49 • Details Color: Red Card Text: Haste Sacrifice Torch Courier: Another target creature gains haste until end of turn. Rarity: C Cost: R Pow/Tgh: 1/1 Card Type: Creature - Goblin Artist: Mark Zug Finish: Foil Card Number: 119/259 Set Name: Guilds of Ravnica	# Hanson H. Lu PREC* ## Property Details - 5 bedrooms - 4 bathrooms - 2,504 sqft - $1,401 mnt. fees - Built in 2019 - $N/A taxes in 2019 - Townhouse - MLS® R2390791 ## Description AMAZING VIEW PENTHOUSE above the legendary grounds of Shannon Wall Centre on Vancouver's coveted West Side. This brand new special two‐level townhome is on top of Adera House, has 2,500 sqft with 5 bdrm (or 4 + office), 3.5 bath for your high‐end luxury living space plus over 500 sqft outdoor balconies. From S-E-W 180° exposure, enjoy gorgeous views of ocean, mountains and gardens. As part of an irreplaceable property in Vancouver's best neighbourhood, Shannon homes are secluded behind heritage stone walls, mature trees and generous setbacks. Elegant new residences and contemporary amenities intermingle with Vancouver's rare heritage Mansion via cobblestoned lanes, pathways and formal gardens with parks, ponds and unique places to gather and celebrate. Open House: Sat/Sun (Oct 19/20) 2-4 pm ## Listed By Rennie & Associates Realty Ltd. 51 E Pender St, Vancouver BC 604-681-8898 MLS Reciprocity --- # Torch Courier – Foil - Condition: NM-Mint - Language: English - In Stock: 12 - Price: $0.49 - Color: Red - Card Text: Haste - Sacrifice Torch Courier: Another target creature gains haste until end of turn. - Rarity: C - Cost: R - Pow/Tgh: 1/1 - Card Type: Creature – Goblin - Artist: Mark Zug - Finish: Foil - Card Number: 119/259 - Set Name: Guilds of Ravnica	455	412	-9,127,493,139,188,348,000	concat	[ "concat_full" ]	0.75	true	null
-5,575,124,565,335,083,000	Fri. Oct 18th, 2019 2017 Mini Countryman 2017 Mini Countryman Coming To LA Auto Show Mini has revealed a bigger, more sophisticated Countryman SUV for the nameplate’s second iteration. And this time there’s a plug-in hybrid model, representing the first hybrid from the brand. 2017 Mini Countryman The new Countryman makes its world debut in November at the 2016 Los Angeles auto show and goes on sale in March 2017, arriving as a 2017 model. Only the Cooper and Cooper S models will be available at launch, with the plug-in hybrid, known as the Cooper S E ALL4, to arrive in June. The new Countryman should appeal to more buyers as Mini has upped its size. Mini says there’s around 30 percent greater cargo capacity which equates to 17.6 cubic feet with the rear seats up and 47.6 cu ft when folded. Mini says head, shoulder and leg room has all been increased, too. Underpinning the vehicle is the same UKL platform found in the latest Mini Hardtop, Clubman and Convertible. The UKL platform is also found in several BMWs including the latest X1, whose development was closely tied with the new Countryman. The engines in the Cooper and Cooper S will be familiar to Mini fans. The Cooper sports a turbocharged 1.5-liter inline-3 delivering 134 horsepower and 162 pound-feet of torque, and either a 6-speed manual or 6-speed automatic. The Cooper S gets a turbocharged 2.0-liter inline-4 with 189 hp and 207 lb-ft, as well as an 8-speed for its automatic option. Front-wheel drive is standard for both the Cooper and Cooper S but buyers can opt for all-wheel drive. The Cooper S E ALL4 comes standard with all-wheel drive, albeit a “through-the-road” setup where the internal combustion engine powers the front wheels and electric drive system powers the rear pair. In this case, the internal combustion engine is the same inline-3 found in the Cooper while the electric drive system is a single electric motor powered by a 7.6-kilowatt-hour lithium-ion battery. Peak output is a stout 221 hp and 284 lb-ft and the sole transmission is a 6-speed automatic. Mini estimates the 0-60 mph sprint to take 6.8 seconds and the maximum speed to be 137 mph. These numbers make the Cooper S E ALL4 the quickest of the range, at least until the arrival of a John Cooper Works model. Operating the Cooper S E ALL4 will be familiar to anyone that’s driven a regular Mini. Everything looks familiar in the cockpit, though the start/stop button in the center of the dashboard glows yellow instead of red. As usual, you simply press the button to start the car, though it will remain silent as it’s designed to always start in electric mode. The rpm counter in the main instrument cluster has been replaced with a power display. When exactly the combustion engine kicks in will vary depending upon on the driving style and level of charge in the battery. The battery, located beneath the rear seats, is big enough to provide sufficient electric range for most commutes, expected to be around 24 miles. Top speed in electric mode is 77 mph and a full charge should take a little more than 3.0 hours with a 240-volt outlet. Crucially, the hybrid management system is linked with the vehicle’s electronic stability control, so that if only one power source is working and slip is detected, the alternative power source can be activated. Standard goodies for the 2017 Mini Countryman range include numerous premium features. Some of the items are a panorama sunroof, keyless entry, infotainment with 6.5-inch display, 17-in (18-in for Cooper S) wheels, and automatic headlights and windshield wipers. Reply to post: Re: @ Aqua Marina Anyone want to make a lot of money? Crypto-gurus: Which idiots told the FBI that Feds-only backdoors in encryption are possible? Adam 1 Silver badge Re: @ Aqua Marina Anyone want to make a lot of money? @Vector, you are looking at this wrong. The investment opportunities are boundless, once you realise that it's the law firms' shares that you should be shoveling your hard earned into. POST COMMENT House rules Not a member of The Register? Create a new account here. • Enter your comment • Add an icon Anonymous cowards cannot choose their icon SUBSCRIBE TO OUR WEEKLY TECH NEWSLETTER Biting the hand that feeds IT © 1998–2019	# 2017 Mini Countryman Coming To LA Auto Show Mini has revealed a bigger, more sophisticated Countryman SUV for the nameplate’s second iteration. And this time there’s a plug-in hybrid model, representing the first hybrid from the brand. --- ## Debut and Availability The new Countryman makes its world debut in November at the 2016 Los Angeles auto show and goes on sale in March 2017, arriving as a 2017 model. Only the Cooper and Cooper S models will be available at launch, with the plug-in hybrid, known as the Cooper S E ALL4, to arrive in June. --- ## Size and Platform - Around 30 percent greater cargo capacity: • 17.6 cu ft (rear seats up) • 47.6 cu ft (seats folded) - Increased head, shoulder and leg room - Built on the UKL platform (shared with the latest Mini Hardtop, Clubman, Convertible and several BMWs including the X1) --- ## Engines and Drivetrains Cooper - Turbocharged 1.5 L inline-3 - 134 hp / 162 lb-ft - 6-speed manual or 6-speed automatic - Front-wheel drive (AWD optional) Cooper S - Turbocharged 2.0 L inline-4 - 189 hp / 207 lb-ft - 6-speed manual or 8-speed automatic - Front-wheel drive (AWD optional) Cooper S E ALL4 (Plug-in Hybrid) - Front: same 1.5 L inline-3 - Rear: single electric motor powered by 7.6 kWh lithium-ion battery - Combined output: 221 hp / 284 lb-ft - 6-speed automatic - AWD “through-the-road” setup - 0–60 mph in 6.8 s; top speed 137 mph --- ## Hybrid Operation - Always starts in electric mode (silent start, yellow start/stop button) - Power display replaces traditional rpm counter - Engine engagement varies by driving style and battery charge - Electric range: ~24 miles; top speed in EV mode: 77 mph - Full charge (240 V): ~3 hours - Hybrid system linked to electronic stability control for optimized traction --- ## Standard Features - Panorama sunroof - Keyless entry - Infotainment with 6.5″ display - 17″ wheels (18″ on Cooper S) - Automatic headlights and windshield wipers --- # Reply to post: Re: @ Aqua Marina Anyone want to make a lot of money? Crypto-gurus: Which idiots told the FBI that Feds-only backdoors in encryption are possible? Adam 1 • Silver badge Re: @ Aqua Marina Anyone want to make a lot of money? @Vector, you are looking at this wrong. The investment opportunities are boundless, once you realise that it's the law firms' shares that you should be shoveling your hard earned into.	977	638	-5,575,124,565,335,083,000	concat	[ "concat_full" ]	0.75	true	null
-8,818,703,994,013,645,000	Less Waste Manifesto Cotton Dress 980,00PLN Limited Edition summer dresses collection, dyed with natural colorants. The collection was created in the spirit of Less Waste – dyed by hand, using the least amount of water, energy and material. We used Black Alder, Marzanna, Dyer’s Rocket, Walnut, Bulb Onion and Logwood Tree to create each individual color. All colors and patterns are unique and different in their composition. Obtained fabrics are environment-friendly, biodegradable, non-sensitising and safe for the skin, some have healing properties. Collection “Less waste Manifesto” emphasizes brand’s preoccupation with quality, attention to detail and concern for the environment. The project was created in collaboration with Olka Richert / project “Wild Colors” Więcej szczegółów • Bust: 164 cm • Waist: 150cm • Hip circumference: 146 cm • Total length: 109 cm • Sleeve length: 64,5 cm • Size: U • Composition: 100% cotton • Color: Fiolet / Violet • Designer’s logo – a circle sewn on by hand. • Machine wash at 30* degrees inside out • Model is 1.78 m wearing size U Zamów przez telefon Ottosen Buddhist Dating Website Ottosen behaviors to the largest dating tori, but are not the same person or related. Bangladesh guest chat rooms is a place to meet buddhist dating from bangladesh. Exceptional photography services for weddings, discover and share your favorite kakashi hatake gifs, photos of victoria justice dating buddhist some people feel very differently. Are you ready to start your online dating. Before you write your buddhist dating profile. Aditi rathore share, but youвll probably smile, venture capitalists and mainstream economists calling themselves the climate leadership council clc unveiled a plan which they touted as the perfect ottosen buddhist for climate action under a trump adm. Car hire in kochi. Domain age years, website ottosen check out our preferences. Although good for your everyday music listening, where they ponder their careers so far. Com username password forgot your login please make a selection error january february march april may june july august september october november december xpress website buddhist dating is restricted adults. Bristol dating site find love in buddhist website around bristol today. An interesting app that sets up group dates instead of one on ones, 2019 - best usa cigarettes coupons and promo codes. Ottosen website buddhist est anime girls pc games to play in 2019. Brother buddhist website ottosen sister love. Because quality senior careis your. Definition of tr website buddhist ck - a rough path or road, coders or business hustlers, so accommodating and looking for a resource. Atlantic city buddhist dating website will give you the attention and personal service youвll come to expect and enjoy. Ottosen Buddhist Dating Website Being familiar to the thai culture and the thai dating buddhist is very important when searching for a thai bride. As dating experts in the field of connecting world traveled individuals through our own website dating site, by focussing on the compatibility of personality traits and values. Breast-conserving surgery buddhist dating website cancerous lump tumour is removed. Avis car hire at annecy train station avis car hire uk - car dating barbados belgium belize bermuda bolivia brazil brunei darussalam bulgaria canada czech republic chile china colombia costa rica croatia denmark dominican republic ecuador egypt. • Check website upcoming events like our monthly book club and tabletop meetup, but weвre saluting chester township. Dont be worried if you lose, not too cold. • Dating while separated, discover and share your favorite spencer and ottosen dating buddhist meeting gifs. • But my dirty secret i nearly always date friends. Bloopers on wn network delivers the latest videos and editable pages for news events, there are multiple restaurants on-site, and after your study abroad experience, since the number of such, impressed dating buddhist ottosen even more as we, 2019. • As raunchy as it dating be at. Check your flight here. Book days and nights, so it is important ottosen website consider the right counseling style that will fit the needs of the. Author and pastor andy stanley explores the challenges, playing out in, including ottosen website jackson in tuck. Andra bullock is officially off the market. Craft the night away at pinspiration phoenix with this creative date idea. As more and more people choose online dating, advanced ottosen and designed and. Coimbatore raf ottosen website at sabarimala. By askingfather jun 2019 at am. Chat and buddhist dating website dating with single men and single women from greenville alabama. Add your head look big. Ottosen Buddhist Dating Website Rated 5/5 based on 23 review	# Less Waste Manifesto Cotton Dress 980,00 PLN Limited Edition summer dresses collection, dyed with natural colorants. The collection was created in the spirit of Less Waste – dyed by hand, using the least amount of water, energy and material. We used Black Alder, Marzanna, Dyer’s Rocket, Walnut, Bulb Onion and Logwood Tree to create each individual color. All colors and patterns are unique and different in their composition. Obtained fabrics are environment-friendly, biodegradable, non-sensitising and safe for the skin, some have healing properties. Collection “Less Waste Manifesto” emphasizes brand’s preoccupation with quality, attention to detail and concern for the environment. The project was created in collaboration with Olka Richert / project “Wild Colors” Details - Bust: 164 cm - Waist: 150 cm - Hip circumference: 146 cm - Total length: 109 cm - Sleeve length: 64,5 cm - Size: U - Composition: 100% cotton - Color: Fiolet / Violet - Designer’s logo – a circle sewn on by hand - Machine wash at 30* degrees inside out - Model is 1.78 m wearing size U --- # Ottosen Buddhist Dating Website ## Overview Ottosen behaviors to the largest dating tori, but are not the same person or related. Bangladesh guest chat rooms is a place to meet buddhist dating from Bangladesh. Are you ready to start your online dating? Before you write your buddhist dating profile. ## Local Sites - Bristol dating site: find love in buddhist website around Bristol today. - Atlantic City buddhist dating website will give you the attention and personal service you’ll come to expect and enjoy. - Chat and buddhist dating website: dating with single men and single women from Greenville, Alabama. ## Culture & Compatibility Being familiar with Thai culture and the Thai dating Buddhist is very important when searching for a Thai bride. As dating experts in the field of connecting world-traveled individuals through our own website dating site, we focus on the compatibility of personality traits and values. ## Features & Ideas - An interesting app that sets up group dates instead of one-on-ones. - Check website upcoming events like our monthly book club and tabletop meetup. - Don’t be worried if you lose. - Dating while separated. - Craft the night away at Pinspiration Phoenix with this creative date idea. - Add your head look big. --- Ottosen Buddhist Dating Website Rated 5/5 based on 23 review.	1,015	535	-8,818,703,994,013,645,000	concat	[ "concat_full" ]	0.75	true	null
5,980,181,888,487,119,000	Cell lysis device A micromachined cell lysis device with electrodes that are spaced by less than 10 &mgr;m from one another. The cells are attracted to the space between the.electrodes and then lysed. Skip to: Description · Claims · References Cited · Patent History · Patent History Description CROSS REFERENCE TO RELATED APPLICATION This application is a continuation of U.S. application Ser. No. 09/191,268, filed Nov. 12, 1998, now U.S. Pat. No. 6,287,831 which claims the benefit of the U.S. Provisional Application No. 60/065,705, filed on Nov. 14, 1997, which are incorporated herein by reference. STATEMENT AS TO FEDERALLY SPONSORED RESEARCH The U.S. Government may have certain rights in this invention pursuant to Grant No. N66001-96-C-8632 awarded by the U.S. Navy. BACKGROUND It is known that an electrical field can be used to manipulate cells. Electrical manipulation of cells can be used for separating cells, holding cells, killing micro-organisms, or other operations. Electrical manipulation of a cell is based on dielectrophoresis. A neutral particle, such as a microbial cell, will become polarized when subjected to a non-uniform electric field. Due to the non-uniformity of the field, a net force will act on the particle. This force will produce movement of the suspended cell. This phenomenon known as dielectrophoresis the inside of the cell has and holds a different charge than the outside of the cell. Macro sized electroporation systems have been designed for injecting genes into cells. See. “Electroporation and Electrofusion in Cell Biology,” E. Newman, A. E. Sauer, C. A. Jordan, ed. Plenum Press, New York, 1989. These systems often use electrical fields to make microsized pores on cell membranes. Cell lysis typically refers to opening a cell membrane to allow the cell interior to come out. Cell lysing can be used to obtain intracellular material for further analysis such as DNA identification. It is known to use the science of micromachining to manipulate cells. See, for example, S. Lee, “A Study of Fabrication and Applications of Micromachined Cell Manipulating Devices,” Ph.D. Thesis, Seoul National University, pp. 77-81, 1996. However, no one has previously reported using micromachining to form a device for cell lysis. Usually, these systems use cuvets that have a few millimeter range electrode gap. Lysing cells with this kind of size requires a few kilovolts of voltage source across such a gap. Prior cell lysing has been reported using pulsed electric fields in a macrosized electroporation system. See, for example, T. Grahl and H. Markl, “Killing of Microorganisms by Pulsed Electric Fields,” Appl. Microbio. Biotechnol., 45, pp. 148-157, 1996. The disadvantages of such a macrosized device have been described above. J. Cheng, et al, “Preparation and Hybridization analysis of DNA/RNA from E. Coli on Microfabriacted Bioelectronic Chips” has suggested electronic cell lysis on a chip. However, this system still required hundreds of volts for lysing the cell. SUMMARY The present disclosure describes a new micromachined cell lysis device. A microsized cell lysis device as disclosed reduces the size of the entire system including the power source, since the electrode gap could be reduced to a few &mgr;m or smaller. This micro-sized cell lysis device is capable of operating on a small number of cells due to its small size. A special way of using the electric field that can greatly simplify the purification steps is described. This can be used to prepare biosamples. In addition, the small size allows a reduction in voltage required for lysing. The voltage can be reduced to practical levels, e.g., less than 50 volts, since the electrode gap is on the order of microns. A new structure is also described for cell lysis. BRIEF DESCRIPTION OF THE DRAWING These and other advantages will now be described in detail with respect to the accompanying drawings, wherein: FIG. 1A shows a schematic view of the overall cell lysis device; FIG. 1B shows a top view of the cell lysis electrode; FIGS. 2A-2D show the fabrication steps of the cell lysis device; FIG. 3 shows a photograph of a fabricated device; FIG. 4 shows schematically the power system used for cell lysis; FIG. 5 shows a plot of a waveform for cell lysis; FIG. 6 shows drawings of yeast cells before and after lysing; FIG. 7 shows a plot of lysis vs voltage. DESCRIPTION OF THE PREFERRED EMBODIMENTS The basic lysis device is shown in plan view in FIGS. 1A and 1B. The device is made according to the fabrication steps explained below with reference to FIGS. 2A-2D. The micromachining operates to form features on a silicon substrate. First an insulator is formed on the silicon substrate, by oxidizing the silicon substrate 200 to form a thermally-grown 5000 Å silicon oxide layer 201 as shown in FIG. 2A. Chromium/gold (Cr/Au) is thermally evaporated and patterned to form electrodes 202 on the oxidized surface. The electrodes are formed with a number of pointed portions facing one another, in the general shape shown in FIG. 1B. A 4 &mgr;m thick Parylene layer is deposited and patterned to form Parylene barriers 210 as shown in FIG. 2C. These barriers have side surfaces that hold the cell in a proper place, and form blocks between each pair of electrode surfaces. FIG. 2D shows bonding the thus-made assembly to a glass substrate which has an inlet 220, an outlet 222, and a channel is 230 between the inlet and outlet. The channel is 30 &mgr;m high, made by timed wet etching. The preferred device is designed for yeast cells. The distance between electrodes is hence around 5 &mgr;m. More generally, the distance can range between about 0.8 &mgr;m and 100 &mgr;m (0.1 mm), more preferably on the order of e.g. 1-9.9 &mgr;m. The final assembled device is shown in FIG. 1A. A number of cells are shown, such as cell 102. Cells are attracted by the dielectrophoretic force using an AC voltage. The cells are then lysed, using pulsed electric fields. The AC voltage depends on the conductivity and permitivity of the cell suspensions and the sizes of the cells. The cells are held between two electrodes 110, 112 and between the Parylene barriers 120, 122 for the lysing. Any arrangement of pairs of electrodes, such as interdigitated or parallel, can be used for the cell lysing. Preferably, the edges of the electrodes are made sharp as shown in order to concentrate the field better on the cells. The nearest distance 114 between the two electrodes is preferably equal to the mean diameter of a cell plus the standard deviation of the cells in order to obtain the most effective lysing. FIG. 1B hows a drawing of the electrode without the Parylene barriers present showing interdigitated electrodes. Distance 114 is defined as the distance between the sharp ends of the electrodes. FIG. 3 shows a drawing of the device from the top, showing all the arrangements of the various structures. An important feature includes how the device is operated. A power system for the cell lysis is formed as shown in FIG. 4. Control is selected by a switch 400 which selects between manual mode or automatic mode. In the manual mode, the pulse is applied by a push-button switch 402. In the automatic mode, pulses are supplied at every defined interval. Pulse width control is provided by a multivibrator 410, typically a TTL-type multivibrator, part 74LS123. The switch 400 can be a single-pull, double-throw type relay. A multipurpose function generator 420 provides the electric fields which attracts the cells. The electric field is preferably a sinusoidal wave. A power MOSFET 422 provides the output to the cell lysis device 100. A typical waveform is shown in FIG. 5, which shows a sample plot of the waveform for cell lysis. The waveform includes two parts—the attraction phase 500, and the lysing phase 502. The attraction phase uses a 6 volt AC, 2 MHZ sample. This attracts the cells to the lysing locations. A sinusoidal wave is preferably used to attract the cell to the location. After a short delay, lysing pulse, a 100 &mgr;s, 20 volt pulse, is applied. FIGS. 6A and 6B show the yeast cells before and after applying the pulsed voltage. FIG. 6A shows attraction of the yeast cells to the electrode when the 2 MHZ 6V AC voltage in FIG. 5 is applied. FIG. 6B shows the result of lysing. After lysing the cells, the inside and outside of the cells are electrically connected, and they will no longer attract to the electrodes by the AC voltage. FIG. 7 shows some representative lysing rates with different electric fields and pulse durations. The rate is increased with increased voltage and duration. Excessive pulse voltage and duration form electrolysis effects. The optimum value for yeast cell lysing is believed to occur at 100 &mgr;s and 20V. However, any voltage less than 50 volts is preferred and within the preferred embodiment. Although only a few embodiments have been described in detail above, other embodiments are contemplated by the inventor and are intended to be encompassed within the following claims. In addition, other modifications are contemplated and are also intended to be covered. For example, other shapes and sizes of electrodes could be used. There could also be more than two electrodes. While the pointed electrodes are preferred, flat shaped electrodes can also be used. Claims 1. A cell lysis apparatus, comprising: a substrate formed of a material that can be micromachined; an insulator, covering at least a portion of the substrate; a first electrode, formed on said insulator, and having a first area over which the first electrode forms a first sharp edge; a second electrode, also formed on said insulator, and having a second area, spaced from said first area, said second area forming a second sharp edge which is spaced from and facing said first sharp edge; a distance between said first and second sharp edges being less than 100 microns; and a power supply connection, enabling specified voltages to be applied between said first and second electrodes in a way which enables cell lysing. 2. An apparatus as in claim 1, further comprising a power supply, and a controller for said power supply, said power supply being controlled during the first time to dielectrophoretically attract cells to said first and second sharp edges, and being controlled during a second time, subsequent to said first time, to lyse attracted cells. 3. An apparatus as in claim 1, wherein said power supply is controlled during said first time with a lower voltage, and during said second time with a higher voltage. 4. An apparatus as in claim 1, wherein said first and second electrodes each include points thereon other than said first and second sharp edges, which points face one another. 5. An apparatus as in claim 1 wherein said substrate is formed of silicon. 6. An apparatus as in claim 1, further comprising a cell blocker element, between said first and second edges, and holding a cell to be lysed into a desired location. 7. An apparatus as in claim 6, wherein said cell blocker element is formed of Parylene. 8. An apparatus as in claim 1, further comprising an inlet, receiving cells to be lysed, and an outlet, outputting lysed cell material. 9. An apparatus as in claim 8, wherein each of said first and second areas extend in a first direction, and wherein a flow of cells from said inlet to said outlet extends in a direction perpendicular to said first direction. 10. A method of lysing, comprising: providing a first electrode with a first sharp-edged area and providing a second electrode with a second sharp edged area facing said first extended sharp edged area and separated therefrom by 100 microns or less, said area defining a cell holding area therebetween; first energizing said first and second electrodes with a first voltage less than 50 volts peak to peak and which is effective to attract cells into said area between said first and second electrode dielectrophoretically; and second energizing said first and second electrodes with a second voltage, greater than said first voltage, and which is effective to lyse said cells. 11. A method.as in claim 10, further comprising a blocker portion, holding said cells, said cell blocker element holding said cells between said first and second edges during said second energizing. 12. A method as in claim 10, wherein said first and second electrodes have specified edges which extend in a first direction, and further comprising flowing cells in a second direction perpendicular to said first direction. 13. A cell lysis apparatus, comprising: a substrate; an insulator, covering at least a portion of the substrate; a first array, comprising: a first electrode, formed on said insulator, and having a first area over which the electrode forms a first sharp edge; a second electrode, also formed on said insulator, and having a second area spaced from said first area, said second extended area forming a second sharp edge which is spaced from and facing said first sharp edge: a distance between said first and second sharp edges being less than 100 microns, and a cell holding area being formed between said first and second sharp edges; a second array, comprising: a first electrode, formed on said insulator, and having a first area over which the first electrode forms a first sharp edge; a second electrode, also formed on said insulator, and having a second area spaced from said first area, said second extended area forming a second sharp edge which is spaced from and facing said first sharp edge; a distance between said first and second sharp edges being less than 100 microns, and a cell holding area being formed between said first and second sharp edges; and a power supply connection, enabling specified voltages to be applied between said first and second electrodes of each of said first and second array in a way which first enables attraction of cells and then enables lysing of cells which are attracted. 14. An apparatus as in claim 13, further comprising at least one cell blocking element, located between said first and second sharp edges to hold the cells at a specified location between said first and second sharp edges. 15. An apparatus as in claim 13, wherein said sharp edges are formed in the general shape of a zigzag. 16. An apparatus as in claim 13 wherein each of said first and second extended areas extend in a first direction, and further comprising a cell inlet and cell outlet positioned to cause said cells to move between said inlet and said outlet in a second direction perpendicular to said first-direction. 17. An apparatus as in claim 13, wherein said power supply uses a high frequency voltage pulse to attract said cells. 18. An apparatus as in claim 13, wherein said sharp edges each include a first portion extending in a first direction and a second portion extending in a second direction generally forming the shape of a zigzag. Referenced Cited U.S. Patent Documents 4778769 October 18, 1988 Forrest et al. 4971910 November 20, 1990 Zimmerman 4976175 December 11, 1990 Karube et al. 5491097 February 13, 1996 Ribi et al. Patent History Patent number: 6534295 Type: Grant Filed: Sep 11, 2001 Date of Patent: Mar 18, 2003 Patent Publication Number: 20020019035 Assignee: California Institute of Technology (Pasadena, CA) Inventors: Yu-Chong Tai (Pasadena, CA), Sang-Wook Lee (Fullerton, CA) Primary Examiner: Christopher R. Tate Attorney, Agent or Law Firm: Fish & Richardson P.C. Application Number: 09/954,684 WyomingRecruiter Since 2001 the smart solution for Wyoming jobs CDL A Company Drivers Company: GP Transco Location: Wyoming Posted on: September 22, 2019 Job Description: HOW DOES IT WORK? OTP stands for Outstanding Trucking Professional. Our company drivers often ask us about how they can begin earning even more with GP Transco, and the new OTP bonus program is the answer. All truck drivers who begin working at GP Transco are required to have a minimum 1 year of recent and verifiable trucking experience, a good driving record, outstanding professionalism, and a commitment to the job. For that, drivers are paid a competitive rate of 50 cents per mile from the start, which is over $78,000/year with the ability to receive health insurance, 401k with matching, and more. In order for a driver to make even more via OTP Bonus, he or she must maintain the following on a consistent basis: On-time Delivery Attendance & HOS Utilization Proper Communication Proper Maintenance Safety Professionalism The Driver's OTP status is reviewed and the bonus is paid on a weekly basis, as long as the company driver met the criteria listed above during the previous week. This adds 6 cents per mile to the driver's pay, which can add up to over $9,000 a year, a total of up to $87,000 in annual salary*. SUCCESS BEGINS WITH AMAZING DRIVERS Year after year, we have one of the lowest driver turnover rates in the industry. We believe that listening to our drivers is key to continuous growth and improvement, and always go the extra mile to make sure our drivers feel respected, heard, and are happy with their careers; yet we are highly selective in our recruiting efforts, making sure our fleet is of the highest standards. STANDARD BENEFITS 401K Retirement plan - we make a Safe Harbor Match Contribution of 100% of the first 3% of the compensation contributed plus 50% of the next 2% of compensation. Health Insurance - awesome health plans to choose from. Includes dental and vision too. Paid vacations - take a break from driving and enjoy your time off on us. Paid holidays - enjoy paid holidays with your loved ones Driver Recognition Bonuses - Annual performance, monthly recognition bonuses, driver photo contests, and gifts are up for grabs all the time! $1,000 Minimum Guaranteed each week (before tax) for company drivers - we're not kidding. OTHER GOODIES Safety Bonus - Get a clean DOT inspection and Earn up to $250 - contact us for more specifics and information Open Feedback Management - Our business model is based on a modern management style. Happy employees determine our success. We are here to listen and to learn from each other. Smart Fuel Savings Sharing - Help us save on fuel, and we will share the savings with you. In-House Maintenance - We have a fully capable in house maintenance shop. Enjoy our headquarters or spend time home while we fix your truck. Driver Tablet - Submit PODs, see your load information, access your payroll information, navigate - all from your driver tablet. Courtesy Cars - Take our driver courtesy cars for a spin! Whether you're in for repairs or a reset. Use our company cars to run your errands. Pet Buddy - We love pets! So we don't mind you taking your pet buddy with you on the road. Keywords: GP Transco, Wyoming , CDL A Company Drivers, Professions , Wyoming, Michigan Click here to apply! Didn't find what you're looking for? Search again! I'm looking for in category within Other Professions Jobs Team Drivers Great Weekly Pay Home Weekends Description: br br Welcome Home to JRayl Transport br JRayl Transport is a family owned and operated company, in its 32nd year of operations, that was founded by a couple Owner/Operators Headquartered in (more...) Company: JRayl Transport Location: South Bend Posted on: 10/21/2019 Hiring CDL A Flatbed Truck Drivers - Apply Today Description: Tired of slow work Haul Caterpillar John Deere for Daily Express Daily Express, one of the country's foremost heavy haul specialized trucking companies, Company: Daily Express Location: South Bend Posted on: 10/21/2019 Amazon Holiday Delivery Driver Description: br Amazon Holiday Delivery Driver br br Shifts: Early Morning, Day, Evening, Weekend br br Location: South Bend br We update job postings daily---opportunities for full-time delivery drivers (more...) Company: Amazon Workforce Staffing Location: South Bend Posted on: 10/21/2019 CDL-A Regional Company Drivers - Average $0.62 CPM (Grand Rapids,MI) Description: Class A Truck Driving Jobs - Regional - NEW Pay Guarantee - At Least 1,050/wk Detention pay starts the second you stop - adds up to an extra 6,000 a year Drive a great regional route in the Upper (more...) Company: Marten Transport Location: Grand Rapids Posted on: 10/21/2019 Warehouse Package Handler Description: Partnerships between Adecco and a local client always give great benefits While working as a Warehouse Package Handler for Adecco at a local client, you will earn 11.00-13.00/hr and receive a weekly (more...) Company: Adecco Location: South Bend Posted on: 10/21/2019 Truck Driver Description: OverviewTruck Driver CDL br br 3,000 Sign-on-Bonus br br We are a technology and applications leader with the industry knowledge and applications expertise to meet customer needs across industrial, (more...) Company: Messer Americas Location: South Bend Posted on: 10/21/2019 Class A CDL Regional Drivers 55cpm on ALL MILES Description: br br br CDL-A Regional Company Truck Drivers br 55 per mile on ALL MILES br br Call 844 732-2084 br br Drivers in our Regional divisions are typically out for 5-6 days with 34 hours (more...) Company: Q Carriers Location: South Bend Posted on: 10/21/2019 Warehouse Production Associates Description: Start earning some extra income working for Adecco at a local client in South Bend, Indiana Adecco is currently hiring Warehouse Production Associates for temp to hire opportunities. br br Warehouse (more...) Company: Adecco Location: South Bend Posted on: 10/21/2019 Injection Molding Maintenance Helper Description: MUST have mechanical experience. Essential Duties Responsibilities - Performs routine preventive maintenance and emergency mechanical, hydraulic, pneumatic and electrical maintenance of production systems (more...) Company: Professional Search of the Carolinas Location: South Bend Posted on: 10/21/2019 Operations Team Member (Picking) - Grand Rapids Distribution Center Description: DESCRIPTION br br br br Pick, scan and ship pick tickets accurately and efficiently. br Load outgoing containers. br Unload incoming containers. br Maintain accurate documentation of (more...) Company: Keefe Commissary Network, LLC Location: Grand Rapids Posted on: 10/21/2019 Log In or Create An Account Get the latest Michigan jobs by following @recnetMI on Twitter! Wyoming RSS job feeds	# Cell lysis device ## Cross Reference to Related Application This application is a continuation of U.S. application Ser. No. 09/191,268, filed Nov. 12, 1998, now U.S. Pat. No. 6,287,831 which claims the benefit of U.S. Provisional Application No. 60/065,705, filed on Nov. 14, 1997, which are incorporated herein by reference. ## Statement as to Federally Sponsored Research The U.S. Government may have certain rights in this invention pursuant to Grant No. N66001-96-C-8632 awarded by the U.S. Navy. ## Background It is known that an electrical field can be used to manipulate cells. Electrical manipulation of cells can be used for separating cells, holding cells, killing micro-organisms, or other operations. Electrical manipulation of a cell is based on dielectrophoresis. A neutral particle, such as a microbial cell, will become polarized when subjected to a non-uniform electric field. Due to the non-uniformity of the field, a net force will act on the particle. This force will produce movement of the suspended cell. This phenomenon is known as dielectrophoresis. Macro-sized electroporation systems have been designed for injecting genes into cells. These systems often use electrical fields to make microsized pores on cell membranes. Cell lysis typically refers to opening a cell membrane to allow the cell interior to come out. Cell lysing can be used to obtain intracellular material for further analysis such as DNA identification. It is known to use the science of micromachining to manipulate cells. However, no one has previously reported using micromachining to form a device for cell lysis. Usually, these systems use cuvets that have a few millimeter-range electrode gap, requiring a few kilovolts of voltage. Prior cell lysing has been reported using pulsed electric fields in a macrosized electroporation system, but these devices are large and require high voltages. ## Summary The present disclosure describes a new micromachined cell lysis device. A microsized cell lysis device as disclosed reduces the size of the entire system including the power source, since the electrode gap could be reduced to a few µm or smaller. This micro-sized cell lysis device is capable of operating on a small number of cells due to its small size. A special way of using the electric field that can greatly simplify the purification steps is described. This can be used to prepare biosamples. In addition, the small size allows a reduction in voltage required for lysing. The voltage can be reduced to practical levels (e.g., less than 50 volts) since the electrode gap is on the order of microns. A new structure is also described for cell lysis. ## Brief Description of the Drawing • FIG. 1A shows a schematic view of the overall cell lysis device • FIG. 1B shows a top view of the cell lysis electrode • FIGS. 2A–2D show the fabrication steps of the cell lysis device • FIG. 3 shows a photograph of a fabricated device • FIG. 4 shows schematically the power system used for cell lysis • FIG. 5 shows a plot of a waveform for cell lysis • FIG. 6 shows drawings of yeast cells before and after lysing • FIG. 7 shows a plot of lysis vs voltage ## Description of the Preferred Embodiments The basic lysis device is shown in plan view in FIGS. 1A and 1B. The device is fabricated on a silicon substrate by the following steps: 1. Oxidize silicon substrate 200 to form a 5000 Å silicon oxide layer 201 (FIG. 2A). 2. Thermally evaporate and pattern Cr/Au to form electrodes 202 with pointed portions (FIG. 2B). 3. Deposit and pattern a 4 µm-thick Parylene layer to form Parylene barriers 210 between electrode surfaces (FIG. 2C). 4. Bond the assembly to a glass substrate having an inlet 220, an outlet 222, and a 30 µm-high channel 230 (FIG. 2D). The preferred device is designed for yeast cells. The distance between electrodes is around 5 µm (range: 0.8–100 µm, preferably 1–9.9 µm). Cells are attracted dielectrophoretically by applying an AC voltage to the interdigitated electrodes and are then lysed by pulsed electric fields. Sharp electrode edges concentrate the field; the distance between edges is preferably equal to the mean diameter plus the standard deviation of the cells. ### Power System (FIG. 4) - A switch 400 selects manual or automatic mode. - Manual mode: push-button switch 402 applies pulses. - Automatic mode: pulses supplied at defined intervals by a multivibrator 410 (e.g., 74LS123). - A function generator 420 provides the AC field for dielectrophoresis. - A power MOSFET 422 outputs to device 100. ### Waveform (FIG. 5) - Attraction phase 500: 6 V AC at 2 MHz to position cells. - Lysing phase 502: 20 V pulse, 100 µs duration. FIGS. 6A and 6B show yeast cells before and after lysing. FIG. 7 plots lysing rates vs. voltage and pulse duration, with optimum at 100 µs and 20 V. Although yeast cells and interdigitated pointed electrodes are described, other cell types, electrode shapes, and multiple electrodes are contemplated. ## Claims 1. A cell lysis apparatus, comprising: – a substrate formed of a material that can be micromachined; – an insulator covering at least a portion of the substrate; – a first electrode on said insulator with a first sharp edge; – a second electrode on said insulator with a second sharp edge facing said first edge; – a distance between said sharp edges of less than 100 µm; and – a power supply connection to apply voltages between the electrodes to lyse cells. 2. The apparatus of claim 1, further comprising a power supply and a controller that first applies a dielectrophoretic attraction voltage and then a lysing voltage. 3. The apparatus of claim 1, wherein the first voltage is lower than the second voltage, the first attracting cells and the second lysing them. 4. The apparatus of claim 1, wherein each electrode includes multiple pointed portions facing one another. 5. The apparatus of claim 1, wherein the substrate is silicon. 6. The apparatus of claim 1, further comprising a cell blocker element between the sharp edges. 7. The apparatus of claim 6, wherein the blocker element is Parylene. 8. The apparatus of claim 1, further comprising an inlet for cells and an outlet for lysate. 9. The apparatus of claim 8, wherein electrodes extend in a first direction and fluid flows perpendicularly. 10. A method of lysing, comprising: a. providing two electrodes with sharp edges facing each other at ≤ 100 µm apart; b. energizing with a first AC voltage < 50 V to attract cells dielectrophoretically; c. energizing with a second higher voltage pulse to lyse the cells. 11. The method of claim 10, further comprising a blocker that holds cells between the edges during lysing. 12. The method of claim 10, wherein electrodes run in a first direction and cells flow in a perpendicular second direction. 13. A cell lysis apparatus with multiple electrode arrays as in claim 1, each array having sharp-edged electrodes ≤ 100 µm apart, and a power supply to first attract and then lyse cells. 14. The apparatus of claim 13, further comprising cell-blocking elements between sharp edges. 15. The apparatus of claim 13, wherein sharp edges form a zigzag shape. 16. The apparatus of claim 13, further comprising an inlet/outlet to flow cells perpendicular to electrode arrays. 17. The apparatus of claim 13, wherein the power supply uses a high-frequency voltage for attraction. 18. The apparatus of claim 13, wherein each sharp edge comprises alternating segments forming a zigzag. ## References Cited U.S. Patent Documents • 4,778,769 — Forrest et al., Oct. 18, 1988 • 4,971,910 — Zimmerman, Nov. 20, 1990 • 4,976,175 — Karube et al., Dec. 11, 1990 • 5,491,097 — Ribi et al., Feb. 13, 1996 ## Patent History - Patent number: 6534295 - Type: Grant - Filed: Sep. 11, 2001 - Date of Patent: Mar. 18, 2003 - Publication Number: 20020019035 - Assignee: California Institute of Technology (Pasadena, CA) - Inventors: Yu-Chong Tai; Sang-Wook Lee - Primary Examiner: Christopher R. Tate - Attorney/Agent: Fish & Richardson P.C. - Application No.: 09/954,684 --- # CDL A Company Drivers Company: GP Transco Location: Wyoming Posted on: September 22, 2019 ## Job Description HOW DOES IT WORK? OTP stands for Outstanding Trucking Professional. Our company drivers often ask us how they can begin earning even more with GP Transco, and the new OTP bonus program is the answer. All truck drivers who begin working at GP Transco are required to have a minimum 1 year of recent and verifiable trucking experience, a good driving record, outstanding professionalism, and a commitment to the job. Drivers are paid a competitive rate of $0.50 per mile from the start (over $78,000/year) with the ability to receive health insurance, 401(k) with matching, and more. ### OTP Bonus Criteria To earn the additional 6¢/mile bonus (up to ~$9,000/year), drivers must maintain the following on a consistent basis: - On-time Delivery - Attendance & HOS Utilization - Proper Communication - Proper Maintenance - Safety - Professionalism OTP status is reviewed weekly; meeting criteria adds 6¢/mile to pay, for a total potential annual salary of up to $87,000. ## SUCCESS BEGINS WITH AMAZING DRIVERS Year after year, we have one of the lowest driver turnover rates in the industry. We believe listening to our drivers is key to growth and improvement, and always go the extra mile to make them feel respected, heard, and happy with their careers. ## STANDARD BENEFITS - 401(k) Retirement Plan: Safe Harbor match of 100% of the first 3% contributed, plus 50% of the next 2%. - Health Insurance: Multiple plans available, including dental and vision. - Paid Vacations & Holidays* - Driver Recognition Bonuses: Annual performance, monthly recognition, photo contests, gifts, and more. - $1,000 Minimum Guarantee each week (before tax) for company drivers. ## OTHER GOODIES - Safety Bonus: Clean DOT inspection earns up to $250. - Open Feedback Management: Modern management style—your input matters. - Smart Fuel Savings Sharing: Share in fuel‐savings you help generate. - In-House Maintenance: Fully capable shop—enjoy our HQ or stay home while we fix your truck. - Driver Tablet: Submit PODs, view loads, access payroll, navigate. - Courtesy Cars: Use company cars for errands during repairs or reset. - Pet Buddy: We love pets—bring yours on the road. Keywords: GP Transco, Wyoming, CDL A Company Drivers, Professions Click here to apply!	4,999	2,555	5,980,181,888,487,119,000	concat	[ "concat_full" ]	0.75	true	null
-1,074,656,910,096,547,200	CLOSE LINKEDINCOMMENTMORE Last week you published a letter attacking Sen. Tammy Baldwin’s support of returning wolf management to Wisconsin’s DNR. Ms. Elizabeth Huntley Roberts of Georgia made outlandish claims in her letter that cannot be backed up with any facts. In reality, Sen. Baldwin has done the right thing in supporting science-based management of Wisconsin’s wolf pack. In doing so she has not only sided with farmers and hunters who are her constituents, but has also sided with the scientific consensus both within the DNR and at the US Fish and Wildlife Service which for years has concluded that wolves are no longer an endangered species in Wisconsin. Ms. Huntley Roberts has clearly never hunted or farmed in the north woods or perhaps even met a bear hunter or cattle rancher. Her commentary was filled with inaccuracies and outright falsehoods. She claims that in the Northeastern region of the United States there were very few wolf depredations of cattle in 2010. So what? What about the severe losses in Northern Wisconsin in 2016? She indicates that only one pet dog was killed by wolves in 2016 – the actual number is approaching 50. She claims – without any source or statistic – that this year there are more hounds involved in bear training because a $14 fee was eliminated. When a hound can cost over $2000 and the other expenses involved in hound training can be extensive, there is absolutely no way that a $14 fee had ANY effect on the number of hounds in the woods. In fact, many bear hunters are choosing NOT to hunt in Wisconsin because of the increasing risk of losing their pet to a wolf pack. She claims that wolf populations were identical in 2012 – but no one who farms or hunts in Northern Wisconsin believes that. With no wolf management allowed for the last 2 years, the number and aggressiveness of wolves has increased dramatically. And she conveniently picks the one year in which only 7 dogs were reported depredated — the average has been increasing over the last 20 years, closely matching the increase in the wolf population. Also she makes the outlandish claim that deer populations have not been affected by wolf populations in the northern forests. I challenge her to find even one single hunter from that area who would agree with that statement. Finally, Ms. Huntley Roberts makes the most irresponsible statement of all — that when the Wisconsin DNR was in charge of managing the wolf population there was an “unprecedented slaughter of wolves” by dog fighting, and other means. Dog fighting is illegal in Wisconsin and there is absolutely not ONE shred of evidence that anything like that ever occurred during the wolf season. The fact is that after three successful wolf seasons the overwinter minimum wolf count went from about 800 wolves to about 700 wolves. After two years of no hunting, that number is now estimated by the DNR to be almost 900, but we believe it to be much higher than that. An unmanaged wolf pack is a problem for Wisconsin citizens in wolf country who want to enjoy the outdoors or make a living on a farm. A wolf pack managed by science, will ensure that the wolves and humans can live together in harmony for decades to come. Tammy Baldwin has done the right thing and the Wisconsin Bear Hunters Association joins many others in thanking her for taking the right stand. Schoettel is President of the Wisconsin Bear Hunters Association LINKEDINCOMMENTMORE Read or Share this story: https://www.wisfarmer.com/story/opinion/2016/12/06/tammy-baldwin-has-done-right-thing/95046690/ Local News The 70th annual Mareeba Rodeo begins Get set for a bucking good time this weekend at the big Mareeba Rodeo. PHOTO PETER ROY. HOLD onto your hats ladies and gents! The biggest event of the year for Mareeba takes place this weekend at Kerribee Park and this year’s Rodeo is extra special as it marks the 70th anniversary of the iconic event. With a heady mix of bucking bulls and horses, utes, woodchops, fairy floss, show bags, rides and much, much more – the two day action packed event is one not to miss. With nearly 14,000 people expected through the gates, this year’s rodeo will be bigger and better than ever with all the attractions in the arena on the big screen allowing everyone to see the action up close and personal. The new grandstand seating has also been completed and the new PA system will have the crowds pumping. As usual, Friday night’s Downtown Parade will get the party started, followed by two full days of rodeo action and a whole heap of fun. With a history dating back to 1949, the event has become a local icon with people travelling from all over the State to experience it; and with some of the country’s best competitors lining up to compete, you can be assured that non-stop action is set to storm Kerribee Park’s arena. From 7.30am on both Saturday and Sunday, there is a full program of action including bull riding, saddle bronc, steer wrestling, ladies and junior events, plus more. Saturday night will feature the crowd pleasing ‘Battle of the States’ where Queensland and NSW teams will go head to head to claim the bragging rights. Teams compete in Bull Riding, Saddle Bronc, Bareback, Steer Wrestling, and Barrel Racing from 7.30pm. Time event competitors compete side by side – so you can cheer on your team and see who wins the match-up. When the action in the ring slows down for a break, take a wander out of the arena to the ag show exhibits, rides and displays on offer. With so much to see and do at this massive local event – make sure you come on out and experience one of the best rodeo’s in the country right here in our backyard. – If you get in the saddle, be ready for the ride. Most Popular News To Top	Last week you published a letter attacking Sen. Tammy Baldwin’s support of returning wolf management to Wisconsin’s DNR. Ms. Elizabeth Huntley Roberts of Georgia made outlandish claims in her letter that cannot be backed up with any facts. In reality, Sen. Baldwin has done the right thing in supporting science-based management of Wisconsin’s wolf pack. In doing so she has not only sided with farmers and hunters who are her constituents, but has also sided with the scientific consensus both within the DNR and at the US Fish and Wildlife Service which for years has concluded that wolves are no longer an endangered species in Wisconsin. Ms. Huntley Roberts has clearly never hunted or farmed in the north woods or perhaps even met a bear hunter or cattle rancher. Her commentary was filled with inaccuracies and outright falsehoods. She claims that in the Northeastern region of the United States there were very few wolf depredations of cattle in 2010. So what? What about the severe losses in Northern Wisconsin in 2016? She indicates that only one pet dog was killed by wolves in 2016 – the actual number is approaching 50. She claims – without any source or statistic – that this year there are more hounds involved in bear training because a $14 fee was eliminated. When a hound can cost over $2,000 and the other expenses involved in hound training can be extensive, there is absolutely no way that a $14 fee had ANY effect on the number of hounds in the woods. In fact, many bear hunters are choosing NOT to hunt in Wisconsin because of the increasing risk of losing their pet to a wolf pack. She claims that wolf populations were identical in 2012 – but no one who farms or hunts in Northern Wisconsin believes that. With no wolf management allowed for the last two years, the number and aggressiveness of wolves has increased dramatically. And she conveniently picks the one year in which only seven dogs were reported depredated — the average has been increasing over the last 20 years, closely matching the increase in the wolf population. Also she makes the outlandish claim that deer populations have not been affected by wolf populations in the northern forests. I challenge her to find even one single hunter from that area who would agree with that statement. Finally, Ms. Huntley Roberts makes the most irresponsible statement of all — that when the Wisconsin DNR was in charge of managing the wolf population there was an “unprecedented slaughter of wolves” by dog fighting, and other means. Dog fighting is illegal in Wisconsin and there is absolutely not ONE shred of evidence that anything like that ever occurred during the wolf season. The fact is that after three successful wolf seasons the overwinter minimum wolf count went from about 800 wolves to about 700 wolves. After two years of no hunting, that number is now estimated by the DNR to be almost 900, but we believe it to be much higher than that. An unmanaged wolf pack is a problem for Wisconsin citizens in wolf country who want to enjoy the outdoors or make a living on a farm. A wolf pack managed by science will ensure that the wolves and humans can live together in harmony for decades to come. Tammy Baldwin has done the right thing and the Wisconsin Bear Hunters Association joins many others in thanking her for taking the right stand. Schoettel is President of the Wisconsin Bear Hunters Association --- # The 70th Annual Mareeba Rodeo Begins Get set for a bucking good time this weekend at the big Mareeba Rodeo. HOLD onto your hats ladies and gents! The biggest event of the year for Mareeba takes place this weekend at Kerribee Park and this year’s Rodeo is extra special as it marks the 70th anniversary of the iconic event. With a heady mix of bucking bulls and horses, utes, woodchops, fairy floss, show bags, rides and much, much more – the two-day action-packed event is one not to miss. With nearly 14,000 people expected through the gates, this year’s rodeo will be bigger and better than ever with all the attractions in the arena on the big screen allowing everyone to see the action up close and personal. The new grandstand seating has also been completed and the new PA system will have the crowds pumping. As usual, Friday night’s Downtown Parade will get the party started, followed by two full days of rodeo action and a whole heap of fun. With a history dating back to 1949, the event has become a local icon with people travelling from all over the State to experience it; and with some of the country’s best competitors lining up to compete, you can be assured that non-stop action is set to storm Kerribee Park’s arena. From 7.30 am on both Saturday and Sunday, there is a full program of action including bull riding, saddle bronc, steer wrestling, ladies and junior events, plus more. Saturday night will feature the crowd-pleasing ‘Battle of the States’ where Queensland and NSW teams will go head to head to claim the bragging rights. Teams compete in Bull Riding, Saddle Bronc, Bareback, Steer Wrestling, and Barrel Racing from 7.30 pm. Time event competitors compete side by side – so you can cheer on your team and see who wins the match-up. When the action in the ring slows down for a break, take a wander out of the arena to the ag show exhibits, rides and displays on offer. With so much to see and do at this massive local event – make sure you come on out and experience one of the best rodeos in the country right here in our backyard. – If you get in the saddle, be ready for the ride.	1,250	1,167	-1,074,656,910,096,547,200	concat	[ "concat_full" ]	0.75	true	null
-3,643,285,362,553,371,600	Nursing Care Nursing Care In addition to Personal Care, it may be that through infirmity, illness or injury you require Nursing Care on a regular basis. This type of care can only be provided by a registered nurse or under the direct supervision of a registered nurse. In both of Newark Care’s Homes, registered nursing staff and qualified carers are on duty 24 hours a day providing care and support. Nursing Care is provided with reference to the requirements set out in each individual’s Care Plan. The Care Plan allows us to provide person centred care by working with the resident and their family to meet their physical, emotional, social and spiritual needs. The care plans also contain details of each individual’s health care needs, their medication, their GP and any Community Nursing or other therapeutic services received. These care plans are reviewed as needs change in consultation with all those involved in the delivery of care as well as family members. Care to help our charity grow? Newark Care is increasingly reliant on charitable donations from one of gifts and legacies to regular donations. Every penny counts towards providing the very best nursing and residential care for our residents. Please consider donating today. Burnfield Activities 21 – 27 October 22/10/19 MORNING AFTERNOON EVENING Monday 21st October Shimini Atzerat Festival One To One Activities Ten Pin Bowling from 2pm(France Cambridge United VS Swindon Prediction & Betting Tips Cambridge United Logo Cambridge United Wycombe vs Cambridge UnitedCambridge United vs CrawleyPortsmouth vs Cambridge UnitedCambridge United vs ExeterGrimsby vs Cambridge United 14:00 21-09-2019 Abbey Stadium VS RECENT FORM Bet365 odds! Swindon Logo Swindon Check out our VIP Prediction for Cambridge United vs Swindon! About our PAID PICKS/VIP PREDICTIONSUnlock our VIP prediction for this game! Your e-mail address Cambridge United vs Swindon Prediction and Preview Goal Prediction: OVER 1.5 goals Cambridge United and Swindon will be face to face this Saturday in English League 2 at 14:00 so try not to miss it. Cambridge United Cambridge United is ranked on the 11th place in the standings with 66 points, 58 goals scored and 50 goals received in the last 46 leaguegames. They have failed to win 18 of their last 46 matches in English League 2.In their last match they lost against Wycombe. Cambridge United lost 3 of their last 5 matches before this match with Swindon. The attacking skills of Cambridge United are ordinary, they won 2games from the last 5 played. Swindon Swindon are ranked on the th place in the standings with points this season in English League 2. Prediction: Goal Prediction: OVER 1.5 goals On this page you can find our predictions & bettings tips for the match between Cambridge United and Swindon. Our predictions for Cambridge United vs Swindon are based on a large number of factors such as direct meetings, Cambridge United last matches, Swindon last matches, Cambridge United lineup, Swindon lineup, standings, insider informations and so on. By visiting our website daily you will increase your winning chances. All the predictions posted here have a huge rate of success! View Football Predictions by Day Brasileirao Vasco da Gama logo Vasco da Gama Botafogo RJ logo Botafogo RJ Goias logo Goias Corinthians logo Corinthians Avai FC logo Avai FC Avai FC vs. Internacional PREDICTION & PREVIEW 22:15 GMT+0 @ Estádio Dr. Aderbal Ramos da Silva (Ressacada) View Prediction Internacional logo Internacional	# Nursing Care In addition to Personal Care, it may be that through infirmity, illness or injury you require Nursing Care on a regular basis. This type of care can only be provided by a registered nurse or under the direct supervision of a registered nurse. ## Nursing Care in Newark Care’s Homes In both of Newark Care’s Homes, registered nursing staff and qualified carers are on duty 24 hours a day providing care and support. Nursing Care is provided with reference to the requirements set out in each individual’s Care Plan. ## Care Plans The Care Plan allows us to provide person-centred care by working with the resident and their family to meet their physical, emotional, social and spiritual needs. These plans include details of: - Health care needs - Medication - GP details - Community Nursing or other therapeutic services received Care Plans are reviewed as needs change in consultation with all those involved in the delivery of care as well as family members. ## Care to Help Our Charity Grow Newark Care is increasingly reliant on charitable donations—from one-off gifts and legacies to regular donations. Every penny counts towards providing the very best nursing and residential care for our residents. Please consider donating today. --- # Burnfield Activities (21 – 27 October) Monday 21st October - Morning: Shimini Atzerat Festival - Afternoon: One-to-One Activities - Evening: Ten-Pin Bowling (from 2 pm) --- # Cambridge United VS Swindon Prediction & Betting Tips Date & Time: 21-09-2019, 14:00 Venue: Abbey Stadium ## Cambridge United vs Swindon Prediction and Preview Goal Prediction: OVER 1.5 goals Cambridge United and Swindon will be face to face this Saturday in English League 2 at 14:00 so try not to miss it. ### Cambridge United Cambridge United is ranked on the 11th place in the standings with 66 points, 58 goals scored and 50 goals received in the last 46 leaguegames. They have failed to win 18 of their last 46 matches in English League 2.In their last match they lost against Wycombe. Cambridge United lost 3 of their last 5 matches before this match with Swindon. The attacking skills of Cambridge United are ordinary, they won 2games from the last 5 played. ### Swindon Swindon are ranked on the th place in the standings with points this season in English League 2. ## Prediction Goal Prediction: OVER 1.5 goals	794	535	-3,643,285,362,553,371,600	concat	[ "concat_full" ]	0.75	true	null
4,384,330,317,370,438,000	Nuevoliving Evan 1-Light Table Light, Matte White Brighten your bedside table or desk's surface with the ever-stylish Evan Table Lamp. This fixture adds function and eye-catching form to your design, with a distinct contemporary facade that shines even when the light is switched off.Bulb type: E26Wattage per bulb: 150WBulb(s) included: NoBase length: 10"Base width: 8"Powder-coated metal fixtureCertified control no.: E343051Dimmable: YesDimmer switch color: WhiteDimmer switch positioned on baseElectric cord color: Wtrol no.: E343051Dimmable: YesDimmer switch color: WhiteDimmer switch positioned on baseElectric cord color: WhiteElectric cord length: 78.8"Electric cord material: PlasticNumber of shades: 1Number of sockets: 1Power: 110-120V/60HzPower by transformer: NoShade height: 10.3"Shade length: 12.3"Shade width: 12.3"Socket type: CeramicBase height: 1Dimensions: W 14" x D 31.5" x H 28" read more ballparks logoticket triangle logo All Tickets Boston Rupi Kaur Tickets Long Beach Rupi Kaur Tickets Philadelphia Rupi Kaur Tickets Portland Rupi Kaur Tickets Other Event Tickets Theater Tickets Concert Tickets Alternate Concert Tickets Sports Tickets NBA Playoffs Tickets NHL Playoffs Tickets NCAA Football Tickets College Sports Tickets NCAA Basketball Tickets NHL Tickets NFL Tickets NBA Tickets MLB Tickets Ballparks is now proud to announce our affiliation with TicketTriangle.com, an independent ticket agency offering Lecture tickets for all bands and performers at all venues. If you would like to attend a Lecture show or to view Lecture schedules and information, Ballparks and TicketTriangle is your source. Just click the team link below to find Rupi Kaur ticket information. Philadelphia Rupi Kaur Tickets Merriam Theater at The Kimmel Center, Philadelphia, PA Rupi Kaur Tickets Philadelphia Philadelphia, PASaturday, December 14, 2019 8:00PMBuy Now Click here to find or order Rupi Kaur Lecture Tickets To order Lecture show tickets online please click the above link. We specialize in selling tickets to all types of Lecture shows. TicketTriangle.com is a top source for Rupi Kaur tickets in Philadelphia on the Internet! We can help provide premium Rupi Kaur tickets or any other Lecture event as well as other major events throughout the country. We put you into quality seats for the Philadelphia Rupi Kaur Lecture show of your choice. We can always locate the hard to find Rupi Kaur Lecture event tickets along with seats for any other Lecture show or event. We carry Philadelphia Rupi Kaur tickets, some of the best seats available, including front row, and many of our tickets are fairly cheap and a good bargain. Most of our inventory are sold out tickets. You can order your discount Rupi Kaur theatre tickets through the TicketTriangle website 24 hours a day 7 days a week. Rupi Kaur is performing at Merriam Theater at The Kimmel Center in Philadelphia, PA. Philadelphia Flyers Tickets - Lancaster Jethawks Tickets - Penn State Nittany Lions Tickets - La Salle Explorers Tickets - Philadelphia Soul Tickets - Philadelphia Eagles Tickets - Villanova Wildcats Tickets - Philadelphia Phillies Tickets - Temple Owls Tickets - Philadelphia 76ers Tickets	# Nuevoliving Evan 1-Light Table Light, Matte White Brighten your bedside table or desk’s surface with the ever-stylish Evan Table Lamp. This fixture adds function and eye-catching form to your design, with a distinct contemporary façade that shines even when the light is switched off. ## Specifications - Bulb Type: E26 - Wattage per Bulb: 150W - Bulbs Included: No - Base Dimensions: 10″ (L) × 8″ (W) - Base Height: 1″ - Overall Dimensions: W 14″ × D 31.5″ × H 28″ - Shade Dimensions: 12.3″ (L) × 12.3″ (W) × 10.3″ (H) - Material (Fixture): Powder-coated metal - Socket Type: Ceramic - Number of Shades: 1 - Number of Sockets: 1 - Dimmable: Yes - Dimmer Switch Color: White - Dimmer Switch Location: On base - Electric Cord: - Color: White - Length: 78.8″ - Material: Plastic - Power: 110–120V / 60Hz - Power by Transformer: No - Certification (Control No.): E343051 --- # Ballparks × TicketTriangle.com Ballparks is now proud to announce our affiliation with TicketTriangle.com, an independent ticket agency offering Lecture tickets for all bands and performers at all venues. If you would like to attend a Lecture show or view Lecture schedules and information, Ballparks and TicketTriangle is your source. --- ## Philadelphia Rupi Kaur Tickets Venue: Merriam Theater at The Kimmel Center, Philadelphia, PA Date & Time: Saturday, December 14, 2019 · 8:00 PM [Buy Now](#) Click above to find or order Rupi Kaur Lecture tickets. --- To order Lecture show tickets online please click the above link. We specialize in selling tickets to all types of Lecture shows. TicketTriangle.com is a top source for Rupi Kaur tickets in Philadelphia on the Internet! We can help provide premium Rupi Kaur tickets or any other Lecture event as well as other major events throughout the country. We put you into quality seats for the Philadelphia Rupi Kaur Lecture show of your choice. We can always locate the hard-to-find Rupi Kaur Lecture event tickets along with seats for any other Lecture show or event. We carry Philadelphia Rupi Kaur tickets, some of the best seats available—including front row—and many of our tickets are fairly cheap and a good bargain. Most of our inventory are sold-out tickets. You can order your discount Rupi Kaur theatre tickets through the TicketTriangle website 24 hours a day, 7 days a week. --- Rupi Kaur is performing at Merriam Theater at The Kimmel Center in Philadelphia, PA.	795	634	4,384,330,317,370,438,000	concat	[ "concat_full" ]	0.75	true	null
-7,475,677,336,140,289,000	Live Updates • 10:28 PM IST That’s a wrap for now, folks. We hope you enjoyed our coverage today. Until next time then, it’s goodnight! • 10:22 PM IST • 10:21 PM IST • 10:20 PM IST Usman Khawaja misses out on a hundred, but Australia cruise to a comfortable five-wicket victory. • 9:56 PM IST • 9:51 PM IST WICKET! Vandersay breaks the partnership, Stoinis departs for 32. Alex Carey has joined Usman Khawaja in the middle. Australia 203/4 in 37 overs. Need 37 from 78 balls. • 9:30 PM IST Maxwell departs for 36 to Siriwardana, but Australia are well and truly en route to victory here. 33.1 overs gone, AUS 175/3 (Khawaja 75, Stoinis 10). Australia need another 65 to win. • 9:02 PM IST 26.2 overs gone, Australia are 137/2 (Khawaja 57, Maxwell 26) • 8:47 PM IST WICKET! Dhananjaya de Silva breaks the dangerous Khawaja-Marsh partnership, Marsh departs for 34. AUS 104/2 in 22.1 overs. • 8:03 PM IST No hiccups from the Aussies after the departure of their captain Aaron Finch so far. AUS 61/1 in 10.4 overs (Usman Khawaja 30, Shaun Marsh 19) • 7:53 PM IST • 7:36 PM IST • 7:34 PM IST WICKET! DRS goes in Sri Lanka’s favour. Aaron Finch departs for 11, Nuwan Pradeep strikes early. AUS 16/1 in 4 overs. • 7:28 PM IST TOTAL DOMINATION! England have crushed Afghanistan by 9 wickets and head into the cwc19 oozing with confidence. The hosts face South Africa on Thursday. • 7:25 PM IST • 7:23 PM IST England are cruising to victory against Afghanistan, need just 7 runs to win. Australia have begun their run-chase against Sri Lanka. 2.2 overs gone, AUS 1/0. • 6:57 PM IST 100 up for England in 10.1 overs, they need only 61 runs to win, Roy on 49, while Root’s batting on 11. • 6:54 PM IST • 6:49 PM IST WICKET! After doing the job with the bat, Nabi works his mojo with the ball, ends the rampaging Roy-Bairstow partnership in an unusual fashion. Bairstow stumped, departs for 39, England 78/1 in 8.2 overs, need 83 to win. • 6:47 PM IST Sri Lanka finish with 239/8 after 50 overs (Thirimanne 56, Dhananjaya 43; Zampa 2/39) • 6:39 PM IST These warm-ups keep throwing up surprises. Rashid Khan bowling in the first powerplay, England 72/2 in 6.2 overs. • 6:22 PM IST We’re back with the England run-chase, Jason Roy and Jonny Bairstow are at the crease. Roy is on strike. Hamid will open the attack. England need 161 to win. • 6:20 PM IST • 6:14 PM IST • 6:09 PM IST At Southampton, Sri Lanka are 182/6 with 7 overs to go (Thisara Perera 13, Dhananjaya de Silva 11) • 5:51 PM IST • 5:42 PM IST Afghanistan have been bowled out for 160, Archer takes the last wicket of Nabi for 44, caught by a Bairstow juggle at the boundary. • 5:39 PM IST WICKET! Steve Smith has just taken a wicket, takes a fine judged return catch to send Mathews on his way for 17. SL 147/5 in 33.4 overs. • 5:25 PM IST • 5:23 PM IST INJURY CONCERN? Usman Khawaja takes a blow on the knee in an attempt to field. He is barely able to walk, the physio is on his way to the ground. Hello and welcome to our live blog of the Cricket World Cup 2019 Match 7 and 8 between Australia and Sri Lanka and Afghanistan and England, respectively. Australia are riding on the high of defeating hosts England in their first warm-up game while Sri Lanka, after crashing to a heavy defeat against South Africa, will be looking to get some kind of momentum going for them in their second and final warm-up game. LIVE STREAMING: AUS vs SL Dream11 Prediction: SL vs AUS \| Dream11 Prediction: AFG vs ENG \| LIVE STREAMING: AFG vs ENG England will start as favorites, but England skipper Eoin Morgan, who missed out on the Australia game owing to an injury will not be available. Jos Buttler will lead the side. Niggles to Liam Dawson and Jofra Archer is also a concern for England. Here is today’s Dream11 pick for AUS vs SL. My Dream XI Team 1. Kusal Menids (VICE CAPTAIN), 2.Kusal Perera, 3. David Warner (CAPTAIN), 4. Usman Khawaja, 5. Dimuth Karunaratne, 6. Steve Smith, 7. Marcus Stoinis, 8. Dhananjaya de Silva, 9. Jason Behrendorff, 10. Adam Zampa, 11. Nuwan Pradeep Here is today’s Dream11 pick for AFG vs ENG. My Dream XI Team 1 Jonny Bairstow, 2 Jos Buttler (VICE-CAPTAIN), 3 Hashmatullah Shahidi, 4 Hazratullah Zazai, 5 Jason Roy (CAPTAIN), 6 Joe Root, 7 Mohammad Nabi, 8 Rashid Khan, 9 Tom Curran, 10 Chris Woakes, 11 Jofra Archer Editorial team of CricketCountry. Новини Jan 1st New Year Updates From BlueVM It's a new year and I'd like to discuss some of the changes we're making around BlueVM to make our services better for each of our clients. Last year we didn't live up to our expectations and we're working incredibly hard to change that in the coming year. Here's a quick overview of the changes we're making: We've brought on three additional ... Читать далі » Dec 24th Happy Holidays from BlueVM! Happy Holidays from BlueVM Communications LLC! We wish you and your loved ones a Merry Christmas.We apologize for any delayed ticket response times during this holiday season. BlueVM support staff will continue to be here 24/7, but we will be a bit short staffed as we want to give the opportunity to allow our employees to spend quality time ... Читать далі »	# Live Updates ## 10:28 PM IST That’s a wrap for now, folks. We hope you enjoyed our coverage today. Until next time then, it’s goodnight! ## 10:20 PM IST Usman Khawaja misses out on a hundred, but Australia cruise to a comfortable five-wicket victory. ## 9:30 PM IST Maxwell departs for 36 to Siriwardana, but Australia are well and truly en route to victory here. 33.1 overs gone, AUS 175/3 (Khawaja 75, Stoinis 10). Australia need another 65 to win. ## 9:02 PM IST 26.2 overs gone, Australia are 137/2 (Khawaja 57, Maxwell 26) ## 8:47 PM IST WICKET! Dhananjaya de Silva breaks the dangerous Khawaja-Marsh partnership, Marsh departs for 34. AUS 104/2 in 22.1 overs. ## 8:03 PM IST No hiccups from the Aussies after the departure of their captain Aaron Finch so far. AUS 61/1 in 10.4 overs (Usman Khawaja 30, Shaun Marsh 19) ## 7:34 PM IST WICKET! DRS goes in Sri Lanka’s favour. Aaron Finch departs for 11, Nuwan Pradeep strikes early. AUS 16/1 in 4 overs. ## 7:28 PM IST TOTAL DOMINATION! England have crushed Afghanistan by 9 wickets and head into the cwc19 oozing with confidence. The hosts face South Africa on Thursday. ## 7:23 PM IST England are cruising to victory against Afghanistan, need just 7 runs to win. Australia have begun their run-chase against Sri Lanka. 2.2 overs gone, AUS 1/0. ## 6:57 PM IST 100 up for England in 10.1 overs, they need only 61 runs to win, Roy on 49, while Root’s batting on 11. ## 6:49 PM IST WICKET! After doing the job with the bat, Nabi works his mojo with the ball, ends the rampaging Roy-Bairstow partnership in an unusual fashion. Bairstow stumped, departs for 39, England 78/1 in 8.2 overs, need 83 to win. ## 6:47 PM IST Sri Lanka finish with 239/8 after 50 overs (Thirimanne 56, Dhananjaya 43; Zampa 2/39) ## 6:39 PM IST These warm-ups keep throwing up surprises. Rashid Khan bowling in the first powerplay, England 72/2 in 6.2 overs. ## 6:22 PM IST We’re back with the England run-chase, Jason Roy and Jonny Bairstow are at the crease. Roy is on strike. Hamid will open the attack. England need 161 to win. ## 5:42 PM IST Afghanistan have been bowled out for 160, Archer takes the last wicket of Nabi for 44, caught by a Bairstow juggle at the boundary. ## 5:39 PM IST WICKET! Steve Smith has just taken a wicket, takes a fine judged return catch to send Mathews on his way for 17. SL 147/5 in 33.4 overs. --- Hello and welcome to our live blog of the Cricket World Cup 2019 Match 7 and 8 between Australia and Sri Lanka and Afghanistan and England, respectively. Australia are riding on the high of defeating hosts England in their first warm-up game while Sri Lanka, after crashing to a heavy defeat against South Africa, will be looking to get some kind of momentum going for them in their second and final warm-up game. LIVE STREAMING: AUS vs SL Dream11 Prediction: SL vs AUS \| Dream11 Prediction: AFG vs ENG \| LIVE STREAMING: AFG vs ENG England will start as favorites, but England skipper Eoin Morgan, who missed out on the Australia game owing to an injury, will not be available. Jos Buttler will lead the side. Niggles to Liam Dawson and Jofra Archer are also a concern for England. ### Here is today’s Dream11 pick for AUS vs SL My Dream XI Team 1. Kusal Menids (VICE CAPTAIN) 2. Kusal Perera 3. David Warner (CAPTAIN) 4. Usman Khawaja 5. Dimuth Karunaratne 6. Steve Smith 7. Marcus Stoinis 8. Dhananjaya de Silva 9. Jason Behrendorff 10. Adam Zampa 11. Nuwan Pradeep ### Here is today’s Dream11 pick for AFG vs ENG My Dream XI Team 1. Jonny Bairstow 2. Jos Buttler (VICE-CAPTAIN) 3. Hashmatullah Shahidi 4. Hazratullah Zazai 5. Jason Roy (CAPTAIN) 6. Joe Root 7. Mohammad Nabi 8. Rashid Khan 9. Tom Curran 10. Chris Woakes 11. Jofra Archer Editorial team of CricketCountry --- # Новини ## Jan 1st New Year Updates From BlueVM It's a new year and I'd like to discuss some of the changes we're making around BlueVM to make our services better for each of our clients. Last year we didn't live up to our expectations and we're working incredibly hard to change that in the coming year. Here's a quick overview of the changes we're making: - We've brought on three additional … ## Dec 24th Happy Holidays from BlueVM! Happy Holidays from BlueVM Communications LLC! We wish you and your loved ones a Merry Christmas. We apologize for any delayed ticket response times during this holiday season. BlueVM support staff will continue to be here 24/7, but we will be a bit short staffed as we want to give our employees the opportunity to spend quality time …	1,525	1,298	-7,475,677,336,140,289,000	concat	[ "concat_full" ]	0.75	true	null
-2,940,963,909,664,896,500	Italiano English San Leo Official Facebook page San Leo Official Twitter profile San Leo Official Flickr page San Leo Official YouTube channel San Leo Official Instagram profile • San Leo official website • The Bandiera Arancione award • Borghi più belli d'Italia • The most beautiful villages in Italy association (I Borghi più belli d'Italia) San Leo Territory The city of San Leo can be reached, going up from the Adriatic coast, along the State Road Marecchiese 258 that from Rimini, along the river Marecchia, leads to Tuscany. Territory The city of San Leo can be reached, rising from the Adriatic coast, along the Highway 258 that Marecchiese from Rimini, along the river Marecchia, leads in Tuscany. After 20 kilometers, the height of Pietracuta, the most populated town of the Municipality of San Leo, the road deviates from the traveler Marecchiese to the hills leading to the San Leo boulder. The traveler who instead reach San Leo from the geographical heart of the Montefeltro, along the provincial road that from the height of the Passo San Marco (986 m above sea level), slips for 10 km through Villagrande of Montecopiolo to San Leo, in a striking crowned views the scenic backdrop formed by the majestic Mount Titano (San Marino republic). HOW TO GET THERE By car: A 14 motorway, Rimini North exit towards Santarcangelo di Romagna, follow SS 258 at the height of Pietracuta and signs for San Leo. Since Montefeltro must instead travel the road that from the height of the Passo San Marco (986 m) slips for about 10 kilometers through Villagrande of Montecopiolo, to San Leo. By plane: International Airport of Rimini "Federico Fellini". By train: Rimini Station. By bus: AM Mobility Agency and Benedettini Corrado. For more information visit also: - International Airport "Federico Fellini" - Ferrovie dello Stato - Rimini AM KNOW THE VALLEY OF THE HINTERLAND OF RIMINI Visit the website www.lavalmarecchia.it door of tourism in the hinterland of Rimini Montefeltro The Montefeltro area is a sub-region scattered between Emilia-Romagna and Tuscany. It covers an extensive tract of land from the hills of the Central Apennines to the Adriatic Coast. Valmarecchia Valmarecchia The Comunità Montana Alta Valmarecchia is a local governing body associating the mountain municipalities of Casteldelci, Maiolo, Novafeltria, Pennabilli, San Leo, Sant'Agata Feltria and Talamello. Geology Geology San Leo rises on a rhomboidal limestone and sandstone rock of about 480.000 square metres. The highest point is the southeastern portion of the rock, which then progressively lowers on the western side. Flora Flora With its spontaneous plants and lush vegetation, the Montefeltro area is one of the richest wildlife habitats. Fauna Fauna The rich fauna thriving in the nearby natural park Sasso Simone e Simoncello can also be found in the woods of the Montefeltro area. Animals silently roam its trails and paths, its village and town roads. They are scared of human beings and only show themselves to those who respect nature and look at it attentively, eager to penetrate its secrets. Search for San Leo: Gallery • How to reach San Leo, in Italy Getting here San Leo lies in Rimini's hinterland, in southern Emilia Romagna, on the border of Tuscany, Le Marche Region and the Republic of San Marino. Look at the map » Wood Trim Ideas.Advice Needed On Decorating 4x4 Support Posts . New Construction Eagle Cliff Construction LLC. Wider Beadboard Backsplash HERE IS THE WIDE BEABOARD - Home Improvement Gallery Home Improvement Gallery Wood-trim-ideas, my recent story on unwanted old china generated a lot of responses so many that i thought it was worth sharing some of the. Sometimes even the best joinery skills don't make a project look finished if your bookcase is lacking the detail you want you can use wood trim to dress it up cover a seam or help it match the, bring in wood trim by using wood trim to create architectural interest photo by beckwith interiors more contemporary living room ideas 8 mix it up employing a bevy of design tricks this. But period appropriate stained glass wood trim and a restored cast iron claw foot tub add homes are designed to retain as much heat and energy as possible 25 storage ideas to help you get, the obama foundation hosted a dinner discussion featuring giridharadas's ideas and he has spoken at google "before anand. Black metal on the sconces window trim the focus on the wood elements like the sliding barn doors this country kitsch, wood trim takes projects from boring to exciting with all the varieties species profiles and sizes there's wood trim for just about anything you can imagine it's simple enough to make in your own. If you are furiously seeking a "buy" link you can give up now - there's only one of these because ford isn't a crazy company that likes throwing money away on outlier ideas design exercise the, pose in the driver's seat of a skid steer loader and watch a laser cutter trim wood the event hosted by the construction. As the month progresses mr and mrs bones embrace the extreme with activities that help them keep those trim physiques, trim studio designed the house for a newlywed couple who wanted a house that was no more than 100 square feet and 16 feet tall but had all the typical amenities of a full sized home that means a. Try a wood plank backsplash if you're looking for a way photo by id 810 design group discover living room design ideas 12 show off your trim if you're looking for a statement wall treatment	# San Leo ## Official Profiles - San Leo Official Facebook page - San Leo Official Twitter profile - San Leo Official Flickr page - San Leo Official YouTube channel - San Leo Official Instagram profile - San Leo official website ## Awards & Associations - The Bandiera Arancione award - Borghi più belli d’Italia - The most beautiful villages in Italy association (I Borghi più belli d’Italia) --- ## Territory The city of San Leo can be reached, going up from the Adriatic coast, along the State Road Marecchiese 258 that from Rimini, along the river Marecchia, leads to Tuscany. After 20 kilometers, at the height of Pietracuta (the most populated town of the Municipality of San Leo), the road deviates from the Marecchiese valley into the hills leading to the San Leo rock. Travelers coming from the geographical heart of the Montefeltro follow the provincial road from the Passo San Marco (986 m a.s.l.), which winds for 10 km through Villagrande di Montecopiolo to San Leo, offering striking views of Mount Titano (Republic of San Marino). --- ## How to Get There - By car A 14 motorway, Rimini Nord exit towards Santarcangelo di Romagna; follow SS 258 to Pietracuta and signs for San Leo. From Montefeltro, take the road from Passo San Marco (986 m) through Villagrande di Montecopiolo (about 10 km). - By plane International Airport of Rimini “Federico Fellini” - By train Rimini Station - By bus AM Mobility Agency and Benedettini Corrado For more information, visit: - International Airport “Federico Fellini” - Ferrovie dello Stato - Rimini AM --- ## Know the Valley of the Hinterland of Rimini Visit the website: www.lavalmarecchia.it (door of tourism in the hinterland of Rimini) --- ## Montefeltro The Montefeltro area is a sub-region scattered between Emilia-Romagna and Tuscany. It covers an extensive tract of land from the hills of the Central Apennines to the Adriatic Coast. ## Valmarecchia The Comunità Montana Alta Valmarecchia is a local governing body associating the mountain municipalities of Casteldelci, Maiolo, Novafeltria, Pennabilli, San Leo, Sant’Agata Feltria, and Talamello. ## Geology San Leo rises on a rhomboidal limestone and sandstone rock of about 480 000 m². The highest point is the southeastern portion of the rock, which progressively lowers toward the western side. ## Flora With its spontaneous plants and lush vegetation, the Montefeltro area is one of the richest wildlife habitats. ## Fauna The rich fauna thriving in the nearby natural park Sasso Simone e Simoncello can also be found in the woods of the Montefeltro area. Animals silently roam its trails and paths, its village and town roads. They are wary of humans and only show themselves to those who respect nature and observe attentively. --- ## Gallery - How to reach San Leo, in Italy San Leo lies in Rimini’s hinterland, in southern Emilia-Romagna, on the border of Tuscany, Le Marche, and the Republic of San Marino. Look at the map » --- --- # Wood Trim Ideas ## Advice Needed On Decorating 4×4 Support Posts ## New Construction Eagle Cliff Construction LLC ## Wider Beadboard Backsplash Home Improvement Gallery - “Sometimes even the best joinery skills don't make a project look finished if your bookcase is lacking the detail you want—you can use wood trim to dress it up, cover a seam or help it match the…” - “Bring in wood trim by using wood trim to create architectural interest.” Photo by Beckwith Interiors - More contemporary living room ideas: mix it up employing a bevy of design tricks. - Try a wood plank backsplash if you're looking for a way… Photo by ID 810 Design Group - Show off your trim if you're looking for a statement wall treatment.	1,220	887	-2,940,963,909,664,896,500	concat	[ "concat_full" ]	0.75	true	null
-4,230,923,051,953,079,300	Please note: Over-the-air viewers in Milwaukee need to re-scan televisions on Friday, October 18 to continue to receive CBS58, WMLW, MeTV, Telemundo Wisconsin, Heroes & Icons, Bounce, Decades, Start TV, Movies! and most other local channels. Those viewers unable to currently receive these stations over-the-air should see improved reception on October 18. Cable and satellite viewers are not impacted. Further information on the re-scan can be found at: https://www.cbs58.com/rescan Tip Line: 414-777-5808 \| [email protected] Racine man charged after punching neighbor in face during fight over snow-blowing RACINE, Wis. (CBS 58) -- Racine Police were dispatched to a home in the 2400 block of 20th Street for a report of an assault. It happened on Sunday afternoon. Upon arrival, officers met with the victim who said he was snow blowing his property and his neighbor's property because he was out of town. The victim said while he was doing that, the suspect accused him of purposefully blowing snow onto the street. The victim said it was an accident and cleaned up the snow on the street. The victim said the suspect then came onto his property and said he was blowing snow onto the parkway. The victim told police that the suspect then punched him three times, causing pain. Police observed dried blood and lacerations to the victim's lower lip. Police met with the suspect who admitted to getting into an argument with the victim over snow blowing but denied that he punched him in the face. Share this article: Save with Are you sure you want to delete this comment? Close 0 Comments Post a comment Be the first to leave a comment! Are you sure you want to delete this comment? Play Next Crave more? Click "PlayNext" to check a similar track. Dismiss tour Got it! quiero que me odies 0 Add to Share Preview is not available You need to upgrade your Adobe Flash Player Preview is not available Enable preview We notice you have AdBlock installed. This prevents you from using all features on 4shared. Please consider whitelisting us in AdBlock. 00:00 / 00:00 quiero que me odies.mp3 0/1 tracks Share playlist Add to account quiero que me odies quiero que me odies.mp3 Report abuse ingrid S. 4 years ago File type mp3 Size 2,520 KB Bit rate 96 kbps quiero que me odies - download at 4shared. quiero que me odies is hosted at free file sharing service 4shared. More Less Download Checked by McAfee. No virus detected. McAfee detected a threat in this file. x Remove Ads Explore x Remove Ads Show more Discuss 0 comments Add new comment Submit Cancel 500 characters left Previous 1 1 Next Add to account Add to playlist New playlist Is owner View only Upload & Edit	## Over-the-Air Rescan Notice (Milwaukee) Please note: Over-the-air viewers in Milwaukee need to re-scan televisions on Friday, October 18 to continue to receive: - CBS58 - WMLW - MeTV - Telemundo Wisconsin - Heroes & Icons - Bounce - Decades - Start TV - Movies! - Most other local channels Those viewers unable to currently receive these stations over-the-air should see improved reception on October 18. Cable and satellite viewers are not impacted. Further information on the re-scan can be found at: https://www.cbs58.com/rescan Tip Line: 414-777-5808 \| [email protected] --- ## Racine Man Charged After Punching Neighbor in Face During Fight Over Snow-Blowing RACINE, Wis. (CBS 58) – Racine Police were dispatched to a home in the 2400 block of 20th Street for a report of an assault. It happened on Sunday afternoon. > “I was snow blowing my property and my neighbor’s property because I was out of town. While I was doing that, the suspect accused me of purposefully blowing snow onto the street,” the victim told officers. “It was an accident and I cleaned up the snow on the street.” The victim said the suspect then came onto his property and accused him of blowing snow onto the parkway. The suspect allegedly punched him three times, causing pain. Police observed dried blood and lacerations to the victim’s lower lip. Police met with the suspect, who admitted to getting into an argument with the victim over snow blowing but denied that he punched him in the face. --- # quiero que me odies.mp3 Hosted on 4shared Uploaded by ingrid S. (4 years ago) File details - Type: mp3 - Size: 2,520 KB - Bit rate: 96 kbps Security scan - Checked by McAfee: No virus detected [Download “quiero que me odies.mp3”](https://www.4shared.com)	662	444	-4,230,923,051,953,079,300	concat	[ "concat_full" ]	0.75	true	null
-4,337,908,741,140,474,000	7.1/10 8 Generation Wired Nineties alternative culture goes mainstream as the Wired Generation (Generation X) embraces grunge music, gourmet coffee, and the sleek digital gadgets of the future. Director: Harry Hewland Photos Add Image Add an image Do you have any images for this title? Edit Cast Episode credited cast: Huey Morgan Huey Morgan ... Himself - Narrator Rest of cast listed alphabetically: Jennifer Aniston ... Herself (archive footage) Bob Batchelor Bob Batchelor ... Himself - Historian Timothy Busfield ... Himself Bill Clinton ... (archive footage) Kurt Cobain ... (archive footage) Douglas Coupland Douglas Coupland ... Himself - Author: 'Generation X' David Crane ... Himself - Creator, 'Friends' Robert X. Cringely ... Himself - Technology Journalist Brad Edmonson Brad Edmonson ... Himself - Author Geoffrey Fowler Geoffrey Fowler ... Himself - The Washington Post Bill Gates ... (archive footage) Al Gore ... (archive footage) Erin Griffith Erin Griffith ... Herself - Wired Magazine Walter Isaacson ... Himself - Steve Job's Biographer Edit Storyline Nineties alternative culture goes mainstream as the Wired Generation (Generation X) embraces grunge music, gourmet coffee, and the sleek digital gadgets of the future. Plot Summary \| Add Synopsis Genres: Documentary Certificate: TV-PG Edit Details Release Date: 24 September 2018 (USA) See more » Company Credits Production Co: Nutopia See more » Show more on IMDbPro » Technical Specs Runtime: See full technical specs » Edit Did You Know? Connections Features Friends (1994) See more » Frequently Asked Questions This FAQ is empty. Add the first question. User Reviews Contribute to This Page Free Movies and TV Shows You Can Watch Now On IMDb TV, you can catch Hollywood hits and popular TV series at no cost. Select any poster below to play the movie, totally free! Browse free movies and TV series Stream Trending TV Series With Prime Video Explore popular and recently added TV series available to stream now with Prime Video. Start your free trial Recently Viewed Home > By Manufacturer > Takom > TAK02039 1:35 Takom Chieftain Marksman SPAAG TAK02039 1:35 Takom Chieftain Marksman SPAAG MSRP $54.00 Our Price: $43.99 Savings: $10.01 Scale: 1/35 Stock Status:In Stock Product Code: TAK02039 Qty: Description - Individual tracks - 5 types of markings - PE and clear parts included - All hatches can be built in open or closed position	# Generation Wired Rating: 7.1/10 Director: Harry Hewland --- ## Synopsis Nineties alternative culture goes mainstream as the Wired Generation (Generation X) embraces grunge music, gourmet coffee, and the sleek digital gadgets of the future. --- ## Cast - Huey Morgan … Himself – Narrator - Jennifer Aniston … Herself (archive footage) - Bob Batchelor … Himself – Historian - Timothy Busfield … Himself - Bill Clinton … (archive footage) - Kurt Cobain … (archive footage) - Douglas Coupland … Himself – Author: “Generation X” - David Crane … Himself – Creator, “Friends” - Robert X. Cringely … Himself – Technology Journalist - Brad Edmonson … Himself – Author - Geoffrey Fowler … Himself – The Washington Post - Bill Gates … (archive footage) - Al Gore … (archive footage) - Erin Griffith … Herself – Wired Magazine - Walter Isaacson … Himself – Steve Jobs’s Biographer --- ## Details - Genre: Documentary - Certificate: TV-PG - Release Date: 24 September 2018 (USA) - Production Company: Nutopia --- --- # TAK02039 1:35 Takom Chieftain Marksman SPAAG MSRP: $54.00 Our Price: $43.99 Savings: $10.01 Scale: 1/35 Stock Status: In Stock Product Code: TAK02039 ## Description - Individual tracks - 5 types of markings - PE and clear parts included - All hatches can be built in open or closed position	584	398	-4,337,908,741,140,474,000	concat	[ "concat_full" ]	0.75	true	null
8,614,589,244,957,449,000	CML patients on imatinib have similar mortality rates to general population Tuesday, March 22, 2011 - 16:00 in Health & Medicine Patients taking imatinib (Gleevec) for CML, or chronic myelogenous leukemia, and in remission after two years of treatment, have a mortality rate similar to that of the general population according to a study published online [date] in the Journal of the National Cancer Institute. Read the whole article on Physorg More from Physorg Latest Science Newsletter Get the latest and most popular science news articles of the week in your Inbox! It's free! Check out our next project, Biology.Net Swimsuits For All Black Friday 2019 Sale & Deals Table of Contents 2019: You probably have other things on your mind this November than shopping for a new bikini (probably along the lines of a new winter jacket or new snow boots). But with 45% off site-wide expected at Swimsuits for All on Black Friday, you may want to reconsider it. While it’s still too early to have the “official” details, if this upcoming Thanksgiving weekend sale at Swimsuits for All will be anything like last year’s sale then you can expect to see them offer some of the best deals of the year. You can scroll down the page to see last year’s Black Friday ad to get an idea of what’s to come. We are watching all of the latest developments and will be posting the updates right here on as soon as we know more. Check back soon or join our newsletter to stay informed. Until then, be sure to take a moment to visit swimsuitsforall.com for a full list of their current pre-Thanksgiving day offers, including up to 70% off available now in their clearance section. You can also sign up to their email list the be included in any upcoming exclusive member-only sales. Comments What new swimsuit has caught your eye? Let us know what you’re planning on getting this coming Thanksgiving weekend in the comments (the comments section can be found at the very bottom of this page). 2018: Updated on Wednesday November 21, 2018: We just received the details on what’s coming at Swimsuits For All’s Black Friday sale this year. Here’s what’s coming: • Get 45% OFF sitewide and shipping is $4.98 with coupon code 18EABF. Offer runs from November 21-25, 2018 at 11:59PM EST! • Get 45% OFF sitewide and FREE SHIPPING with coupon code 18BLKFRDY – Offer available only on November 23, 2018. • Get 45% OFF sitewide and shipping is $4.98 with coupon code 18BFE. Offer available November 24-25, 2018. • Get 50% OFF sitewide and FREE SHIPPING with coupon code 18CM. Offer available only on November 26, 2018 (that’s Cyber Monday!). Have a nice Thanksgiving weekend and good luck bargain hunting all the deals out there! History Are you interested in seeing some of Swimsuits for All’s older Black Friday ads? Then you’ve come to the right place! Follow the links below to view the last few years of ad history. • 2017: Page 1. • 2016: Page 1 and 2. • 2015: Page 1, 2 and 3. Leave a Reply	# CML patients on imatinib have similar mortality rates to general population Tuesday, March 22, 2011 – 16:00 in Health & Medicine Patients taking imatinib (Gleevec) for CML, or chronic myelogenous leukemia, and in remission after two years of treatment, have a mortality rate similar to that of the general population according to a study published online [date] in the Journal of the National Cancer Institute. --- # Swimsuits For All Black Friday 2019 Sale & Deals ## 2019 You probably have other things on your mind this November than shopping for a new bikini (probably along the lines of a new winter jacket or new snow boots). But with 45% off site-wide expected at Swimsuits for All on Black Friday, you may want to reconsider it. While it’s still too early to have the “official” details, if this upcoming Thanksgiving weekend sale at Swimsuits for All will be anything like last year’s sale then you can expect to see them offer some of the best deals of the year. You can scroll down the page to see last year’s Black Friday ad to get an idea of what’s to come. We are watching all of the latest developments and will be posting the updates right here as soon as we know more. Check back soon or join our newsletter to stay informed. Until then, be sure to take a moment to visit swimsuitsforall.com for a full list of their current pre-Thanksgiving day offers, including up to 70% off available now in their clearance section. You can also sign up to their email list to be included in any upcoming exclusive member-only sales. ## 2018 Updated on Wednesday November 21, 2018: We just received the details on what’s coming at Swimsuits For All’s Black Friday sale this year. Here’s what’s coming: - Get 45% OFF sitewide and shipping is $4.98 with coupon code 18EABF. Offer runs from November 21–25, 2018 at 11:59 PM EST! - Get 45% OFF sitewide and FREE SHIPPING with coupon code 18BLKFRDY – Offer available only on November 23, 2018. - Get 45% OFF sitewide and shipping is $4.98 with coupon code 18BFE. Offer available November 24–25, 2018. - Get 50% OFF sitewide and FREE SHIPPING with coupon code 18CM. Offer available only on November 26, 2018 (that’s Cyber Monday!). Have a nice Thanksgiving weekend and good luck bargain hunting all the deals out there! ## History Are you interested in seeing some of Swimsuits for All’s older Black Friday ads? Then you’ve come to the right place! - 2017: Page 1 - 2016: Page 1 and 2 - 2015: Page 1, 2 and 3	718	625	8,614,589,244,957,449,000	concat	[ "concat_full" ]	0.75	true	null
-5,445,764,716,247,442,000	Skip to main content The Power of 'AND' I have been fortunate to be helping two startups over the past few months. I think both of these startups have a great chance because they are combining two disparate things into a new service or product. One thing that I have noticed about successful companies (both startups and giants), is that those which tend to be successful employ the “Power of ‘AND’.” This means they take traditionally mutually exclusive characteristics and then combine them into a new and novel way. Examples include Southwest Airlines (low cost fares with on-time, high quality service), Wal-Mart (low prices with large selection), and Apple (high technology with high styling) to name a few. That is not to say that companies that do not use the 'power of and' are not successful, it just seems like the odds for success tend to tilt towards people and companies who can pull this feat off. Ronald Reagan was able to combine a forceful, “hawkish” leadership, with the everyman personal touch. So much so that he was framed as the “Great Communicator.” George W. Bush’s team understood this when he came out with the “Compassionate Conservative.” He was saying that he was trying to open the tent to everyone. Now, saying one thing and doing another will get you an approval rating in the high 20’s, so be sure you walk the talk. But still, if you can pull it off, look at how you can combine things like: Feature Rich and Simple to Use Low Power and High Performance Light Weight and Solid Build High Performance and Great Fuel Efficiency High Style and Value Pricing Rugged and Stylish You may ask is there any imperial evidence that the 'power of and' can help me or my company? Well, in Richard Tanner Pascale’s Managing on the Edge, a study was conducted involving 43 highlighted companies in the book In Search of Excellence five years after the original research was conducted. Pascale discovered that 14 companies retained their “Excellent” rating while 29 did not. His conclusion to the key factor that distinguished the 14 from the 29 was that they managed the 'power of and' better in what he called “managing contention.” In Built to Last, Jim Collins and Jerry Porras call it “The Genius of the ‘AND’.” Use of the 'power of and' existed in 18 “Silver” companies that outperformed the stock market from 1926 to 1990 by a factor of 2, and in 18 “Gold” companies that outperformed the stock market during that same period by a factor of 15! In Collins’ next book, Good to Great, elements common to all of the 11 selected companies are described in terms of the “AND” they manage either explicitly or intuitively. So the Power of AND can not only help you create a better product or service but a more profitable future as well. The question is...how can you harness that power for yourself and those you work with? Comments NY2TX said… Product and/or technical differentiation is clearly an enabling factor in the success or not of a start-up (or past start-up) company. Interestingly, just this evening one of my management team and I discussed the fact that despite the passage of time, we still had a perceived advantage in both of our technology clusters. What is our "and" factor? I'm not sure, but the nature of technology transfer is taking a technology from one market or area and applying it to another...T2 is also the leveraging of R&D and turning it into a new product. So, I guess in that light, our "and" lies in the federal laboratory origins of our technologies and the unique management approach we've taken to bring the effort to its current state. It has just taken wa-y-y-y too long to get here, and yet, the market has not run away from us. Kept Up said… You actually might be AHEAD of your time. Look for my next blog on "timeliness" to market (not time to market). Keep up the good fight! NY2TX said… I've been told that one of my greatest strengths is also one of my weaknesses. If an entrepreneur has vision that is too early, then the entrepreneur either has to outlast the waiting period (for the market to catch up), or die on the vine for lack of funding and credibility. Kept Up said… You are absolute prescient on that matter. Popular posts from this blog Myers-Briggs and Social Media If you have been working for any amount of time, you have most likely have taken the Myer-Briggs personality indicators (introvert v. extrovert; sensing v. intuition; thinking v feeling; and perceiving v. judging). Here is an infographic created my mbti that has been broken into five sections. It is pretty informative and goes on to show what types of indicators prefer which types of social media. Myers-Briggs Type The about graphic describes the various characteristics of the Myers-Briggs personality types and how they would be inclined to use social media. There are 4 types that can combined to create 16 "personalities." To enlarge picture, just click on the image. Do You Use Facebook This is an graphic on how your particular personality type would use Facebook. It seems like extraverts and intuitive individuals prefer using Facebook. Social Media Use at Work This graphic explores how different types use social media and the web at work and their predisposition to share i… Lupercalia and St. Valentine's Day OK, I just could not resist this: Romance, sex, orgies, wolves, and martyrdom all under one legend. Oh my, what a day we have!!! We might celebrate romance and sweethearts on this day, but boy, the Romans really knew how to party. While history is fun, it is also interesting to know how some things never change (like falling in love and celebrating it!). Happy St. Valentine’s and Lupercalia. May you celebrate it at your heart’s content with someone who has stolen or whom you have given your heart away! Lupercalia is uniquely Roman. It harkens back to the days when Rome was nothing more than a few shepherds living on a hill known as Palantine and was surrounded by wilderness teeming with wolves. The name comes from lupus, or the latin form of wolf, that celebrates the founding of Rome by Romulus and Remus (as they were suckled by a she-wolf). Another thought is that Lupercus, protector of flocks against wolves, is a likely candidate for the name. In any case, there is no question abou… Men v. Boys I have been reading a lot of articles of late about relationships and seeing some that put men into groups without understanding that men are NOT all alike. By lumping all men together, the concept of being a gentleman does not come into play. Women, and people in general, have to realize that there are men of character, culture and grace, and then there are boys. Boys are men who have chosen not to grow up and become wise in the ways of civility, charm, and substance. This post highlights the differences between men and boys. Ladies, which are you dating? Men, whom are you? \| Current local time in Shanghu, China 8:57 :46 AM 08:57 :46 Friday, October 18, 2019 (CST) Convert Shanghu Time Want to convert Shanghu time to different time zone? Our CST Time Zone Converter will help you find and compare Shanghu time to any time zone or city around the world. Additionally you can select one of our popular time converters, allowing convert Shanghu CST timezone to GMT, PST, EST, CET, PDT, CST, EDT, IST, BST, CEST timezones. Shanghu Information Time Zone Abbreviation / Name CST - China Standard Time UTC / GMT Offset +8:00 hours during China Standard Time, currently in use. Shanghu Facts Country China Alternative Names Shanghu, Shanghu Xiang, Shanghuxu, shang hu, shang hu xiang, 上湖, 上湖乡 Currency Yuan Renminbi (CNY) Geographic Coordinates 28° 20' N Latitude / 115° 19' E Longitude International Dialing Code +86	# The Power of ‘AND’ I have been fortunate to be helping two startups over the past few months. I think both of these startups have a great chance because they are combining two disparate things into a new service or product. One thing that I have noticed about successful companies (both startups and giants), is that those which tend to be successful employ the “Power of ‘AND’.” This means they take traditionally mutually exclusive characteristics and then combine them into a new and novel way. Examples include: - Southwest Airlines (low cost fares with on-time, high quality service) - Wal-Mart (low prices with large selection) - Apple (high technology with high styling) That is not to say that companies that do not use the ‘power of and’ are not successful, it just seems like the odds for success tend to tilt towards people and companies who can pull this feat off. Ronald Reagan was able to combine a forceful, “hawkish” leadership, with the everyman personal touch. So much so that he was framed as the “Great Communicator.” George W. Bush’s team understood this when he came out with the “Compassionate Conservative.” He was saying that he was trying to open the tent to everyone. Now, saying one thing and doing another will get you an approval rating in the high 20’s, so be sure you walk the talk. But still, if you can pull it off, look at how you can combine things like: - Feature Rich and Simple to Use - Low Power and High Performance - Light Weight and Solid Build - High Performance and Great Fuel Efficiency - High Style and Value Pricing - Rugged and Stylish You may ask is there any empirical evidence that the ‘power of and’ can help me or my company? Well, in Richard Tanner Pascale’s _Managing on the Edge_, a study was conducted involving 43 highlighted companies in the book _In Search of Excellence_ five years after the original research was conducted. Pascale discovered that 14 companies retained their “Excellent” rating while 29 did not. His conclusion to the key factor that distinguished the 14 from the 29 was that they managed the ‘power of and’ better in what he called “managing contention.” In _Built to Last_, Jim Collins and Jerry Porras call it “The Genius of the ‘AND’.” Use of the ‘power of and’ existed in 18 “Silver” companies that outperformed the stock market from 1926 to 1990 by a factor of 2, and in 18 “Gold” companies that outperformed the stock market during that same period by a factor of 15! In Collins’ next book, _Good to Great_, elements common to all of the 11 selected companies are described in terms of the “AND” they manage either explicitly or intuitively. So the Power of AND can not only help you create a better product or service but a more profitable future as well. The question is… how can you harness that power for yourself and those you work with? --- # Current Local Time in Shanghu, China - 8:57:46 AM, Friday, October 18, 2019 (CST) # Shanghu Information ## Time Zone - Abbreviation / Name: CST – China Standard Time - UTC / GMT Offset: +8:00 hours ## Shanghu Facts - Country: China - Alternative Names: Shanghu, Shanghu Xiang, Shanghuxu, shang hu, shang hu xiang, 上湖, 上湖乡 - Currency: Yuan Renminbi (CNY) - Geographic Coordinates: 28° 20′ N, 115° 19′ E - International Dialing Code: +86	1,748	783	-5,445,764,716,247,442,000	concat	[ "concat_full" ]	0.75	true	null
4,480,752,665,430,057,500	outdoor waterproof pvc panelling Switzerland best pvc fence panel for in uk,Birmingham, open… pvc fence rails,light weight pvc decking,pvc fence panels 6 foot ..... outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale in south africa...Online Message The 25+ best ideas about Waterproof Paneling on Pinterest… Waterproof PVC Beadboard Planks (For use in bathroom above shower and tub ..... outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale...Online Message Waterproof Paneling on Pinterest… Waterproof PVC Beadboard Planks (For use in bathroom above shower and ...... outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale in...Online Message exterior wood plastic handrails for Artificial… WPC railing, outdoor fencing, cheap railing , fencing selling, waterproof fence ...... outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale in...Online Message pvc panels \| companies - Europages Find and request a quote for pvc panels from companies that specialise in ... Supplier of: pvc panels \| pvc door panels \| pvc doors \| Exterior doors for houses \| door panels .... Waterproof (dampproof): Resistance to weather/. .... Wer liefert was (wlw) is the leading online B2B marketplace in Germany, Austria and Switzerland.Online Message Dumaplast: Sustainable PVC wall cladding - wall… Dumaplast is a leading manufacturer of PVC wall cladding, ceiling cladding, waterproof flooring, outside wall cladding and much more.Online Message Swisspearl HEADQUARTER SWITZERLAND ... Swisspearl? fiber cement panels are manufactured with low energy and a high level of environmental awareness.Online Message PVC Panels - PVC Panel Exporter from New… Exporter of PVC Panels - PVC Panel, PVC Ceiling Panels, PVC Cladding Material and PVC Panels and Profiles offered by A. D. Global Synergies Pvt. Ltd., New...Online Message Products Case Previous:deck prices per square foot calculator Next:3d decorative panels cape town Saturday , October 19th 2019 Shut Eye \| Natural Herbal Sleep Aid \| 60 Non-Habit Forming Veggie Capsules \| Herbal Sleeping Complex Made with Valerian Root, Melatonin, Chamomile, Magnesium \| Anxiety Relief \| Adult Sleeping Pills Product Features: SLEEP WELL, WAKE UP REVITALIZEDIf you're feeling tired and seeking better sleep, then it's time to get some Shut Eye! A natural, maximum strength and non-habit forming herbal sleep aid, Shut Eye is designed to re-balance your overtaxed system for restful sleep.Expertly crafted by a renowned neurologist who set… Price as on: 2018-09-05 19:18:37 26.3 26.3 Product Description SLEEP WELL, WAKE UP REVITALIZED If you’re feeling tired and seeking better sleep, then it’s time to get some Shut Eye! A natural, maximum strength and non-habit forming herbal sleep aid, Shut Eye is designed to re-balance your overtaxed system for restful sleep. Expertly crafted by a renowned neurologist who set out to improve deeper sleep for all, Shut Eye promotes relaxation, healthier sleeping patterns and reduces anxiety. BENEFITS OF KEY INGREDIENTS 1. L-THEANINE – Proven to promote relaxation, reduce stress, and improve sleep 2. GABA – one of your body’s primary neurotransmitters and acts to calm your central nervous system (CNS). Effective in natural treatment for depression, anxiety, insomnia, and addiction 3. MELATONIN – The sleep hormone that signals to your entire body to shut down, and drift into deep dreamless sleep 4. 5-HTP – The precursor to serotonin and melatonin, it gives your body the raw material to help reset your sleep cycle 5. MAGNESIUM – A critical mineral that helps your body unwind and let go of any body tension keeping you up at night 6. VALERIAN ROOT – valerian reduces the time it takes to fall asleep and improves the quality of sleep. By reducing anxiety and improving the length and quality of sleep, it can significantly help with daily stress management. 7. CHAMOMILE – a medicinal herb for fighting stress and promoting relaxation. It is also known to be a natural remedy for anxiety and general depression. 8. PASSION FLOWER EXTRACT – An herbal sedative, stress reducer, and sleep aid. Product Features • SLEEP WELL, WAKE UP REVITALIZED \| If you’re feeling tired and seeking better sleep, then it’s time to get some Shut Eye! An all-natural, maximum strength and non-habit forming herbal sleep aid, Shut Eye is designed to re-balance your overtaxed system for restful sleep. Expertly crafted by a renowned neurologist who set out to improve deeper sleep for all. You’ll wake up feeling refreshed and energized without the groggy side effect associated with other sleep aids. • SLEEP DEEPER, LONGER, and WAKE UP REFRESHED \| No more restless tossing and turning. No more spinning thoughts. Shut Eye eases tension, helping you get to sleep and stay asleep so you can wake up rested, recharged, and finally feeling like yourself again. • A BOOST OF SOOTHING MAGNESIUM, L-THEANINE & MORE \| L-Theanine is an amino acid found in green tea; GABA is a neurotransmitter produced by the body. They both help the brain to down-regulate feelings of worry and create states of relaxation, which may make it easier to fall asleep and extend the duration of deep sleep. Magnesium, also known as the ‘relaxation mineral’, aids in calming your mind and muscles • MADE IN THE U.S.A. \| in an FDA-Registered facility. This product is GMP (Good Manufacturing Practice)-certified to assure the highest quality and purity. • GOOD NIGHT’S SLEEP, GUARANTEED: Our commitment is simple: We are so confident that you will experience the immediate benefits of Shut-Eye that we offer a 30-day, money-back guarantee, no questions asked. Just return the bottle and the unused contents and we will refund the entire purchase price. Now that’s a promise worth dreaming about!	# outdoor waterproof pvc panelling Switzerland - best pvc fence panel for in uk,Birmingham, open… - pvc fence rails,light weight pvc decking,pvc fence panels 6 foot - outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale in south africa # The 25+ best ideas about Waterproof Paneling on Pinterest… - Waterproof PVC Beadboard Planks (For use in bathroom above shower and tub) - outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale # Waterproof Paneling on Pinterest… - Waterproof PVC Beadboard Planks (For use in bathroom above shower and) - outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale # exterior wood plastic handrails for Artificial… - WPC railing, outdoor fencing, cheap railing , fencing selling, waterproof fence - outdoor waterproof pvc panelling Switzerland, pvc decking materials for sale # pvc panels \| companies – Europages Find and request a quote for pvc panels from companies that specialise in ... Supplier of: - pvc panels - pvc door panels - pvc doors - Exterior doors for houses - door panels Waterproof (dampproof): Resistance to weather/. Wer liefert was (wlw) is the leading online B2B marketplace in Germany, Austria and Switzerland. # Dumaplast: Sustainable PVC wall cladding – wall… Dumaplast is a leading manufacturer of PVC wall cladding, ceiling cladding, waterproof flooring, outside wall cladding and much more. # Swisspearl HEADQUARTER SWITZERLAND Swisspearl? fiber cement panels are manufactured with low energy and a high level of environmental awareness. # PVC Panels – PVC Panel Exporter from New… Exporter of PVC Panels – PVC Panel, PVC Ceiling Panels, PVC Cladding Material and PVC Panels and Profiles offered by A. D. Global Synergies Pvt. Ltd., New… --- # Shut Eye \| Natural Herbal Sleep Aid 60 Non-Habit Forming Veggie Capsules Herbal sleeping complex made with Valerian Root, Melatonin, Chamomile, Magnesium · Anxiety Relief · Adult Sleeping Pills --- ## Product Description Sleep Well, Wake Up Revitalized If you’re feeling tired and seeking better sleep, then it’s time to get some Shut Eye! A natural, maximum-strength, non-habit-forming herbal sleep aid, Shut Eye is designed to re-balance your overtaxed system for restful sleep. Expertly crafted by a renowned neurologist, it promotes relaxation, healthier sleeping patterns, and reduces anxiety. --- ## Benefits of Key Ingredients 1. L-Theanine – Promotes relaxation, reduces stress, and improves sleep. 2. GABA – Calms the central nervous system; effective for depression, anxiety, insomnia, and addiction. 3. Melatonin – The sleep hormone that signals your body to drift into deep, dreamless sleep. 4. 5-HTP – Precursor to serotonin and melatonin; helps reset your sleep cycle. 5. Magnesium – Critical mineral that unwinds body tension and aids restful sleep. 6. Valerian Root – Reduces time to fall asleep and improves sleep quality; assists with stress management. 7. Chamomile – Fights stress and promotes relaxation; natural remedy for anxiety and mild depression. 8. Passion Flower Extract – Herbal sedative, stress reducer, and sleep aid. --- ## Product Features - Sleep Well, Wake Up Revitalized All-natural, maximum strength, non-habit forming. Re-balances your system for restorative sleep without grogginess. - Sleep Deeper, Longer, and Wake Up Refreshed Eases tension to help you fall asleep and stay asleep, so you wake up rested and recharged. - Boost of Soothing Magnesium, L-Theanine & More Supports relaxation and deep sleep by calming the mind and muscles and down-regulating worry. - Made in the U.S.A. Manufactured in an FDA-registered, GMP-certified facility to ensure the highest quality and purity. - Good Night’s Sleep, Guaranteed 30-day money-back guarantee, no questions asked. Return the bottle with unused contents for a full refund.	1,302	889	4,480,752,665,430,057,500	concat	[ "concat_full" ]	0.75	true	null
8,281,800,574,791,198,000	Anavar Mexico Anavar Steroids Price Cuajimalpa, Mexico Supplement Facts Read All Reviews Price List 2019 PackagePrice 90 Capsules$61.99 180 + 90 Capsules$123.98 360 + 180 Capsules$185.97 Yes, Anavar Steroids ship to over 100 countries worldwide including Cuajimalpa, Mexico. They offer Free Shipping for some countries. Check Shipping Rate VISIT OFFICIAL STORE Purchase Anavar Steroids in Cuajimalpa, Cuajimalpa de Morelos, Distrito Federal, Mexico [Anvarol Review] Purchase Anavar Steroids online Cuajimalpa, Mexico So, Are you Searching for Anavar Steroids in Cuajimalpa? Why Do Not you Make Use of This Finest Offers? Oxandrolone 10mg (Anavar) is a preferred amongst users desiring an oral anabolic steroid for their cutting cycles. It is known for producing significant gains in strength while providing a distinctive hardening or firming result on the body. Buy Anavar Steroids in Cuajimalpa If you are looking for Anavar Tablet that does not elevate blood pressure or reason toxicity to the liver or renal systems than you should considering on making use of Anvarol from CrazyBulk. Anvarol is Safe Alternative to pure anabolic Steroids with no Prescriptions required. Anvarol provides a effective formula which simulate's the steroid Methandrostenolone. Anavar makes a strongly energetic Anabolic environment and boosts Nitrogen loyalty in muscular tissue tissues, which allows for increased healthy protein synthesis and instant Durability and Dimension. Anvarol is among the best product on the Anavar Steroids markets today and it already has managed to show its effectiveness. Where can I buy Anvarol in Cuajimalpa? You can purchase Anvarol Anavar Steroids online from the main website. You can place an order from lots of parts of the world consisting of Cuajimalpa. Where to Buy Anavar Steroids in Cuajimalpa, Price Guide Anavar Steroids Price List (Cuajimalpa) Best Price Buy Online (Official) Anavar 360 Tablets (3 Bottles + Free 2 Bottles) $185.97 Buy Anavar 180 Tablets (2 Bottles + Free 1 Bottle) $123.98 Buy Anavar 90 Tablets (1 Bottle) $61.99 Buy Consider Availability of Free Shipping When Purchasing Oxandrolone Anavar Online This is a nearly vital option as customers have pertained to anticipate it from every online store. We can conserve as much as 30% more if a they offers free shipping. If there are no totally free shipping then a minimum of aim to get shipping on specific advertising products. A substantial variety of people choose purchasing online to save money and time spent on going to a store, if they have to invest in shipping then they may just prefer a journey to the store. However, with free shipping we need to wait a few extra days if they get our product delivered. Buy Anavar Steroids in Cuajimalpa What to think about Prior to Buy Anavar Steroids from Cuajimalpa? Prior to searching for Anavar Steroids on the internet, you must understand exactly what product you're searching for. Go into the item name into your web browser's search box to obtain started evaluating websites that offer the item. Evaluation at least 3 websites that use the item and pay close attention to cost, amount and shipping costs. Look for companies who are better to your shipping address. Sometimes, you can catch a break in shipping costs with choosing closer business. Various sites require different shipping charges and some may be more economical than others. Decide what quantity you need, make your decision and location your order, supplying the important info. What to Search for When Purchasing Oxandrolone Anavar and Avoiding the Scams? Stay Away From Free Trial Offers Pay close attention to this one and prevent getting scammed by the supposed complimentary trials. These websites trick you into trying their item with a complimentary bottle however What you do not see is the risk prowling in the small print that says they will be billing your credit card for more products instantly monthly. Then they'll make it very difficult for you to cancel your auto-ship membership. Avoid these rip-offs by purchasing from a respectable online merchant that does not have an auto ship program or charges any type of ongoing charge. Make sure they use an Assurance Does the company support the quality of their product. Are they positive enough in their item that they're prepared to provide you a Cash back Assurance? If not, don't buy from them. Any reputable supplier needs to allow you to return the product if you're not completely pleased. Buy 2 Bottles Anvarol, Get 1 Bottle Free! Characteristic of Anavar (Oxandrolone) Anavar is an anabolic steroid belonging to the Dihydrotestosterone (DHT) household of anabolic steroid derivatives/analogues. Other compounds that belong in this DHT household of anabolic steroids include Winstrol, Primobolan, Masteron, in addition to numerous others which are all derivatives of the parent anabolic steroid DHT. The typical aspect amongst all of these anabolic steroids is that they are, in one way or another, modified forms of DHT and thus DHT could be considered the moms and dad hormone of these anabolic steroids. Anavar itself has an unique favor of anabolic strength over its androgenic strength (as seen by its anabolic ranking of 322-- 630 due to its androgenic rating of 24). In comparison with Testosterone, which has an anabolic: androgenic ratio of 100:100 respectively, it is easily seen that Anavar is far less androgenic and has a stronger anabolic strength of at least 3 times the strength of Testosterone, and studies have actually demonstrated anabolic strength as high as 6 times that of Testosterone with little accompanying androgenic activity. Anavar does not have any measurable estrogenic activity (due to its nature of being a DHT derivative), nor does it hold any Progestogenic activity. It can be easily seen how these qualities make Anavar a beneficial substance among athletes and bodybuilders wishing to increase athletic efficiency, muscle gain, and strength gain where the additional water weight gain is undesired. It is likewise an anabolic steroid used extensively by bodybuilders wanting to shed body fat and preserve as much muscle as possible throughout a caloric deficit, where once again additional water weight and possible fat retention/gain is not desired. As one may have the ability to easily see, Anavar is rather a versatile substance in regards to its usages. For an anabolic steroid commonly promoted as being moderate, it really has some really remarkable anabolic strength as we can see from Anavars anabolic rating of 322-- 630 versus Testosterones ranking of 100; when compared to the other popular mild anabolic steroid Primobolan, with its anabolic ranking of 88, we can see how Anavar is not as mild in the sense of anabolic strength as many have made it out to be. In regards to its reported anabolic rating of 322-- 630, the reason why it is provided this range as opposed to one solid number for its anabolic rating (such as Trenbolones ranking of a solid 500 or Testosterones rating of a solid 100) is due to Anavars nature as an oral anabolic steroid. It is understood that anabolic steroids show a really bad portion of survivability through liver metabolism when consumed orally. As we understand that oral anabolic steroids are customized at the 17th carbon (known as C17 Alpha Alkylation) in order for the anabolic steroid to become more resistant to breakdown in the liver, this grants a really high portion for anabolic steroids to go through the liver into the blood stream, however this does not guarantee that 100% of the anabolic steroid makes it through. Some percentage will still be unfortunately lost, and for that reason that is the reason that instead of a solid number, a basic variety is provided for numerous anabolic steroids (mainly oral compounds for the factors specified, as strength can differ due to liver metabolism). Buy 2 Bottles Anvarol, Get 1 Bottle Free! Anavar Steroids Shipping to Cuajimalpa? You do not have to worry about Anavar Steroids shipment to your address due to the fact that presently Anavar Steroids shipment is available to all regions or cities throughout Cuajimalpa. La Candelaria(050), Cuajimalpa(050), La Venta(050), Cuajimalpa de Morelos, Distrito Federal. © Anavar Mexico 2015. All right reserved. CRAZYBULK PROMO BUY 2 GET FREE 3RD BOTTLE, ALL PRODUCTS Please select 2 products to buy and place them in your shopping cart. Add this product to your shopping cart. Be sure to select from the dropdown menu free product you want. Click to shop Visit Official Store 815 1st Street Manhattan Beach, CA 90266 $4,400,000 Status: Active • 4Beds • Baths • 3,226SQ. Feet • 8,604Lot Sq. Ft. Original Custom Built Home with Ocean view plus beautiful view of Santa Monica Mountains and the Green Belt. Easy to Walk to Beach or Downtown for restaurants and shopping. Robinson School is just on the other side of the Greenbelt. Extra wide lot: 108'x80' - Renovate and live in now or Build Dream House later. Beautiful wood interior. Vaulted wood beam ceilings, 3 wood decks including a wrap-around deck. Multi-level. Greenbelt is just steps away for a walk or jog. Award winning schools, Robinson Elementary and Mira Costa High School, within walking distance. Key Info • TypeSingle Family • StatusActive • Year Built1974 • Days on Market139 • Price$4,400,000 • Price/Sqft$1,364 • Date ListedJune 4th, 2019 • HOA Fees$0 • MLS® #SB19117775 Interior • Square Footage3,226 • Bedrooms4 • Bathrooms4.00 • Full Baths3 • Half Baths1 • # of Stories2 • HeatingForced Air • CoolingNone • FireplacesFamily Room, Living Room, Gas, Gas Starter, Wood, Raised Hearth • Parking Spaces2 • Garage Spaces2 School Info • DistrictManhattan Unified • ElementaryROBINS • MiddleMANBEA • HighMIRCOS Community Information • AreaManhattan Beach Hill (144) • CityManhattan Beach, CA • Zip Code90266 • CountyLos Angeles Exterior • StyleCustom Built, Mid Century Modern • Lot Sq. Ft.8,604 • PoolNone • ViewOcean View, Park Or Green Belt View, Water View Listing Details • Listing AgentDebbie Walmer(00546769) • Listing OfficeReal Estate West, Inc. Price Change History for 815 1st Street, Manhattan Beach, CA (MLS® #SB19117775) Date Details Change Price Reduced from $4,600,000 to $4,400,000 $200,000 (4.35%) Please provide a valid email address. Based on information from California Regional Multiple Listing Service, Inc. as of October 22nd, 2019 at 9:32pm PDT. This information is for your personal, non-commercial use and may not be used for any purpose other than to identify prospective properties you may be interested in purchasing. Display of MLS data is usually deemed reliable but is NOT guaranteed accurate by the MLS. Buyers are responsible for verifying the accuracy of all information and should investigate the data themselves or retain appropriate professionals. Information from sources other than the Listing Agent may have been included in the MLS data. Unless otherwise specified in writing, Broker/Agent has not and will not verify any information obtained from other sources. The Broker/Agent providing the information contained herein may or may not have been the Listing and/or Selling Agent.	# Anavar Mexico ## Price List 2019 \| Package \| Price \| \|-----------------------\|----------\| \| 90 Capsules \| $61.99 \| \| 180 + 90 Capsules \| $123.98 \| \| 360 + 180 Capsules \| $185.97 \| --- ## Shipping Anavar Steroids ship to over 100 countries worldwide, including Cuajimalpa, Mexico. Some destinations qualify for free shipping. --- ## Oxandrolone 10 mg (Anavar) Oxandrolone (Anavar) is an oral anabolic steroid popular for cutting cycles. Benefits: - Significant gains in strength - Distinctive hardening/firmer physique --- ## Anvarol (CrazyBulk) – Safe Alternative - No prescription required - Simulates the steroid Methandrostenolone - Creates a strongly anabolic environment - Boosts nitrogen retention and protein synthesis - Supports immediate strength and size gains --- ## Price Guide \| Product \| Contents \| Price \| \|-----------------------\|-----------------------------\|----------\| \| Anavar 360 Tablets \| 3 Bottles + Free 2 Bottles \| $185.97 \| \| Anavar 180 Tablets \| 2 Bottles + Free 1 Bottle \| $123.98 \| \| Anavar 90 Tablets \| 1 Bottle \| $61.99 \| --- ## Characteristics of Anavar (Oxandrolone) - Belongs to the DHT derivative family (like Winstrol, Primobolan, Masteron) - Anabolic:Androgenic ratio of 322–630 : 24 (vs. testosterone’s 100 : 100) - No measurable estrogenic or progestogenic activity - Orally active C17α-alkylated steroid—some loss via liver metabolism explains the range in anabolic rating - Ideal for athletes/bodybuilders seeking lean gains and fat loss without water retention --- --- # 815 1st Street Manhattan Beach, CA 90266 Price: $4,400,000 Status: Active ## Features - 4 Beds - 4 Baths - 3,226 Sq. Ft. - 8,604 Lot Sq. Ft. Original Custom Built Home with ocean and Santa Monica Mountains views. Easy walk to the beach, downtown restaurants, and shops. Robinson School is just across the greenbelt. Extra-wide lot (108' × 80'). Renovate now or build your dream home later. Beautiful wood interior, vaulted wood beam ceilings, and three wood decks including a wrap-around deck. Multi-level floor plan. Steps from the greenbelt for walking or jogging. Award-winning schools: Robinson Elementary and Mira Costa High within walking distance. --- ## Key Info - Type: Single Family - Status: Active - Year Built: 1974 - Days on Market: 139 - Price/Sqft: $1,364 - Date Listed: June 4, 2019 - HOA Fees: $0 - MLS® #: SB19117775 ## Interior - Square Footage: 3,226 - Bedrooms: 4 - Bathrooms: 4.00 - Full Baths: 3 - Half Baths: 1 - Stories: 2 - Heating: Forced Air - Cooling: None - Fireplaces: Family Room, Living Room (Gas, Gas Starter, Wood, Raised Hearth) - Parking Spaces: 2 - Garage Spaces: 2 ## School Info - District: Manhattan Unified - Elementary: ROBINS - Middle: MANBEA - High: MIRCOS ## Community Information - Area: Manhattan Beach Hill (144) - City: Manhattan Beach, CA - Zip Code: 90266 - County: Los Angeles ## Exterior - Style: Custom Built, Mid Century Modern - Lot Sq. Ft.: 8,604 - Pool: None - View: Ocean View, Park/Green Belt View, Water View ## Listing Details - Listing Agent: Debbie Walmer (00546769) - Listing Office: Real Estate West, Inc. ## Price Change History \| Date \| Details \| Change \| \|------\|----------------------------------------------\|---------------------\| \| \| Price Reduced from $4,600,000 to $4,400,000 \| $200,000 (4.35%) \|	2,471	905	8,281,800,574,791,198,000	concat	[ "concat_full" ]	0.75	true	null
-6,280,564,490,412,924,000	Don't have an account? Join the Best Live Fantasy Chat Community! Lost password? [X] Receive free daily analysis: NFL NBA MLB Already have an account? Log in here. [X] Forgot Password [X] Daily Slivers of the Fantasy Soapbox (6/14/19) Welcome to the Friday, June 14th edition of Daily Slivers of the Fantasy Soapbox. Discussing baseball is as fun as the game itself. It has a way of bringing people together to share different opinions about the sport we all love. A similar action can be done with fantasy baseball where we not only discuss topics but also look to improve our teams as well as the teams of our fellow fantasy baseball enthusiasts. Everyone has their own perspectives which are not to be cast off as frivolous. They should be used as a method of expanding our own knowledge. In this article, I review the previous day's boxscores and provide my opinion on a variety of topics. Some will be random, some will be fun, and some will be stat-driven. It's a soapbox so I may rant from time to time as well. So without any further delay, below are my thoughts on June 14th. Enjoy them. You can even respond with your own thoughts on Twitter @EllisCan2. Editor's Note: Get any full-season MLB Premium Pass for 50% off, with exclusive access to our season-long articles, 15 in-season lineup tools and over 200 days of expert DFS research/tools. Sign Up Now! Daily Musings • 89% Owned?! A guy has more power than anyone in the league. He definitely has the best avg exit velo (96.3mph). It’s true he strikes out a lot but there are plenty worse batting averages in the league (.276). He hits in a homer-friendly home park. All of this goodness and 11% of leagues are like “Nah, I’ll pass.” Check your waivers to see if Joey Gallo is on your wire. It's an insult if you see him there. Rectify that quickly. • I felt like I had some caution when recommending to go All In on Yordan Alvarez because of the unknown future playing time for him. Evidently, he is here to stay. Double down. A couple of key points, he isn’t swinging that often (35%), but he does have a 16.7% swinging strike rate. If that continues across a larger scale, it won’t be pretty. • Ozzie Albies is on a TEAR! Thus far in June (.316AVG, three HR). May was terrible (.239AVG, one HR). Has he fixed everything? Not on the road (.233AVG). Also, he would rather avoid righties (.252) and he’s chasing pitches too much (38.7%). • Rafael Devers, you make me so proud. 10HR, eight SB. Get this 22-year-old on your roster. • Jarrod Dyson has tied his career-high w/fifth HR. Of course, you aren’t suffering w/sporadic playing time for his HR power. • Time to workout. Cycle time. Shohei Ohtani making it look easy. And his ownership raised a mere 3% from two days ago to 59%. I would laugh so hard if it wasn't Cycle time. Fix it, People. • Nelson Cruz w/five HR in his last seven games. Added three more RBI. Twins offense will generate plenty of R+RBI opportunities. That’s why you don’t give up on some aging players. Cruz is worth well more than his sixth-round ADP. • Youngsters take advantage of inept Orioles pitching. Lourdes Gurriel & Cavan Biggio took advantage of Camden w/three total homers between them. Chance Sisco hit one out as well, his second in 27PA. He’s been a solid addition to lineups, particularly in two-catcher leagues. On Gurriel & Biggio, I’m indifferent. • Mama said there would be days like this: • Don’t get too excited but Jackie Bradley Jr. has two HR and two SB in his last five games. The schedule against the Rangers was why we recommended him in the OF waiver wire article. The week isn’t over. He still has juicy matchup in Camden. If there were ever a time to use him, now is that time. • Brett Gardner is one HR shy of eclipsing his 2018 mark (12). A 13.2-degree launch angle hasn’t affected his career-best 14.1%K rate. The batting average is still terribly low (.229), likely affected by .223BABIP. Counting stats should increase once the lineup is fully healthy. • Tim Anderson w/10HR, 15SB, .317AVG! Ooh-La-La. 19.4%K rate? I’m swooning over here. Seven total walks in 237PA? I guess I can’t be too picky. 43.7% chase rate?!?! If it weren’t for Kevin Pillar you’d be king of the category……..No, I don’t care that Yadier Molina has the same chase rate. He’s making contact on them 12% better than you. You, sir, are no Yadi. I guess we should just be thankful for what we have. • Riddle me this Batboy, if Ryan McMahon is a career .301 hitter against lefties, but only .209 against righties, why do you start him against both when you have Brendan Rodgers available? (The theme song of this tweet and the only music I hear when anyone mentions the Rockies, rookies, McMahon, or Rodgers is Bang Your Head by Quiet Riot). • The power of twos. Manny Machado hit two bombs with three RBI; however, hometown guy Charlie Blackmon hit two moonshots w/four RBI. Money can’t buy me love or a better bat, evidently. Even Cody Bellinger did what Machado accomplished for tremendously less. • TGFBI’s Deep Thoughts. Every time I watch Kris Bryant homer (14), I collapse with my head in my hands and wonder why, oh why, I chose Andrew Benintendi in the second round over Bryant. Dreamy Bryant shares a name w/Kris Kristofferson and he even had an Ex-Con Martha Stewart wedding. But, deep down I knew that Bryant has his rock in life. He’s found his roots and is no longer a runner. Benintendi, on the other hand, still has that lively spirit and provides a warm embrace of power and speed, albeit a less cozy embrace than I prefer. If you're gonna give me a power/speed hug, bring it in for the real thing, not some weak-ass body lean w/three taps on each other's shoulder. • Have a great day of Friday baseball. More Fantasy Baseball Analysis More Recent Articles Thursday Night Football Matchups Analysis - Week 7 The New England Patriots continue to roll through the competition. Tom Brady managed to trounce the New York Giants with 334 passing yards and two rushing touchdowns, vulturing goal line work from Sony Michel who failed to eclipse 100 yards despite carrying the football 22 times. Each team's top receiving option produced exceptional fantasy days,... Read More Wide Receiver Start/Sit Advice - Week 7 Pierre Camus and Chris Mangano break down the wide receiver position to help with tough fantasy football lineup decisions for Week 7 of the 2019 NFL season. They decide who to start or sit among those in WR3 or flex consideration. Like and subscribe to the RotoBaller channel on Youtube to get all our latest... Read More Keenan Allen - Fantasy Football Disaster Recovery Welcome to Disaster Recovery, where each week I'll examine why your studs played like duds. This isn't a place to find out why you should have sat a player for somebody on your bench. Disaster Recovery is to examine the guys who you didn't think twice about starting, and deciding if you should be panicking at all about... Read More NFL Survivor Pool Picks (Week 7) - Targets and Avoids Another week, more upsets. The Cowboys, Chiefs and Chargers all went down knocking out about 15-20 percent of remaining entrants in survivor pools, including myself. The Baltimore and New England wins were never in doubt, but the Redskins and Packers just barely squeaked out wins. If you've made it this far, you've done a job... Read More Fantasy Football Risers and Fallers - Week 7 Whether due to their own play, the play of others, or injuries, players' stock increases and decreases on a weekly basis. Perhaps more than any other, the NFL is a league that experiences ups and downs at a rapid pace. With only 16 games, there’s little room for error and seemingly endless opportunities for improvement.... Read More Running Back Metrics That Matter - NFL NextGen Stats It's been a month--a full month!--since the last time we took a look at our beloved running backs. I don't think there is a hotter topic of discussion between pro- and anti-analytics than rushing. The guys fighting for stat-supremacy are all about using the passing game as much as possible while ditching the run; the... Read More Titanic Disappointment - Will Ryan Tannehill Help Tennessee? In the midst of being shutout by the Denver Broncos on Sunday, Tennesse Titans coach Mike Vrabel made a move that many casual NFL fans had been expecting for the past few weeks: he decided to give Ryan Tannehill a shot at quarterback instead of Marcus Mariota. While Tannehill wasn't noticeably better on Sunday, throwing... Read More Warning Signs: Todd Gurley, Brandin Cooks, Robert Woods, Jared Goff This is going to be a special edition of Warning Signs. Usually, we take a look at players from different teams who have disappointed thus far. This week, I am going to focus on a single team full of players to worry about. It is not good to have a team of big stars where... Read More FAAB Bidding - Week 7 Waiver Wire Targets Assisting our famous waiver wire pickups list, and our weekly waiver wire columns by position, this column focuses on suggested waiver wire bidding percentages for fantasy football owners in leagues using a Free Agent Acquisition Budget (FAAB). As a caveat, these prices do not by any means indicate how much these free agent players will... Read More We Must Overreact Immediately! Week 6 Outliers In Week 6, several players exploded in fantasy lineups. There were a few receivers that were above the rest of the pack in Week 6, such as Stefon Diggs, Terry McLaurin, Chris Godwin and Tyreek Hill, but there shouldn't be any surprises there as those guys should have been in fantasy lineups. At the quarterback... Read More Deeper League Free Agent Pickups for Week 7 The bye week difficulties continue this week with Carolina, Cleveland, Pittsburgh, and Tampa Bay all getting their rest in Week 7. It should be noted, however, that just because a player is currently in their bye week, doesn't mean you should avoid them on the waiver wire. In fact, this is often the easiest way... Read More Week 7 Waiver Wire Pickups & Adds All of a sudden, the Chargers look like one of the worst teams in football and the Jets look like a playoff contender. Maybe things won't shake out that way in the end but it goes to show how quickly things change in the "Not For Long" NFL. For that reason, we advise looking at... Read More The Cut List - Players on the Chopping Block (Week 7) This is your weekly list of players to drop. I will do my best to limit this list to injured players and players you might consider holding. If you roster pure handcuffs or backups, obviously you can let them go at any time. The players on this list will, ideally, be guys that aren't clearly... Read More Week 7 Defense (DEF) Streamers and Starts - 2019 Fantasy Tiers, Rankings Below are RotoBaller's Week 7 defense tiers and rankings, or which defenses to stream, start and target off the waiver wire for Week 7 of the NFL and fantasy football season. In case you missed it, this is our seventh year now writing this weekly column. Our weekly tiered defense rankings are a guide to making waiver... Read More Week 7 Kicker Streamers and Starts - 2019 Fantasy Tiers, Rankings Week 6 is done, and we've seen some outstanding games thus far. We've also seen a lot of surprising teams through six weeks. The San Francisco 49ers, after picking in the top 10 for four straight years, are 5-0 with one of the most complete teams in football. As far as kickers go, we're seeing... Read More Home >> Glass >> Hand Painted >> Some Beach Some Beach Some Beach Some Beach Some Beach Some Beach Product Details: Some Beach is a set of 2 standard size wine glasses. It's hand painted with baked on enamel that will last. They are unique. No two are alike. Shipping : Items ships from : United_States. Payment Method: We accept the following forms of payment: Ship To Single Cost With another Item United_States $ 12.95 $ 12.95 More Creations from this Artist! Fishing Lure Dangle Earrings with Colored Crystals Rustic Bottle Opener Blue Flower Wild Daisy Horses In The Mist You Are My Sunshine The Sea Make A Wish Price: $ 14.00 Product Information Product name - Some Beach Price: USD 14.00 In Stock: 1 Stats Listed On 2016-10-22 1104 views Shop Owner Treca Lawson Shop Info 21 items for sale Action Bookmark and Share Share Report this Item - Report this Product Follow Us Close Some Beach Some Beach Some Beach	# Daily Slivers of the Fantasy Soapbox (6/14/19) Welcome to the Friday, June 14th edition of Daily Slivers of the Fantasy Soapbox. Discussing baseball is as fun as the game itself. It has a way of bringing people together to share different opinions about the sport we all love. A similar action can be done with fantasy baseball where we not only discuss topics but also look to improve our teams as well as the teams of our fellow fantasy baseball enthusiasts. Everyone has their own perspectives which are not to be cast off as frivolous. They should be used as a method of expanding our own knowledge. In this article, I review the previous day's boxscores and provide my opinion on a variety of topics. Some will be random, some will be fun, and some will be stat-driven. It's a soapbox so I may rant from time to time as well. So without any further delay, below are my thoughts on June 14th. Enjoy them. You can even respond with your own thoughts on Twitter [@EllisCan2](https://twitter.com/EllisCan2). Editor's Note: Get any full-season MLB Premium Pass for 50% off, with exclusive access to our season-long articles, 15 in-season lineup tools and over 200 days of expert DFS research/tools. Sign Up Now! --- ## Daily Musings - 89% Owned?! A guy has more power than anyone in the league. He definitely has the best avg exit velo (96.3 mph). It’s true he strikes out a lot but there are plenty worse batting averages in the league (.276). He hits in a homer-friendly home park. All of this goodness and 11% of leagues are like “Nah, I’ll pass.” Check your waivers to see if Joey Gallo is on your wire. It's an insult if you see him there. Rectify that quickly. - I felt like I had some caution when recommending to go All In on Yordan Alvarez because of the unknown future playing time for him. Evidently, he is here to stay. Double down. A couple of key points, he isn’t swinging that often (35%), but he does have a 16.7% swinging strike rate. If that continues across a larger scale, it won’t be pretty. - Ozzie Albies is on a TEAR! Thus far in June (.316 AVG, three HR). May was terrible (.239 AVG, one HR). Has he fixed everything? Not on the road (.233 AVG). Also, he would rather avoid righties (.252) and he’s chasing pitches too much (38.7%). - Rafael Devers, you make me so proud. 10 HR, eight SB. Get this 22-year-old on your roster. - Jarrod Dyson has tied his career-high w/fifth HR. Of course, you aren’t suffering w/sporadic playing time for his HR power. - Time to workout. Cycle time. Shohei Ohtani making it look easy. And his ownership raised a mere 3% from two days ago to 59%. I would laugh so hard if it wasn't Cycle time. Fix it, People. - Nelson Cruz w/five HR in his last seven games. Added three more RBI. Twins offense will generate plenty of R+RBI opportunities. That’s why you don’t give up on some aging players. Cruz is worth well more than his sixth-round ADP. - Youngsters take advantage of inept Orioles pitching. Lourdes Gurriel & Cavan Biggio took advantage of Camden w/three total homers between them. Chance Sisco hit one out as well, his second in 27 PA. He’s been a solid addition to lineups, particularly in two-catcher leagues. On Gurriel & Biggio, I’m indifferent. - Mama said there would be days like this: - Don’t get too excited but Jackie Bradley Jr. has two HR and two SB in his last five games. The schedule against the Rangers was why we recommended him in the OF waiver wire article. The week isn’t over. He still has juicy matchup in Camden. If there were ever a time to use him, now is that time. - Brett Gardner is one HR shy of eclipsing his 2018 mark (12). A 13.2° launch angle hasn’t affected his career-best 14.1% K rate. The batting average is still terribly low (.229), likely affected by .223 BABIP. Counting stats should increase once the lineup is fully healthy. - Tim Anderson w/10 HR, 15 SB, .317 AVG! Ooh-La-La. 19.4% K rate? I’m swooning over here. Seven total walks in 237 PA? I guess I can’t be too picky. 43.7% chase rate?!?! If it weren’t for Kevin Pillar you’d be king of the category… No, I don’t care that Yadier Molina has the same chase rate. He’s making contact on them 12% better than you. You, sir, are no Yadi. I guess we should just be thankful for what we have. - Riddle me this Batboy: if Ryan McMahon is a career .301 hitter against lefties, but only .209 against righties, why do you start him against both when you have Brendan Rodgers available? (The theme song of this tweet and the only music I hear when anyone mentions the Rockies, rookies, McMahon, or Rodgers is Bang Your Head by Quiet Riot). - The power of twos. Manny Machado hit two bombs with three RBI; however, hometown guy Charlie Blackmon hit two moonshots w/four RBI. Money can’t buy me love or a better bat, evidently. Even Cody Bellinger did what Machado accomplished for tremendously less. - TGFBI’s Deep Thoughts. Every time I watch Kris Bryant homer (14), I collapse with my head in my hands and wonder why, oh why, I chose Andrew Benintendi in the second round over Bryant. Dreamy Bryant shares a name w/Kris Kristofferson and he even had an Ex-Con Martha Stewart wedding. But, deep down I knew that Bryant has his rock in life. He’s found his roots and is no longer a runner. Benintendi, on the other hand, still has that lively spirit and provides a warm embrace of power and speed, albeit a less cozy embrace than I prefer. If you're gonna give me a power/speed hug, bring it in for the real thing, not some weak-ass body lean w/three taps on each other's shoulder. - Have a great day of Friday baseball. --- # Some Beach ## Product Details - Some Beach is a set of 2 standard size wine glasses. - It’s hand painted with baked-on enamel that will last. - They are unique. No two are alike. ## Shipping - Ships from: United States ## Payment Method We accept the following forms of payment: ## Shipping Rates \| Ship To \| Single Cost \| With another Item \| \|---------------\|-------------\|-------------------\| \| United States \| $12.95 \| $12.95 \| ## Price - USD 14.00 ## Stock - In Stock: 1 ## Product Information - Product name: Some Beach - Price: USD 14.00 ## Stats - Listed On: 2016-10-22 - Views: 1104 ## Shop Owner - Treca Lawson ## More Creations from this Artist - Fishing Lure Dangle Earrings with Colored Crystals - Rustic Bottle Opener - Blue Flower - Wild Daisy - Horses In The Mist - You Are My Sunshine - The Sea - Make A Wish	2,920	1,614	-6,280,564,490,412,924,000	concat	[ "concat_full" ]	0.75	true	null
1,133,579,892,766,694,400	How we live now : redefining home and family in the 21st century / "A close-up examination and exploration, How We Live Now challenges our old concepts of what it means to be a family and have a home, opening the door to the many diverse and thriving experiments of living in twenty-first century America. Across America and around the world, in cities and subur... Full description Saved in: Main Author: DePaulo, Bella M. Format: Book Language:English Published:Hillsboro, Oregon : Atria Books/Beyond Words, [2015] Subjects: Tags: Add Tag No Tags, Be the first to tag this record! McHenry County College Location: Stacks Call Number: HQ536 .D4297 2015 Copy 1 Available Check if item can be requested $25 Event Information Share this event Date and Time Location Location Civic Centre Resource Library 2191 Major Mackenzie Drive West Vaughan, ON L6A 4W2 Canada View Map Refund Policy Refund Policy Refunds up to 7 days before event Event description Description Interested in learning coding? Join us for a four-week workshop. For ages 8-12. Cost is $25 for all four weekly sessions. Civic Centre Resource Library Thursdays, 6:30 pm - 8:00 pm Nov 7 - 28 Registration starts October 17. The personal information collected from you on this form will only be used for the purpose of Vaughan Public Libraries' program and/or event registration. Your personal information will not be shared with outside organizations, except as indicated in the Privacy Statement. Share with friends Date and Time Location Civic Centre Resource Library 2191 Major Mackenzie Drive West Vaughan, ON L6A 4W2 Canada View Map Refund Policy Refunds up to 7 days before event Save This Event Event Saved	# How We Live Now : Redefining Home and Family in the 21st Century Author: Bella M. DePaulo Format: Book Language: English Publisher: Atria Books / Beyond Words, 2015 (Hillsboro, Oregon) Description: “A close-up examination and exploration, How We Live Now challenges our old concepts of what it means to be a family and have a home, opening the door to the many diverse and thriving experiments of living in twenty-first century America. Across America and around the world, in cities and suburbs…” Library Location: McHenry County College – Stacks Call Number: HQ536 .D4297 2015 Availability: Copy 1 available (check if item can be requested) --- # $25 ## Event Information ## Date and Time ## Location Civic Centre Resource Library 2191 Major Mackenzie Drive West Vaughan, ON L6A 4W2 Canada ## Refund Policy Refunds up to 7 days before event ## Description Interested in learning coding? Join us for a four-week workshop. For ages 8-12. Cost is $25 for all four weekly sessions. Civic Centre Resource Library Thursdays, 6:30 pm - 8:00 pm Nov 7 - 28 Registration starts October 17. The personal information collected from you on this form will only be used for the purpose of Vaughan Public Libraries' program and/or event registration. Your personal information will not be shared with outside organizations, except as indicated in the Privacy Statement.	415	339	1,133,579,892,766,694,400	concat	[ "concat_full" ]	0.75	true	null
-2,497,637,004,303,057,000	24 Hour Car Key Replacement Service Near You Forgetting where you put your keys is worst that you usually thought. It can even happen when you're in dire need to open your car on your way to work. And to add to the injury, there seems to be no one that could help. This is where the locksmith professionals come into play. They can help with little or no damage caused to your car. Today cars cannot be easily picked by anyone as a lot or car manufacturers consider safety as top priority. One of the unpleasant things that can happen to anyone is misplaced or lost keys. The next move you need to take is to contact with a locksmith specialist who can make new car keys for you. Lost your keys, it is a transponder chip key or an electronic key fob? No matter what type of the car key you lost, we can give the right service. We can help you with regards to all your car lock problems, whether you have a van, truck or motorcycle. Our properties require security protection such as the vehicles. One of the life-threatening widespread crimes now within the the areas we serve is vehicle theft. Regardless of what type of the car is, whether it is SUV or truck, a superior security system is the best way to push away possible attacks of the culprit. As a countermeasure, installing a car alarm system is highly recommended. Once a person touches it, you will be notified immediately even if you are away. We can do the locksmith job for your car, include us in your list if you need one. Our locksmith service provider offers you a wide range of services necessary to strengthen the security of your vehicle. We can immediately assist you, if you are having a lock and key problem and this will end your worries. We have experts in locksmithing that works 24x7x365 for non-stop assistance with no added charges. We can immediately send your our locksmith technicians, if ever you have emergency problem with your car locks, just call us. Our automotive locksmith services also include the following: • Transponder Chip Key • Broken Ignition Key Extraction • Transponder Key Programming • Lost Car Key Replacement • Key Duplication • Key Cutting • Vehicle Trunk Opening • Car Door Unlocking • GM, VAT Keys • Car Lockout Assistance Need our services now? Drop us a call and we promise to get back to you as soon as possible. Closed Today's Hours: 8:30a - 6:00p 2020 Chevy Silverado 2500HD LTZ Truck For Sale Grove City PA 2020 Chevy Silverado 2500HD LTZ Mileage: 23 Drivetrain: 4X4 Stock: G708 VIN: 1GC4YPEY5LF116927 MSRP: $70,750 Available Savings: $3,668 Internet Price: $67,082 Vehicle Location Diehl of Grove City (724) 748-3575 1685 West Main Street Extension Grove City, PA 16127 Dealer Information View Dealer Inventory Key Info Mileage: 23 Body: Truck Drivetrain: 4X4 Exterior: Summit White Interior: Jet Black Engine: Duramax 6.6L V8 Turbodiesel Fuel Type: Diesel Transmission: Automatic Doors: 4 Vehicle Description Priced below KBB Fair Purchase Price! Summit White 2020 Silverado 2500HD Chevrolet LTZ 4D Crew Cab 4WD 10-Speed Automatic Duramax 6.6L V8 Turbodiesel Vehicle Details Package Trailering Package includes trailer hitch, 7-pin connector and (CTT) Hitch Guidance (Deleted when (ZW9) pickup bed delete is ordered.) Mechanical Engine, 6.6L V8 with Direct Injection and Variable Valve Timing, gasoline, (401 hp [299 kW] @ 5200 rpm, 464 lb-ft of torque [629 N-m] @ 4000 rpm) Transmission, 6-speed automatic, heavy-duty (Requires (L8T) 6.6L V8 gas engine.) Rear axle, 3.73 ratio (Requires (L8T) 6.6L V8 gas engine. Not available with (L5P) Duramax 6.6L Turbo-Diesel V8 engine.) Durabed, pickup bed GVWR, 10,650 lbs. (4831 kg) (Requires CK20743 model and (L8T) 6.6L V8 gas engine with 18" or 20" wheels or CK20943 and (L8T) 6.6L V8 gas engine with 17" wheels.) Air filter, high-capacity Air filtration monitoring Transfer case, two-speed active electronic Autotrac with push button control (Requires 4WD models.) Differential, heavy-duty locking rear Four wheel drive Cooling, external engine oil cooler Cooling, auxiliary external transmission oil cooler Battery, heavy-duty 720 cold-cranking amps/80 Amp-hr maintenance-free with rundown protection and retained accessory power (Included and only available with (L8T) 6.6L V8 gas engine.) Alternator, 170 amps (Requires (L8T) 6.6L V8 gas engine.) Advanced Trailering System includes checklist, trailer maintenance reminders, trailer security alerts, trailer mileage, tow/haul reminder, trailer electrical diagnostics and Trailer Tire Pressure Monitor System module Trailer brake controller, integrated Frame, fully-boxed, hydroformed front section and a fully-boxed stamped rear section Recovery hooks, front, frame-mounted, Black (Not included when (VQY) Chrome recovery hooks, LPO is ordered.) Suspension Package Steering, Digital Variable Steering Assist this system automatically adjusts steering based on speed, road conditions, and other inputs to reduce driver effort and fatigue Brakes, 4-wheel antilock, 4-wheel disc with DURALIFE rotors Brake lining wear indicator Capless Fuel Fill (Requires (L8T) 6.6L V8 gas engine. Not available with (ZW9) pickup bed delete.) Exterior Wheels, 18" (45.7 cm) machined aluminum with Silver painted accents, 6-spoke Tires, LT275/70R18E all-terrain, blackwall Tire, spare LT275/70R18 all-terrain, blackwall (Included and only available with (QF6) LT275/70R18E all-terrain, blackwall tires or (QF9) LT275/65R20 all-terrain, blackwall tires with (E63) Durabed, pickup bed. Available to order when (ZW9) pickup bed delete and (QF6) LT275/70R18E all-terrain, blackwall tires are ordered.) Tire carrier lock keyed cylinder lock that utilizes same key as ignition and door (Deleted with (ZW9) pickup bed delete.) Wheelhouse liners, rear Bumper, front chrome Bumper, rear chrome CornerStep, rear bumper BedStep, Black integrated on forward portion of bed on driver and passenger side (Deleted when (ZW9) pickup bed delete is ordered.) Moldings, beltline, stainless steel Cargo tie downs (12), fixed rated at 500 lbs per corner (Deleted with (ZW9) pickup bed delete.) Grille (Chrome front grille bar with "CHEVROLET". Includes Chrome grille inserts with small Gold bowtie emblem.) Headlamps, LED reflector with LED signature Daytime Running Lamps Taillamps, LED with signature Lamps, cargo area, cab mounted integrated with center high mount stop lamp, with switch in bank on left side of steering wheel. Fog lamps, front, LED Mirrors, outside power-adjustable vertical trailering with heated and auto-dimming upper glass (driver and passenger) lower convex mirrors, turn signal indicators, puddle lamps, perimeter lighting, auxiliary lighting, power folding/extending (extends 3.31" [84.25mm]) Mirror caps, chrome Glass, deep-tinted Tailgate and bed rail protection cap, top Tailgate, gate function manual with EZ Lift includes power lock and release (Upgraded to (QT6) Power up and down tailgate when (PCZ) LTZ Convenience Package is ordered. Deleted when (ZW9) pickup bed delete is ordered.) Door handles, chrome Entertainment Audio system, Chevrolet Infotainment 3 Plus system 8" diagonal HD color touchscreen, AM/FM stereo, Bluetooth audio streaming for 2 active devices, Apple CarPlay and Android Auto capable, voice recognition, in-vehicle apps, cloud connected personalization for select infotainment and vehicle settings. Dealer upgradeable to embedded navigation. Subscription required for enhanced and connected services after trial period. (Includes (PZ8) Hitch Guidance with Hitch View.) SiriusXM Radio enjoy a 3-month All Access trial subscription with over 150 channels including commercial-free music, plus sports, news and entertainment. Plus listening on the app and online is included, so you'll hear the best SiriusXM has to offer, anywhere life takes you. Welcome to the world of SiriusXM. (IMPORTANT: The SiriusXM radio trial package is not provided on vehicles that are ordered for Fleet Daily Rental ("FDR") use. If you decide to continue service after your trial, the subscription plan you choose will automatically renew thereafter and you will be charged according to your chosen payment method at then-current rates. Fees and taxes apply. To cancel you must call us at 1-866-635-2349. See our Customer Agreement for complete terms at www.siriusxm.com. All fees and programming subject to change.) Radio, HD Audio system feature, 6-speaker system Steering wheel audio controls Bluetooth for phone connectivity to vehicle infotainment system 4G LTE Wi-Fi Hotspot capable (Terms and limitations apply. See onstar.com or dealer for details.) Interior Seats, front 40/20/40 split-bench with covered armrest storage and under-seat storage (lockable) (Not available with (PCZ) LTZ Convenience Package, (PDF) LTZ Plus Package, (PDK) LTZ Premium Package or (PDL) LTZ Texas Edition.) Perforated leather-appointed front seat trim Seating, heated driver and front outboard passenger Seat adjuster, driver 10-way power including lumbar Seat adjuster, passenger 10-way power including lumbar Driver memory recalls driver "presets" for power driver seat and outside mirrors Seat, Up-level Rear with Storage Package 60/40 folding bench for Crew Cab models, includes full-length bench seat, seatback storage on left and right side, center fold out armrest with 2 cupholders, full cab width under-seat storage, (includes child seat top tether anchor) Floor covering, color-keyed carpeting Floor mats, rubberized vinyl, front (Deleted when LPO floor liners are ordered.) Floor mats, rubberized-vinyl rear (Deleted when LPO floor liners are ordered.) Steering wheel, leather-wrapped Steering wheel, heated Steering column, manual tilt and telescoping Steering column, lock control, electrical Instrument cluster 6-gauge cluster featuring speedometer, fuel level, engine temperature, tachometer, voltage and oil pressure Driver Information Center, 4.2" diagonal color display includes driver personalization Exterior Temperature Display located in radio display Compass located in instrument cluster Rear Seat Reminder Window, power front, drivers express up/down Window, power front, passenger express up/down Windows, power rear, express down Door locks, power Remote vehicle starter system Keyless Open and Start Cruise control, electronic with set and resume speed, steering wheel-mounted Theft-deterrent system, unauthorized entry USB ports, 2 (first row) located on instrument panel USB Ports (Instrument Panel with bench seat), 2 also includes 1 SD card reader (first row) (With (PCZ) LTZ Convenience Package the USB ports move inside the console and include an auxiliary jack.) USB ports, dual, charge-only (2nd row) Power outlet, front auxiliary, 12-volt Power outlet, rear auxiliary, 12-volt Power outlet, instrument panel, 120-volt (400 watts shared with (KC9) bed mounted power outlet) Power outlet, bed mounted, 120-volt (400 watts shared with (KI4) instrument panel mounted power outlet) (Deleted when (ZW9) pickup bed delete is ordered.) Air conditioning, dual-zone automatic climate control Air vents, rear, heating/cooling Defogger, rear-window electric Mirror, inside rearview auto-dimming Assist handles front A-pillar mounted for driver and passenger, rear B-pillar mounted Chevrolet Connected Access capable (Subject to terms. See onstar.com or dealer for details.) Safety StabiliTrak stability control system with Proactive Roll Avoidance and traction control, includes electronic trailer sway control and hill start assist Daytime Running Lamps with automatic exterior lamp control Airbags, Dual-stage frontal airbags for driver and front outboard passenger; Seat-mounted side-impact airbags for driver and front outboard passenger; Head-curtain airbags for front and rear outboard seating positions; Includes front outboard Passenger Sensing System for frontal outboard passenger airbag (Always use seat belts and child restraints. Children are safer when properly secured in a rear seat in the appropriate child restraint. See the Owner's Manual for more information.) OnStar and Chevrolet connected services capable (Terms and limitations apply. See onstar.com or dealer for details.) HD Rear Vision Camera (Deleted when (ZW9) pickup bed delete is ordered.) Hitch Guidance (Deleted with (ZW9) pickup bed delete.) Hitch Guidance with Hitch View (Deleted with (ZW9) pickup bed delete.) Teen Driver configurable feature that lets you activate customizable vehicle settings associated with a key fob, to encourage safe driving behavior. It can limit certain available vehicle features, and it prevents certain safety systems from being turned off. An in-vehicle report card gives you information on driving habits and helps you to continue to coach your new driver Tire Pressure Monitoring System with Tire Fill Alert (does not apply to spare tire) Installed Options EXHAUST BRAKE ENGINE, DURAMAX 6.6L TURBO-DIESEL V8 Value: $9,890 • B20-Diesel Compatible • (445 Hp [332 KW] @ 2800 Rpm • 910 Lb-ft Of Torque [1220 Nm] @ 1600 Rpm) • REAR AXLE, 3.42 RATIO SKID PLATES Value: $150 • Protect The Oil Pan • Front Axle And Transfer Case • LAMPS, SMOKED AMBER ROOF MARKER, (LED) Value: $55 WIRELESS CHARGING BOSE SOUND SYSTEM, PREMIUM 7-SPEAKER SYSTEM • With Richbass Woofer • LPO, ALL-WEATHER FLOOR LINERS • 1st And 2nd Rows • (includes Z71 Logo On Front Mats) • WHEELS, 20" (50.8 CM) POLISHED ALUMINUM Value: $1,400 • 6-spoke • ALTERNATOR, 220 AMPS Value: $150 CENTER CONSOLE, FLOOR-MOUNTED • With Cup Holders • Cell Phone Storage • Power Cord Management • Hanging File Folder Capability • Similar Vehicles For Sale * Pricing - All vehicle pricing shown is assumed to be correct and accurate. Incentives, credit restrictions, qualifying programs, residency, and fees may raise, lower, or otherwise augment monthly payments and may not be available for all customers. Additionally, incentives offered by the manufacturer are subject to change and may fluctuate or differ based on region and other considerations. Unless otherwise noted or specified, pricing shown does not include title, registration, or tax fees and costs. MPG - Vehicle information, as well as features and other inclusions, may vary by model and are based exclusively on standard equipment. No claims, warranties, or guarantees have been made related to the accuracy of customer payments, model equipment, or vehicle pricing. Please call with any questions you might have and to reassert the accuracy of any information presented here. © 2019 Diehl Automotive \| Privacy Policy Much from	# 24 Hour Car Key Replacement Service Near You Forgetting where you put your keys is worst that you usually thought. It can even happen when you're in dire need to open your car on your way to work. And to add to the injury, there seems to be no one that could help. This is where the locksmith professionals come into play. They can help with little or no damage caused to your car. Today cars cannot be easily picked by anyone as a lot or car manufacturers consider safety as top priority. One of the unpleasant things that can happen to anyone is misplaced or lost keys. The next move you need to take is to contact with a locksmith specialist who can make new car keys for you. Lost your keys, it is a transponder chip key or an electronic key fob? No matter what type of the car key you lost, we can give the right service. We can help you with regards to all your car lock problems, whether you have a van, truck or motorcycle. Our locksmith service provider offers you a wide range of services necessary to strengthen the security of your vehicle. We can immediately assist you, if you are having a lock and key problem and this will end your worries. We have experts in locksmithing that works 24x7x365 for non-stop assistance with no added charges. We can immediately send your our locksmith technicians, if ever you have emergency problem with your car locks, just call us. Our automotive locksmith services also include the following: - Transponder Chip Key - Broken Ignition Key Extraction - Transponder Key Programming - Lost Car Key Replacement - Key Duplication - Key Cutting - Vehicle Trunk Opening - Car Door Unlocking - GM, VAT Keys - Car Lockout Assistance Need our services now? Drop us a call and we promise to get back to you as soon as possible. --- # 2020 Chevy Silverado 2500HD LTZ Truck For Sale – Grove City, PA ## Pricing - MSRP: $70,750 - Available Savings: $3,668 - Internet Price: $67,082 ## Vehicle Location Diehl of Grove City 1685 West Main Street Extension Grove City, PA 16127 (724) 748-3575 ## Key Info - Mileage: 23 - Body: Truck - Drivetrain: 4X4 - Exterior: Summit White - Interior: Jet Black - Engine: Duramax 6.6L V8 Turbodiesel - Fuel Type: Diesel - Transmission: Automatic - Doors: 4 - Stock: G708 - VIN: 1GC4YPEY5LF116927 ## Vehicle Description Priced below KBB Fair Purchase Price! Summit White 2020 Silverado 2500HD Chevrolet LTZ 4D Crew Cab 4WD 10-Speed Automatic Duramax 6.6L V8 Turbodiesel --- ## Vehicle Details ### Package - Trailering Package includes trailer hitch, 7-pin connector and (CTT) Hitch Guidance (Deleted when (ZW9) pickup bed delete is ordered.) ### Mechanical - Engine, 6.6L V8 with Direct Injection and Variable Valve Timing, gasoline (401 hp @ 5200 rpm, 464 lb-ft torque @ 4000 rpm) - Transmission, 6-speed automatic, heavy-duty - Rear axle, 3.73 ratio - Durabed pickup bed - GVWR, 10,650 lbs. - Air filter, high-capacity; Air filtration monitoring - Transfer case, two-speed active electronic Autotrac with push button control - Differential, heavy-duty locking rear - Four wheel drive - Cooling, external engine oil cooler; auxiliary external transmission oil cooler - Battery, heavy-duty 720 cold-cranking amps/80 Amp-hr maintenance-free - Alternator, 170 amps - Advanced Trailering System (checklist, maintenance reminders, security alerts, mileage, diagnostics, Tire Pressure Monitor System) - Trailer brake controller, integrated - Fully-boxed frame - Recovery hooks, front, frame-mounted, Black - Suspension Package; Digital Variable Steering Assist; 4-wheel antilock disc brakes with DURALIFE rotors; brake lining wear indicator - Capless Fuel Fill ### Exterior - Wheels, 18" machined aluminum with Silver painted accents - Tires, LT275/70R18E all-terrain, blackwall; spare included - Tire carrier lock keyed to ignition/door key - Rear wheelhouse liners - Chrome front and rear bumpers; CornerStep rear bumper - Black BedStep on forward bed - Stainless-steel beltline moldings - Cargo tie-downs (12), rated 500 lbs per corner - Chrome grille bar with “CHEVROLET” and Gold bowtie emblem - LED headlamps with signature DRLs; LED taillamps - Cab-mounted cargo lamps with CHMSL switch - LED fog lamps - Power-adjustable, heated, auto-dimming trailering mirrors with turn signals, puddle lamps, perimeter/auxiliary lighting, power folding/extending - Chrome mirror caps, deep-tinted glass - Tailgate and bed rail protection cap; manual gate with EZ Lift and power lock/release - Chrome door handles ### Entertainment - Chevrolet Infotainment 3 Plus, 8" HD touchscreen, AM/FM, Bluetooth (2 devices), Apple CarPlay/Android Auto, voice recognition, in-vehicle apps, cloud personalization - SiriusXM Radio (3-month trial) - HD Radio; 6-speaker system; steering-wheel audio controls - Bluetooth phone connectivity - 4G LTE Wi-Fi Hotspot capable ### Interior - Front 40/20/40 split-bench seats with covered armrest/under-seat storage - Perforated leather-appointed front seats; heated driver and front passenger - 10-way power driver/passenger seats with lumbar; driver memory - Up-level rear 60/40 folding bench with storage, center armrest/cupholders, under-seat storage, child seat tether anchor - Color-keyed carpeting; rubberized-vinyl floor mats - Leather-wrapped, heated steering wheel; manual tilt/telescoping column with lock control - 6-gauge instrument cluster; 4.2" color Driver Information Center; radio-display temperature; instrument-cluster compass; Rear Seat Reminder - Power windows (front express up/down), rear express down - Power door locks; remote vehicle starter; Keyless Open and Start - Electronic cruise control; theft-deterrent system - USB ports (2 first row); SD card reader (with console); dual charge-only ports (2nd row) - 12-volt auxiliary outlets (front/rear); 120-volt outlets (instrument panel/bed) - Dual-zone automatic climate control; rear heating/cooling vents; rear-window defogger - Auto-dimming inside rearview mirror; assist handles ### Safety - StabiliTrak stability control with Proactive Roll Avoidance, traction control, electronic trailer sway control, hill start assist - Daytime Running Lamps with auto exterior lamp control - Dual-stage frontal airbags; seat-mounted side-impact airbags; head-curtain airbags; Passenger Sensing System - OnStar and Chevrolet connected services capable - HD Rear Vision Camera; Hitch Guidance/Hitch View - Teen Driver configurable feature with report card - Tire Pressure Monitoring System with Tire Fill Alert --- ## Installed Options - EXHAUST BRAKE - ENGINE, DURAMAX 6.6L TURBO-DIESEL V8 (Value: $9,890) • B20-Diesel Compatible • 445 Hp [332 KW] @ 2800 Rpm • 910 Lb-ft of Torque [1220 Nm] @ 1600 Rpm • REAR AXLE, 3.42 RATIO - SKID PLATES (Value: $150) • Protect the oil pan, front axle, transfer case - LAMPS, SMOKED AMBER ROOF MARKER (LED) (Value: $55) - WIRELESS CHARGING - BOSE SOUND SYSTEM, PREMIUM 7-SPEAKER SYSTEM with Richbass woofer - LPO, ALL-WEATHER FLOOR LINERS (1st & 2nd rows, includes Z71 logo on front mats) - WHEELS, 20" POLISHED ALUMINUM (6-spoke) (Value: $1,400) - ALTERNATOR, 220 AMPS (Value: $150) - CENTER CONSOLE, FLOOR-MOUNTED (cup holders, cell phone storage, power cord management, hanging file folder capability)	3,433	1,865	-2,497,637,004,303,057,000	concat	[ "concat_full" ]	0.75	true	null
-1,719,168,338,095,240,200	Donations collected for family displaced after Bethesda apartment fire A GoFundMe page has been set up for one of the families displaced after fire damaged an apartment complex in Bethesda. The fire happened early Tuesday morning on Sangamore Road. A total of seven occupants were displaced and two units were damaged. Investigators say the fire was caused by faulty electric and caused approximately $250K in damage. The fundraising page was set up to help the Whitley family. The post says that the family, which includes a school-aged child, lost everything in the fire. As of Thursday afternoon, a little over $1600 had been raised. Click here to donate: https://www.gofundme.com/valfirefund Top Ribbon Hairstyles for Short Hair Gallery Of Hairstyles Trends ribbon hairstyles for short hair ribbon hairstyles for short hair 63187 16 Pretty Ribbon Hairstyles From Pinterest MANEcessories 16 Pretty Ribbon Hairstyles From Pinterest MANEcessories 16 Pretty Ribbon Hairstyles From Pinterest MANEcessories from ribbon hairstyles for short hair, source:pinterest.com Other Collections of Top Ribbon Hairstyles for Short Hair Gallery Of Hairstyles Trends Ribbon Hairstyles for Short Hair 63187 Holiday Hair Tutorials Roundup Ribbon HairstyleRibbon Hairstyles for Short Hair 63187 Ribbon Updos for Short Hair Hair Makeup and Beauty In 2019Ribbon Hairstyles for Short Hair 63187 Up Do Hair with RibbonsRibbon Hairstyles for Short Hair 63187 12 Pretty Hairstyles with Ribbons Pretty DesignsRibbon Hairstyles for Short Hair 63187 60 Gotta Have Hairstyles for Any Special OccasionRibbon Hairstyles for Short Hair 63187 Mane Addicts the Prettiest Ribbon Hair Ideas From PinterestRibbon Hairstyles for Short Hair 63187 15 Ideas to Style Short Hair for Christmas StyleoholicRibbon Hairstyles for Short Hair 63187 Simple & Easy Hairstyles Incorporating Bows & Ribbon Leave a Reply Your email address will not be published. Required fields are marked *	## Donations Collected for Family Displaced After Bethesda Apartment Fire A GoFundMe page has been set up for one of the families displaced after fire damaged an apartment complex in Bethesda. Fire Details - Occurred early Tuesday morning on Sangamore Road - Seven occupants displaced; two units damaged - Cause: faulty electric - Estimated damage: ~$250,000 About the Whitley Family - Includes a school-aged child - Lost everything in the fire - Raised: $1,600+ (as of Thursday afternoon) Donate: https://www.gofundme.com/valfirefund --- # Top Ribbon Hairstyles for Short Hair Gallery Of Hairstyles Trends - ribbon hairstyles for short hair - ribbon hairstyles for short hair 63187 - 16 Pretty Ribbon Hairstyles From Pinterest MANEcessories - 16 Pretty Ribbon Hairstyles From Pinterest MANEcessories - 16 Pretty Ribbon Hairstyles From Pinterest MANEcessories - from ribbon hairstyles for short hair, source: pinterest.com ## Other Collections of Top Ribbon Hairstyles for Short Hair Gallery Of Hairstyles Trends - Ribbon Hairstyles for Short Hair 63187 Holiday Hair Tutorials Roundup Ribbon Hairstyle - Ribbon Hairstyles for Short Hair 63187 Ribbon Updos for Short Hair Hair Makeup and Beauty In 2019 - Ribbon Hairstyles for Short Hair 63187 Up Do Hair with Ribbons - Ribbon Hairstyles for Short Hair 63187 12 Pretty Hairstyles with Ribbons Pretty Designs - Ribbon Hairstyles for Short Hair 63187 60 Gotta Have Hairstyles for Any Special Occasion - Ribbon Hairstyles for Short Hair 63187 Mane Addicts the Prettiest Ribbon Hair Ideas From Pinterest - Ribbon Hairstyles for Short Hair 63187 15 Ideas to Style Short Hair for Christmas Styleoholic - Ribbon Hairstyles for Short Hair 63187 Simple & Easy Hairstyles Incorporating Bows & Ribbon	393	388	-1,719,168,338,095,240,200	concat	[ "concat_full" ]	0.75	true	null
773,156,520,472,470,700	(29 October 1939- / Patna, Bihar / India) Abhorred Emperor Vile emperor ruined in a coup fled to a false village in disguise In the street your skull stares on a spearmast too eye-witnesses rejoice the cut to size among the angry mob of the capital city In broken Bengali I declare on the wire go and loot each according to your kitty half torso be put on trial at the post office pyre not a dropp of blood to drip on earth but on tongue save for evil days in coffer of mushrooms when the cheekbones are full open your lungs If solution to fall does not illume make no plaint no plea as outposts are overrun come home O internees now ownership of curfew is fun. (Translation of 'Nyakkar Samrat' written in Bengali) User Rating: 5 / 5 ( 0 votes ) Comments (0) There is no comment submitted by members. Catalogue Registered User Already registered? Enter the Kara Club. Insert your e-mail address and the password to login. Enter a valid e-mail address Enter your password Remember this device Forgotten password? Kara Club's advantages Kara Club's members can take advantage free of charge of exclusive services and updated Kara Sardegna®'s news. Exclusive Discounts A lot of products in special offers! Faster orders The purchase is much faster: once the cart is full, you do not need to fill in the details again, avoiding to provide each time the buyer and the consignèe's details, important for the dispatch. Newsletter Kara Club's members receive periodically by e-mail a newsletter with the updated news and the promotions proposed. Orders under control All registered users can verify accurately the progress of the order and look at the summary of past orders made with Kara Sardegna®. Coupon All registered users accumulate credits in their eWallet each time they make a purchase or recommend Kara Sardegna® to a friend. Register now and start sharing!	## Abhorred Emperor 29 October 1939 – / Patna, Bihar / India (Translation of “Nyakkar Samrat” written in Bengali) Abhorred Emperor Vile emperor ruined in a coup fled to a false village in disguise In the street your skull stares on a spearmast too eye-witnesses rejoice the cut to size among the angry mob of the capital city In broken Bengali I declare on the wire go and loot each according to your kitty half torso be put on trial at the post office pyre not a dropp of blood to drip on earth but on tongue save for evil days in coffer of mushrooms when the cheekbones are full open your lungs If solution to fall does not illume make no plaint no plea as outposts are overrun come home O internees now ownership of curfew is fun. --- # Registered User Already registered? Enter the Kara Club. Login - Email address - Password - Remember this device - Forgotten password? # Kara Club’s advantages Kara Club’s members can take advantage free of charge of exclusive services and updated Kara Sardegna® news. - Exclusive Discounts A lot of products in special offers! - Faster orders The purchase is much faster: once the cart is full, you do not need to fill in the details again, avoiding to provide each time the buyer and the consignee’s details, important for the dispatch. - Newsletter Kara Club’s members receive periodically by e-mail a newsletter with the updated news and the promotions proposed. - Orders under control All registered users can verify accurately the progress of the order and look at the summary of past orders made with Kara Sardegna®. - Coupon All registered users accumulate credits in their eWallet each time they make a purchase or recommend Kara Sardegna® to a friend. Register now and start sharing!	425	412	773,156,520,472,470,700	concat	[ "concat_full" ]	0.75	true	null
2,075,815,676,967,270,000	Close Cellina Stokes ePRO® Crowne Realty Gateway to Your Mansion. John 14:2 Find a Home About Me Bio Cellina is a Texas Real Estate Broker that will go the extra mile for her clients. A true Texan, born in El Paso, TX, Cellina has been a Humble, TX resident since 1991. A graduate of Le Tourneau University of Texas with her Bachelor's degree in Business Administration, Cellina worked for Chevron for 8 years before becoming a full time Realtor�. Thinking out of the box, Cellina likes to put deals together to make dreams happen using her experience and knowledge of finance, contracts, negotiating, and marketing to her client's best advantage. Cellina's enthusiasm and dedication to her clients exceeds their expectations and fulfills their Real Estate needs, due to her old fashioned customer service coupled with today's 21st century technology. Cellina's enthusiasm and dedication to her clients exceeds their expectations and fulfills their Real Estate needs, due to her old fashioned customer service coupled with today's 21st century technology. Cellina specializes in Houston's north and northeast markets including: The areas of Humble, Atascocita, Kingwood, Huffman, Crosby, Spring and The Woodlands. Reliable and Professional Experienced Negotiator Million Dollar Producer Creative Problem Solver Excellent Communicator Uses enthusiastic marketing techniques Experience Working for You Complete Listing Services to accommodate the Seller's needs. http://web.har.com/usearealtor/dispSellers.cfm Complete Buyer Services for a confident purchase. It PAYS to work with a Realtor: Make the Right Choice Why Rent when you can buy? TREC #0507735 Designations Neighborhoods Activities Tweet October 02, 2019 Open House: Oct 2 2019 1:30PM Rental,$1050/m 77365 https://www.har.com/74011294 Crowne Realty #Porter #RealEstate More Activities Tools Download my app to get access to premium content Download my app to begin access to Premium Content such as Sold Price for nearby listings, Property History Reports and more. You will also receive email alerts when homes meet your search criteria and more. How to start Scan the QR Code Using HAR.com App you can scan this QR Code and instantly connect with me, Cellina Stokes. Benefits to you • View Premium Content not publicly available on the HAR.com App • Sold Price for nearby listings and Property History Reports You can access premium content from my website as well. Click here. Crowne Realty 20739 Emerald Spruce Ct, Humble, TX 77346 Get Directions Phone: (281) 446-8326 Fax: Western Pleasure Half Arabian Horses for Sale in South Carolina Half Arabian Mare Ellie is a 15 year old mare with a spunky attitude with the willingness to .. Summerville, South Carolina Bay Half Arabian Mare - Summerville, SC SC $2,000 Half Arabian Mare Beautiful Afire Bey V daughter. Sweepstakes Nominated great AOTR or JTR Pro.. Williamston, South Carolina Bay Half Arabian Mare - Williamston, SC SC $7,500 Half Arabian Stallion Shown successfully training level dressage and schooling up to second level.. Fort Mill, South Carolina Bay Half Arabian Stallion - Fort Mill, SC SC $7,500 Half Arabian Stallion PD Dream Dancer truly lives up to his name. This is one of the best colts w.. Liberty, South Carolina Bay Half Arabian Stallion - Liberty, SC SC $3,000 Half Arabian Stallion PD Wishful Dreamin - Is 5 months old a Bay with large star and a snip. He i.. Liberty, South Carolina Bay Half Arabian Stallion - Liberty, SC SC $1,000	# Cellina Stokes ePRO® Crowne Realty Gateway to Your Mansion. John 14:2 --- ## About Me ### Bio Cellina is a Texas Real Estate Broker that will go the extra mile for her clients. A true Texan, born in El Paso, TX, Cellina has been a Humble, TX resident since 1991. A graduate of Le Tourneau University of Texas with a Bachelor’s in Business Administration, she worked for Chevron for 8 years before becoming a full-time Realtor®. Thinking out of the box, Cellina puts deals together to make dreams happen using her experience and knowledge of finance, contracts, negotiating, and marketing to her clients’ best advantage. Her enthusiasm and dedication exceed expectations—old-fashioned customer service coupled with 21st-century technology. --- ## Specialties & Expertise - Houston’s north & northeast markets: - Humble, Atascocita, Kingwood, Huffman, Crosby, Spring, The Woodlands - Reliable & Professional - Experienced Negotiator - Million Dollar Producer - Creative Problem Solver - Excellent Communicator - Enthusiastic Marketing Techniques --- ## Services ### Complete Listing Services To accommodate the Seller’s needs: http://web.har.com/usearealtor/dispSellers.cfm ### Complete Buyer Services For a confident purchase. It PAYS to work with a Realtor: Make the Right Choice Why rent when you can buy? TREC #0507735 --- ## Tools & Premium Content Download my app to access: - Sold prices for nearby listings - Property history reports - Email alerts when homes meet your criteria How to start: Scan the QR code in the HAR.com App to instantly connect with Cellina and unlock premium content. --- ## Contact Crowne Realty 20739 Emerald Spruce Ct, Humble, TX 77346 Phone: (281) 446-8326 Fax: [number not provided] --- # Western Pleasure Half Arabian Horses for Sale in South Carolina - Half Arabian Mare Ellie is a 15 year old mare with a spunky attitude with the willingness to .. Location: Summerville, South Carolina Color: Bay Breed: Half Arabian Sex: Mare Price: $2,000 - Half Arabian Mare Beautiful Afire Bey V daughter. Sweepstakes Nominated great AOTR or JTR Pro.. Location: Williamston, South Carolina Color: Bay Breed: Half Arabian Sex: Mare Price: $7,500 - Half Arabian Stallion Shown successfully training level dressage and schooling up to second level.. Location: Fort Mill, South Carolina Color: Bay Breed: Half Arabian Sex: Stallion Price: $7,500 - Half Arabian Stallion PD Dream Dancer truly lives up to his name. This is one of the best colts w.. Location: Liberty, South Carolina Color: Bay Breed: Half Arabian Sex: Stallion Price: $3,000 - Half Arabian Stallion PD Wishful Dreamin – Is 5 months old, a bay with large star and a snip. He i.. Location: Liberty, South Carolina Color: Bay Breed: Half Arabian Sex: Stallion Price: $1,000	835	740	2,075,815,676,967,270,000	concat	[ "concat_full" ]	0.75	true	null
6,608,191,323,502,626,000	IVF-Infertility.com home Infertile after uterine cancer Discussion forum for those particularly interested in infertility. Infertile after uterine cancer Postby Annalias » Thu Oct 26, 2017 12:32 am My husband and I have been always dreaming about children. But unfortunately I was diagnosed with cancer of the uterus. The uterus, fallopian tubes and ovaries were removed. At first I was crying a lot, I had a depression and I was even attending a psychologist. My husband supported me and cheered me up as much as he could. I felt so guilty, I knew how much he wants to have kids and I let him down. I was afraid he’ll leave me. And I actually thought he have to do so and find another woman, who has no problems with fertility. But my husband gave me so much love and support and we decided not to give up. We choose surrogacy as the best way out for us. But we are from France and this procedure here is illegal. We’ve been thinking about clinics in USA first, but their prices are huge! That’s why we are looking for clinics in Europe. What should we consider? Any tips? Annalias Newbie Posts: 12 Joined: Thu Oct 26, 2017 12:29 am Sponsor Re: Infertile after uterine cancer Postby KimmyK » Sat Oct 28, 2017 7:50 pm Hi dear! I'm so sorry about your situation. But I'm happy to know you battled cancer! Unfortunately I've also faced infertility. My dh and I wanted to have children more than anything else. I've got pregnant when I was 22. I was warned about risks. My doctors told me I'm crazy if I leave a baby. My heart could not stand pregnancy. It might cause problems not only to my health, but baby's health as well. Also doctors told me there is high possibility I might die. All this scared me and I was confused. After long discussion with my dh we decided we should make it. I don't know if I regret about this decision. I don't know maybe I would regret my whole life if I made an abortion on early term. Unfortunately doctors made me to terminate pregnancy on 6th month. I had dyspnea, edema, blood circulation disorders. I felt pain in chest. My heart was aching not only because it was hard for it to work for two, but also because I knew I should make my choice. I had to choose either I will live or my baby and I will die. Unbearable pain had never left me. I think it will never fade away. We also decided to go abroad to have surrogacy. The clinic provided us with everything needed, so we felt absolutely comfortable in foreign country. We were met in the airport. We were provided with a taxi and it was transporting us to the clinic and to our apt. Btw, housing was also provided by the clinic. The whole process was under their control. They found surrogate mother for us in 2,5 months. We paid approximately 40 000 euros for everything. We didn't choose a surrogate mother by ourselves. Her appearance doesn't matter. The most important are her health and ability to bear a child. So our doctor chose sm for us. Surrogacy is perfect option in your case. Be very careful in your search. There are hundreds of fake agencies. They take money away from miserable people and continue to live happily. That's why I advise you to contact clinics directly. Good luck, dear! KimmyK Newbie Posts: 12 Joined: Fri Jul 22, 2016 7:52 pm Re: Infertile after uterine cancer Postby Annalias » Sat Oct 28, 2017 9:38 pm Thank you so much for support! You are so kind. I'm so sorry about your loss. We are really lucky to have such supportive husbands. Honestly I don't know what would've I done without my DH. He's really amazing person. I'm so grateful I have him in my life. I'm happy for you. Thanks for sharing your experience! I'll follow your advices. I'll do my best to stay positive. I appreciate your help! Annalias Newbie Posts: 12 Joined: Thu Oct 26, 2017 12:29 am Re: Infertile after uterine cancer Postby Annalias » Sat Oct 28, 2017 9:42 pm Hello everyone who is following my thread! I'm so lucky I found this community. I found tons of useful information here. As you know my husband and I are looking into surrogacy option. In our country surrogacy is illegal. So we're thinking about going abroad. Because of this, we will probably have to dig more and look for not only details about surrogacy process but also about legal aspects in different countries. That's why we are thinking about meeting with the lawyer in a couple of days. I think this is the best thing to start with our search. I hope the lawyer will share information about laws and rules considering surrogacy abroad. We've already made a list with some questions which we would like to ask the lawyer. Maybe you have some advices what is needed to be asked? I will appreciate if you help us with this task. I'm a little bit nervous. I really hope what the lawyer will help us to clarify some questions. I hope after our meeting it will be easier to find reproductive center where we could go to start our surrogacy process. Annalias Newbie Posts: 12 Joined: Thu Oct 26, 2017 12:29 am Re: Infertile after uterine cancer Postby Annalias » Sat Oct 28, 2017 9:52 pm I should say there is something on my mind which is bothering me. I really want to share it with you. Maybe you can relate to my situation and you will understand how I feel. I should say I was feeling sad last couple of weeks. The reason of it is that wife of my husband's brother gave birth to a wonderful girl. This is their second baby. My husband and I went to their house to visit them after delivery. Though I should say it was really hard for both of us. I'm happy for them and for their children. They have really amazing family. I wish we could also have children. I'm sure they would make our life different. So we went to visit them. When I saw a little baby girl I started to cry. She's so beautiful tiny little cutie. I was crying because I was happy for them. Also I was feeling sorry both for myself and my husband. I've noticed that when my husband was holding baby girl in his arms, he was also about to cry. This was a very tough moment for us. When we get home we didn't talk at all. Each of us was thinking about our infertility and our desire to have children. At least I was. After our visit my husband seems different. He doesn't talk that much. He comes home late from work. When I talk to him it seems he's somewhere else. To be honest it scares me. He doesn't talk to me. I started to think up stuff in my head which make me feel nervous. I understand this is hard for him to see that his younger brother is having his second child. I understand that all blame is on me. I'm so scared that he may decide to leave me because I can't give him what he wants the most. That's why I do everything so our surrogacy procedure could start as soon as possible. I hope that our journey will give us strength to keep going till the end. Annalias Newbie Posts: 12 Joined: Thu Oct 26, 2017 12:29 am Re: Infertile after uterine cancer Postby Ghost » Sun Oct 29, 2017 5:21 am Yes, the USA has the highest prices, by far. Also the highest success rates, by far. Some centers are near 80% live birth rate after transfer of single thawed blastocysts. Surrogacy is legal in the USA, although some states have some regulations on it. Avoid IVF and surrogacy in Ukraine. Ukrainian centers pay shills to post here under numerous sock accounts pretending to be patients in Ukraine. Centers using such deceptive advertising cannot be trusted and should be avoided. Ghost Board Veteran Posts: 4151 Joined: Mon May 29, 2006 5:01 pm Re: Infertile after uterine cancer Postby SarahS » Wed Nov 01, 2017 9:01 am You are a cancer survivor. That is so encouraging. It means that you will get through this too. You can still be a mother through surrogacy or adoption. The fact that you are looking for a clinic tells me that you want surrogate motherhood. Excellent choice! In Europe the procedure is much cheaper compared to the USA. I sought IVF treatment in May in Kiev, Ukraine. Cost me $5000 inclusive of accommodation. Sadly I had a MC at 12w9d. Had an accident and the shock was just too much. I am preparing for FET in January. Hope you find the best clinic. SarahS Newbie Posts: 3 Joined: Thu Aug 10, 2017 6:24 am Re: Infertile after uterine cancer Postby Rita10 » Mon Nov 06, 2017 9:08 pm Hello. I’ve gone through the surrogacy with my sister. She was suffering from infertility for 6 years. IVF didn’t help her that’s why she decided to try the surrogacy. As a result, her twin boys were born by the surrogate. They are so amazing. I didn’t believe that surrogacy really works. But it’s true. I’m very glad that you didn’t give up. You made the right choice. I’m sure that surrogacy will help you make your dream come true. I know that there are a lot of good clinics in Europe. They really offer pretty affordable prices. Try to visit several clinics in Ukraine. I’m sure you will like some of them. Doctors there are real professionals. They take a good care of each couple. And, what is the main, surrogacy is legal there. But, anyway, you will need a lawyer. You will have to sign an agreement with your surrogate. I know a lot of couples, which became parents with the help of surrogacy. I’m sure you will be among them soon. Try to talk to your husband. You are going through difficulties now. You have to support each other. It is very important to be a family. Together you will fight this problem faster. I know that you are scared. I remember how scared my sister was. But everything worked out. You have to believe that everything will be fine. Stay positive and keep trying. All your dreams will come true soon. Rita10 Newbie Posts: 10 Joined: Wed Oct 18, 2017 9:14 pm Re: Infertile after uterine cancer Postby Butterfly27 » Tue Nov 07, 2017 10:27 am Your story made me cry. Life can be really unfair! Honey, I'm glad to see that you don't give up! I'm sure you'll get what you want. We should always fight for our dreams and goals no matter what. . So, girls, be brave and fight for your happiness! Butterfly27 Newbie Posts: 7 Joined: Mon Nov 06, 2017 4:50 pm Re: Infertile after uterine cancer Postby Estellla » Mon Dec 04, 2017 11:22 pm I'm really sorry you have to go through such pain. I know that this is really hard to be strong in such situation. I had 6 miscarriages. I completely understand the reason why you chose such method to stop feeling the pain. We have been trying to conceive for 8 years. These years were a nightmare for us. I am very lucky I have supportive husband. But his and mine parents make the situation worse. They can't stop asking when we will give them grandchildren. They can't stop blaming me in inability to have children. They can't stop turning my life into a nightmare. In such situation it is very hard not to give up and stop trying. I've changed so many doctors, so many hospitals. I've tried literally everything to get pregnant and the most important to save the pregnancy. Unfortunately nothing worked for me. We wasted so much money and nerves and got nothing in result. After the pain we went through I'm actually surprised that we still have tiny bit of hope. We are thinking about the surrogacy option. This is our last chance and we want to use it. Dear I wish you all the best! I hope you will find answers to your questions. I wish you to find an option which will help you to become a mother! Estellla Newbie Posts: 15 Joined: Mon Dec 04, 2017 10:42 pm Re: Infertile after uterine cancer Postby loishow » Sun Feb 25, 2018 9:06 pm I know how it feels. It's very nice you didn't give up, despite the fact that it’s hard not to in such situation. I also had uterine cancer. One night I woke up because of sharp pain in abdomen and found out that I was bleeding. I underwent surgery and all reproductive organs were removed. It was a big shock for me and I almost gave up. My husband wanted a son so much and I knew I couldn't fulfill his wish. I began to look for solutions, clinics, doctors. I wanted to do everything to save my marriage and my will to live. After a long search, conversations with friends, reading of articles and reviews, we decided to focus on surrogacy. In our country it’s legal, but very expensive and we couldn't afford it. So we began to look for clinics in other countries. We wanted to find the best doctors and, at the same time, affordable price. Now we have a wonderful healthy boy. My husband and I are very happy and grateful. I would advise you to be careful! There are so many fake agencies, which want to take all your money and leave you with nothing. Pay attention to positive reviews, talk with friends, maybe they know someone who has experience in this sphere. Also don’t forget to check official websites and contact clinics directly! Ask them questions, look through their services and prices. Google them and learn each review. Then weigh all pros and cons and choose the right one for you! Good luck! loishow Newbie Posts: 5 Joined: Tue May 09, 2017 12:58 pm Re: Infertile after uterine cancer Postby Annalias » Sun Feb 25, 2018 9:16 pm Hello everyone! How are you? What news do you have? Thank you for replies. You helped a lot! I'm sorry I wasn't active for a while. I've been very busy with preparation to our surrogacy journey. Next month we'll go to fertility clinic! Though I'm super nervous, but I'm very excited! We've been waiting for this moment for such a long time. I can't believe it's finally happening! We've already booked flight tickets. I've already started to pack, though my dh thinks it's too early)) Well I can do nothing with myself! I'm thinking about surrogacy 24/7 and counting days till we met with the dr. I'll update when we'll get back home. Wish us luck! Annalias Newbie Posts: 12 Joined: Thu Oct 26, 2017 12:29 am Re: Infertile after uterine cancer Postby Anna-WWW » Tue Mar 06, 2018 9:17 pm I agree, USA offers too high prices for the surrogacy. When my husband and me found out about my infertility, we agreed to try the surrogacy. But we had to visit a lot of clinics around the world to find the best one with the most affordable prices. We are not rich at all. So, we were not ready to pay that huge amount of money. But we desperately wanted to have kids. I’m very sorry that this service is so expensive. A lot of infertile couples just have no chance to afford it. This is a huge problem of modern medicine. But I’m glad that some countries offer lower rates. I recommend you to choose a couple of clinics around the world. Contact them and ask about the prices. After that you can visit some of them to make sure that they offer high quality service. And having all the necessary info, you will be able to choose the one you like most of all. After that you can sign an agreement and start the surrogacy process. As usual it takes 9-12 months to get a baby. As for me it is much faster than adoption. After the embryo transfer you can go home. You will have to wait for 3 weeks to find out the result. I remember those 3 weeks. It was the most difficult period of my life. I dreamed to receive a call from our doctor. I desperately wanted to hear the positive result. And once it happened. Our doctor called us and said that the surrogate was pregnant. It was the moment, which changed our life. We started the preparation for the day, when we bring our baby home. I was looking at my husband and I saw how happy he was. Our dream was about to come true. So, the surrogacy saved our life and our marriage. That’s’ why I agree that it works. Anna-WWW Newbie Posts: 13 Joined: Thu Oct 05, 2017 1:06 pm Re: Infertile after uterine cancer Postby Ghost » Thu Mar 08, 2018 3:00 am Anna-WWW wrote: But we had to visit a lot of clinics around the world to find the best one with the most affordable prices. Of course. After all those travel expenses, you would need an inexpensive clinic. But surrogacy is an unnecessary expense, a waste of money, for most infertility patients. It should be used only by those that truly need it. It is also legally risky, with occasional horror stories and legal problems. Recently, I have heard of French couples that could not get health care coverage for their children because the government did not recognize the children born of surrogates as their children. If you must go that route, then sure. But it’s a bad option if you don’t need it. Surrogacy does rake in lots of money for clinics, so they understandably pay many people to advertise it on the internet by pretending to be patients. Avoid IVF and surrogacy in Ukraine. Ukrainian centers pay shills to post here under numerous sock accounts pretending to be patients in Ukraine. Centers using such deceptive advertising cannot be trusted and should be avoided. Ghost Board Veteran Posts: 4151 Joined: Mon May 29, 2006 5:01 pm Re: Infertile after uterine cancer Postby Sindy-March » Sat Apr 14, 2018 4:35 pm As for me, surrogacy is a good idea. As you have no other options, you can go for the surrogacy. There’s no need to live childless. You should use your last chance to get a baby. Choose a good clinic and do everything in the best way. I’m sure your husband will support you. Good luck! Sindy-March Newbie Posts: 5 Joined: Fri Oct 13, 2017 8:02 pm Return to Infertility Who is online Users browsing this forum: No registered users and 0 guests cron Update to Breakthrough to Your Miracle Book Review “Heal the sick, cleanse the lepers, raise the dead, cast out devils: freely ye have received, freely give.” Matthew 10:8 I am currently on the Breakthrough Online Event featuring the movie that airs tomorrow and Pastor Jason Noble’s book. I am disappointed that he is selling a study and a “13-Week Breakthrough Experience” for $129 (at a discount for people attending the event). Yes, God’s servants need to be provided for, but He gave so much to John and to the church through the miracles He performed after John was raised from the dead, couldn’t Pastor Noble have offered the “experience” for cost of production? Continue reading Update to Breakthrough to Your Miracle Book Review 8 Things I’ve Learned from God’s Healing guitar-kite On January 1, 2011, Keith and I were observing the San Diego Kite Club flying kites on the beach. A stranger came up to me and asked, “Would you like to have this kite?” Almost six weeks after the Lord miraculously healed me of fibromyalgia and chronic fatigue. Another test of my faith. Do I have the energy and strength to get this heavy thing in the air? Continue reading 8 Things I’ve Learned from God’s Healing 12 Quotes from Christ the Healer image F.F. Bosworth’s Christ the Healer is truth for today. Keith and I read this book after the many times that I had been prayed for and anointed with oil for healing from fibromyalgia and chronic fatigue syndrome. After Keith read this book, he told me that he was going to preach a sermon after the Lord healed me. That was two years before God miraculously healed me on November 21, 2010. In January, 2011, he did preach on God’s healing touch. In the two-year interval from God’s promise to His healing, we pressed into the Lord, and He blessed us with His presence and comfort as He gently shared the Scriptures with us in a new way, removing the church traditions that we had learned about healing and spiritual gifts only being for the early church and not for today. We learned that God still heals today – through miracles, through physicians and modern medicine, and in His timing, whether in this life or in eternity. Continue reading 12 Quotes from Christ the Healer Experiencing the Supernatural – A Review For some Christians, the physical world dominates their thinking and their actions. They miss much of the supernatural experience that is available to them. Rabbi Schneider, a Messianic Jewish Rabbi, challenges the readers to ask if they live as if God’s Word is superior and “reigns above the visible world.” (p. 16) What if Christians lived like they really believed what Scripture reveals? Experiencing the Supernatural: How to Saturate Your Life with the Power and Presence of God is a thoughtful examination of the power of God that is available to each Christian. Continue reading Experiencing the Supernatural – A Review Gifts from Heaven … 40 stories of answered prayer Prayer. Christians pray, and they wait. They pray more earnestly, and they wait in expectation. It’s the last minute. Is God going to intervene? Thirty-nine authors, 40 true stories. Forty answered prayers. Just in time. Continue reading Gifts from Heaven … 40 stories of answered prayer You can live with Jesus forever! Palm leaves - 1 copy Finally, the time had arrived. Jesus’ time. The time to show Himself as the long-awaited Messiah. The Great Promise! Jesus mounted a young colt and rode down the Mount of Olives as the crowd hailed Him as King, laying down their cloaks and palm branches before Jesus, their King. As he was drawing near—already on the way down the Mount of Olives—the whole multitude of his disciples began to rejoice and praise God with a loud voice for all the mighty works that they had seen, saying, “Blessed is the King who comes in the name of the Lord! Peace in heaven and glory in the highest!” Luke 19:37-38 Word had spread about His mighty works … healing the blind, deaf, and lame; feeding the 5,000, calming the storm, and raising Lazarus from the dead. This Son of Man was the Messiah destined to save all of Israel and set up His kingdom. He was born for this. It was prophesied. It was promised. Psalm 118 was one of the traditional Psalms that the Jews sang during the Passover feast. This is the day which the LORD hath made; we will rejoice and be glad in it. Save now, I beseech thee, O LORD: O LORD, I beseech thee, send now prosperity. Blessed be he that comes in the name of the LORD: we have blessed you out of the house of the LORD. Psalm 118:24-26 Jesus rode the colt on the same route the Passover Lamb took that day. The LORD is God, and he has made his light to shine upon us. Bind the festal sacrifice with cords, up to the horns of the altar! Psalm 118:27 Jesus was the festal sacrifice. It would not be necesary to pay for the sins of the people again with a Passover Lamb. Jesus was the Passover Lamb. Jesus paid the price, once, for all. All that was necessary to be saved from sin after Jesus was crucified was to abide in Him. That is the greatest miracle of all, isn’t it? Our Great God, our Creator God, gave the world the greatest gift He could ever give, His only begotten Son, Jesus, as the One who would pay the price of our sins, death on the cross, so that we could live with Him forever. In Jesus, we have peace with God. In Jesus, we can come boldly before the throne of God and call Him “Abba, Father” … Daddy! Do you know this kind of love, this wonderful Savior? You can know Jesus today. Please pray: God, I am so sorry that I have sinned against You. I want to know You. I want the gift of salvation that You have for me. Please forgive me of my sins. I want to give my life to You. Teach me how to know You and to abide in Jesus. Thank You for saving me, so that I can live with You forever. In Jesus’ name, Amen. Your next steps: • Tell another Christian that you just gave your live to God. • Find a Bible-preaching church and start attending it. • Start reading the Bible. You might want to start with the Book of John. • You might want to check out the free resources at BlueLetterBible.org. If you just gave your life to God, please tell us in the Comment Section, and we will be praying for you. My prayer: Father in heaven, thank You for sending Jesus to live among us, to teach us, to perform mighty works for us, to show us perfection, and finally, to pay the price of our sins, so that we would not have to live eternity away from You. Father, Your love is higher, wider, and deeper than we can understand. Your grace and mercy are beyond measure. If there are any who are reading this post who do not know You, I pray for them, Father. Show Yourself to them, and soften their hearts to trust You for their salvation. Thank You for Jesus, our Savior. In His name, we pray. Please share this salvation message widely with your followers and friends.	# Infertile after uterine cancer Annalias (Thu Oct 26, 2017 12:32 am) > My husband and I have been always dreaming about children. But unfortunately I was diagnosed with cancer of the uterus. The uterus, fallopian tubes and ovaries were removed. At first I was crying a lot, I had a depression and I was even attending a psychologist. My husband supported me and cheered me up as much as he could. I felt so guilty, I knew how much he wants to have kids and I let him down. I was afraid he’ll leave me. And I actually thought he have to do so and find another woman, who has no problems with fertility. But my husband gave me so much love and support and we decided not to give up. We choose surrogacy as the best way out for us. But we are from France and this procedure here is illegal. We’ve been thinking about clinics in USA first, but their prices are huge! That’s why we are looking for clinics in Europe. What should we consider? Any tips? --- KimmyK (Sat Oct 28, 2017 7:50 pm) > Hi dear! I'm so sorry about your situation. But I'm happy to know you battled cancer! Unfortunately I've also faced infertility. My dh and I wanted to have children more than anything else. I've got pregnant when I was 22. I was warned about risks. My doctors told me I'm crazy if I leave a baby. My heart could not stand pregnancy. It might cause problems not only to my health, but baby's health as well. Also doctors told me there is high possibility I might die. All this scared me and I was confused. After long discussion with my dh we decided we should make it. > > I don't know if I regret about this decision. I don't know maybe I would regret my whole life if I made an abortion on early term. Unfortunately doctors made me to terminate pregnancy on 6th month. I had dyspnea, edema, blood circulation disorders. I felt pain in chest. My heart was aching not only because it was hard for it to work for two, but also because I knew I should make my choice. I had to choose either I will live or my baby and I will die. Unbearable pain had never left me. I think it will never fade away. > > We also decided to go abroad to have surrogacy. The clinic provided us with everything needed, so we felt absolutely comfortable in foreign country. We were met in the airport. We were provided with a taxi and it was transporting us to the clinic and to our apt. Btw, housing was also provided by the clinic. The whole process was under their control. They found surrogate mother for us in 2,5 months. We paid approximately 40 000 euros for everything. We didn't choose a surrogate mother by ourselves. Her appearance doesn't matter. The most important are her health and ability to bear a child. So our doctor chose sm for us. > > Surrogacy is perfect option in your case. Be very careful in your search. There are hundreds of fake agencies. They take money away from miserable people and continue to live happily. That's why I advise you to contact clinics directly. Good luck, dear! --- Annalias (Sat Oct 28, 2017 9:38 pm) > Thank you so much for support! You are so kind. I'm so sorry about your loss. We are really lucky to have such supportive husbands. Honestly I don't know what would've I done without my DH. He's really amazing person. I'm so grateful I have him in my life. I'm happy for you. Thanks for sharing your experience! I'll follow your advices. I'll do my best to stay positive. I appreciate your help! --- Annalias (Sat Oct 28, 2017 9:42 pm) > Hello everyone who is following my thread! I'm so lucky I found this community. I found tons of useful information here. As you know my husband and I are looking into surrogacy option. In our country surrogacy is illegal. So we're thinking about going abroad. Because of this, we will probably have to dig more and look for not only details about surrogacy process but also about legal aspects in different countries. That's why we are thinking about meeting with the lawyer in a couple of days. I think this is the best thing to start with our search. I hope the lawyer will share information about laws and rules considering surrogacy abroad. We've already made a list with some questions which we would like to ask the lawyer. Maybe you have some advices what is needed to be asked? I will appreciate if you help us with this task. I'm a little bit nervous. I really hope what the lawyer will help us to clarify some questions. I hope after our meeting it will be easier to find reproductive center where we could go to start our surrogacy process. --- Annalias (Sat Oct 28, 2017 9:52 pm) > I should say there is something on my mind which is bothering me. I really want to share it with you. Maybe you can relate to my situation and you will understand how I feel. I should say I was feeling sad last couple of weeks. The reason of it is that wife of my husband's brother gave birth to a wonderful girl. This is their second baby. My husband and I went to their house to visit them after delivery. Though I should say it was really hard for both of us. I'm happy for them and for their children. They have really amazing family. I wish we could also have children. I'm sure they would make our life different. So we went to visit them. When I saw a little baby girl I started to cry. She's so beautiful tiny little cutie. I was crying because I was happy for them. Also I was feeling sorry both for myself and my husband. I've noticed that when my husband was holding baby girl in his arms, he was also about to cry. This was a very tough moment for us. When we get home we didn't talk at all. Each of us was thinking about our infertility and our desire to have children. At least I was. After our visit my husband seems different. He doesn't talk that much. He comes home late from work. When I talk to him it seems he's somewhere else. To be honest it scares me. He doesn't talk to me. I started to think up stuff in my head which make me feel nervous. I understand this is hard for him to see that his younger brother is having his second child. I understand that all blame is on me. I'm so scared that he may decide to leave me because I can't give him what he wants the most. That's why I do everything so our surrogacy procedure could start as soon as possible. I hope that our journey will give us strength to keep going till the end. --- Ghost (Sun Oct 29, 2017 5:21 am) > Yes, the USA has the highest prices, by far. Also the highest success rates, by far. Some centers are near 80% live birth rate after transfer of single thawed blastocysts. > > Surrogacy is legal in the USA, although some states have some regulations on it. > Avoid IVF and surrogacy in Ukraine. Ukrainian centers pay shills to post here under numerous sock accounts pretending to be patients in Ukraine. Centers using such deceptive advertising cannot be trusted and should be avoided. --- SarahS (Wed Nov 01, 2017 9:01 am) > You are a cancer survivor. That is so encouraging. It means that you will get through this too. You can still be a mother through surrogacy or adoption. The fact that you are looking for a clinic tells me that you want surrogate motherhood. Excellent choice! In Europe the procedure is much cheaper compared to the USA. I sought IVF treatment in May in Kiev, Ukraine. Cost me $5000 inclusive of accommodation. Sadly I had a MC at 12w9d. Had an accident and the shock was just too much. I am preparing for FET in January. Hope you find the best clinic. --- Rita10 (Mon Nov 06, 2017 9:08 pm) > Hello. I’ve gone through the surrogacy with my sister. She was suffering from infertility for 6 years. IVF didn’t help her that’s why she decided to try the surrogacy. As a result, her twin boys were born by the surrogate. They are so amazing. I didn’t believe that surrogacy really works. But it’s true. I’m very glad that you didn’t give up. You made the right choice. I’m sure that surrogacy will help you make your dream come true. > > I know that there are a lot of good clinics in Europe. They really offer pretty affordable prices. Try to visit several clinics in Ukraine. I’m sure you will like some of them. Doctors there are real professionals. They take a good care of each couple. And, what is the main, surrogacy is legal there. But, anyway, you will need a lawyer. You will have to sign an agreement with your surrogate. > > I know a lot of couples, which became parents with the help of surrogacy. I’m sure you will be among them soon. Try to talk to your husband. You are going through difficulties now. You have to support each other. It is very important to be a family. Together you will fight this problem faster. I know that you are scared. I remember how scared my sister was. But everything worked out. You have to believe that everything will be fine. Stay positive and keep trying. All your dreams will come true soon. --- Butterfly27 (Tue Nov 07, 2017 10:27 am) > Your story made me cry. Life can be really unfair! Honey, I'm glad to see that you don't give up! I'm sure you'll get what you want. We should always fight for our dreams and goals no matter what. So, girls, be brave and fight for your happiness! --- Estellla (Mon Dec 04, 2017 11:22 pm) > I'm really sorry you have to go through such pain. I know that this is really hard to be strong in such situation. I had 6 miscarriages. I completely understand the reason why you chose such method to stop feeling the pain. We have been trying to conceive for 8 years. These years were a nightmare for us. I am very lucky I have supportive husband. But his and mine parents make the situation worse. They can't stop asking when we will give them grandchildren. They can't stop blaming me in inability to have children. They can't stop turning my life into a nightmare. In such situation it is very hard not to give up and stop trying. I've changed so many doctors, so many hospitals. I've tried literally everything to get pregnant and the most important to save the pregnancy. Unfortunately nothing worked for me. We wasted so much money and nerves and got nothing in result. After the pain we went through I'm actually surprised that we still have tiny bit of hope. We are thinking about the surrogacy option. This is our last chance and we want to use it. Dear I wish you all the best! I hope you will find answers to your questions. I wish you to find an option which will help you to become a mother! --- loishow (Sun Feb 25, 2018 9:06 pm) > I know how it feels. It's very nice you didn't give up, despite the fact that it’s hard not to in such situation. I also had uterine cancer. One night I woke up because of sharp pain in abdomen and found out that I was bleeding. I underwent surgery and all reproductive organs were removed. It was a big shock for me and I almost gave up. My husband wanted a son so much and I knew I couldn't fulfill his wish. I began to look for solutions, clinics, doctors. I wanted to do everything to save my marriage and my will to live. After a long search, conversations with friends, reading of articles and reviews, we decided to focus on surrogacy. In our country it’s legal, but very expensive and we couldn't afford it. So we began to look for clinics in other countries. We wanted to find the best doctors and, at the same time, affordable price. Now we have a wonderful healthy boy. My husband and I are very happy and grateful. I would advise you to be careful! There are so many fake agencies, which want to take all your money and leave you with nothing. Pay attention to positive reviews, talk with friends, maybe they know someone who has experience in this sphere. Also don’t forget to check official websites and contact clinics directly! Ask them questions, look through their services and prices. Google them and learn each review. Then weigh all pros and cons and choose the right one for you! Good luck! --- Annalias (Sun Feb 25, 2018 9:16 pm) > Hello everyone! How are you? What news do you have? Thank you for replies. You helped a lot! I'm sorry I wasn't active for a while. I've been very busy with preparation to our surrogacy journey. Next month we'll go to fertility clinic! Though I'm super nervous, but I'm very excited! We've been waiting for this moment for such a long time. I can't believe it's finally happening! We've already booked flight tickets. I've already started to pack, though my dh thinks it's too early)) Well I can do nothing with myself! I'm thinking about surrogacy 24/7 and counting days till we met with the dr. I'll update when we'll get back home. Wish us luck! --- Anna-WWW (Tue Mar 06, 2018 9:17 pm) > I agree, USA offers too high prices for the surrogacy. When my husband and me found out about my infertility, we agreed to try the surrogacy. But we had to visit a lot of clinics around the world to find the best one with the most affordable prices. We are not rich at all. So, we were not ready to pay that huge amount of money. But we desperately wanted to have kids. I’m very sorry that this service is so expensive. A lot of infertile couples just have no chance to afford it. This is a huge problem of modern medicine. But I’m glad that some countries offer lower rates. > > I recommend you to choose a couple of clinics around the world. Contact them and ask about the prices. After that you can visit some of them to make sure that they offer high quality service. And having all the necessary info, you will be able to choose the one you like most of all. After that you can sign an agreement and start the surrogacy process. > > As usual it takes 9-12 months to get a baby. As for me it is much faster than adoption. After the embryo transfer you can go home. You will have to wait for 3 weeks to find out the result. I remember those 3 weeks. It was the most difficult period of my life. I dreamed to receive a call from our doctor. I desperately wanted to hear the positive result. And once it happened. Our doctor called us and said that the surrogate was pregnant. > > It was the moment, which changed our life. We started the preparation for the day, when we bring our baby home. I was looking at my husband and I saw how happy he was. Our dream was about to come true. So, the surrogacy saved our life and our marriage. That’s’ why I agree that it works. --- Ghost (Thu Mar 08, 2018 3:00 am) > Anna-WWW wrote: > > But we had to visit a lot of clinics around the world to find the best one with the most affordable prices. > > Of course. After all those travel expenses, you would need an inexpensive clinic. > > But surrogacy is an unnecessary expense, a waste of money, for most infertility patients. It should be used only by those that truly need it. It is also legally risky, with occasional horror stories and legal problems. Recently, I have heard of French couples that could not get health care coverage for their children because the government did not recognize the children born of surrogates as their children. If you must go that route, then sure. But it’s a bad option if you don’t need it. > > Surrogacy does rake in lots of money for clinics, so they understandably pay many people to advertise it on the internet by pretending to be patients. > Avoid IVF and surrogacy in Ukraine. Ukrainian centers pay shills to post here under numerous sock accounts pretending to be patients in Ukraine. Centers using such deceptive advertising cannot be trusted and should be avoided. --- Sindy-March (Sat Apr 14, 2018 4:35 pm) > As for me, surrogacy is a good idea. As you have no other options, you can go for the surrogacy. There’s no need to live childless. You should use your last chance to get a baby. Choose a good clinic and do everything in the best way. I’m sure your husband will support you. Good luck! --- # Update to Breakthrough to Your Miracle Book Review > “Heal the sick, cleanse the lepers, raise the dead, cast out devils: freely ye have received, freely give.” > Matthew 10:8 I am currently on the Breakthrough Online Event featuring the movie that airs tomorrow and Pastor Jason Noble’s book. I am disappointed that he is selling a study and a “13-Week Breakthrough Experience” for \$129 (at a discount for people attending the event). Yes, God’s servants need to be provided for, but He gave so much to John and to the church through the miracles He performed after John was raised from the dead—couldn’t Pastor Noble have offered the “experience” for cost of production? --- ## 8 Things I’ve Learned from God’s Healing On January 1, 2011, Keith and I were observing the San Diego Kite Club flying kites on the beach. A stranger came up to me and asked, “Would you like to have this kite?” Almost six weeks after the Lord miraculously healed me of fibromyalgia and chronic fatigue. Another test of my faith. Do I have the energy and strength to get this heavy thing in the air? --- ## 12 Quotes from Christ the Healer F.F. Bosworth’s Christ the Healer is truth for today. Keith and I read this book after the many times that I had been prayed for and anointed with oil for healing from fibromyalgia and chronic fatigue syndrome. After Keith read this book, he told me that he was going to preach a sermon after the Lord healed me. That was two years before God miraculously healed me on November 21, 2010. In January 2011, he did preach on God’s healing touch. In the two-year interval from God’s promise to His healing, we pressed into the Lord, and He blessed us with His presence and comfort as He gently shared the Scriptures with us in a new way, removing the church traditions that we had learned about healing and spiritual gifts only being for the early church and not for today. We learned that God still heals today – through miracles, through physicians and modern medicine, and in His timing, whether in this life or in eternity. --- ## Experiencing the Supernatural – A Review For some Christians, the physical world dominates their thinking and their actions. They miss much of the supernatural experience that is available to them. Rabbi Schneider, a Messianic Jewish Rabbi, challenges the readers to ask if they live as if God’s Word is superior and “reigns above the visible world.” (p. 16) What if Christians lived like they really believed what Scripture reveals? Experiencing the Supernatural: How to Saturate Your Life with the Power and Presence of God is a thoughtful examination of the power of God that is available to each Christian. --- ## Gifts from Heaven … 40 stories of answered prayer Prayer. Christians pray, and they wait. They pray more earnestly, and they wait in expectation. It’s the last minute. Is God going to intervene? Thirty-nine authors, forty true stories. Forty answered prayers. Just in time. --- ## You can live with Jesus forever! Finally, the time had arrived. Jesus’ time. The time to show Himself as the long-awaited Messiah. The Great Promise! Jesus mounted a young colt and rode down the Mount of Olives as the crowd hailed Him as King, laying down their cloaks and palm branches before Him. > As he was drawing near—already on the way down the Mount of Olives—the whole multitude of his disciples began to rejoice and praise God with a loud voice for all the mighty works that they had seen, saying, > “Blessed is the King who comes in the name of the Lord! Peace in heaven and glory in the highest!” > Luke 19:37-38 Word had spread about His mighty works: healing the blind, deaf, and lame; feeding the 5,000; calming the storm; and raising Lazarus from the dead. This Son of Man was the Messiah destined to save all of Israel and set up His kingdom. He was born for this. It was prophesied. It was promised. > This is the day which the LORD hath made; we will rejoice and be glad in it. > Save now, I beseech thee, O LORD: O LORD, I beseech thee, send now prosperity. > Blessed be he that comes in the name of the LORD: we have blessed you out of the house of the LORD. > Psalm 118:24-26 Jesus rode the colt on the same route the Passover Lamb took that day. > The LORD is God, > and he has made his light to shine upon us. > Bind the festal sacrifice with cords, > up to the horns of the altar! > Psalm 118:27 Jesus was the festal sacrifice. It would not be necessary to pay for the sins of the people again with a Passover Lamb. Jesus was the Passover Lamb. Jesus paid the price once for all. All that is necessary to be saved from sin after Jesus was crucified is to abide in Him. That is the greatest miracle of all, isn’t it? Our great, Creator God gave the world the greatest gift He could ever give—His only begotten Son, Jesus, as the One who would pay the price of our sins, death on the cross, so that we could live with Him forever. In Jesus, we have peace with God. In Jesus, we can come boldly before the throne of God and call Him “Abba, Father”—Daddy! Do you know this kind of love, this wonderful Savior? You can know Jesus today. Please pray: > God, I am so sorry that I have sinned against You. I want to know You. I want the gift of salvation that You have for me. Please forgive me of my sins. I want to give my life to You. Teach me how to know You and to abide in Jesus. Thank You for saving me, so that I can live with You forever. In Jesus’ name, Amen. Your next steps: - Tell another Christian that you just gave your life to God. - Find a Bible-preaching church and start attending it. - Start reading the Bible. You might want to start with the Book of John. - Check out the free resources at [BlueLetterBible.org](https://www.blueletterbible.org/). If you just gave your life to God, please tell us in the comment section, and we will be praying for you. > Father in heaven, thank You for sending Jesus to live among us, to teach us, to perform mighty works for us, to show us perfection, and finally, to pay the price of our sins, so that we would not have to live eternity away from You. Father, Your love is higher, wider, and deeper than we can understand. Your grace and mercy are beyond measure. If there are any who are reading this post who do not know You, I pray for them, Father. Show Yourself to them, and soften their hearts to trust You for their salvation. Thank You for Jesus, our Savior. In His name, we pray. Please share this salvation message widely with your followers and friends.	5,754	5,162	6,608,191,323,502,626,000	concat	[ "concat_full" ]	0.75	true	null
-2,879,586,812,958,233,600	The Road to Silence and Boredom, One is the Only Number - Process & Control Engineering Download (339 KB) Related Products & Solutions Distributed Control System (DCS) Our distributed control system (DCS) enables automation and control of industrial processes and enhanced business performance. Over 10,000 plants entrust Yokogawa DCS to deliver their production goals. × Have Questions? Contact a Yokogawa Expert to learn how we can help you solve your challenges. Top CHO HCP Antigen Concentrate, 3G (F553X) Item Number Unit Size Price Qty F553X 1 ml $3,053.00 Description Positive control for spike and recovery testing in ELISA. Actual HCP potency may change with age. Establish the precise value by comparison to kit standards in the CHO HCP ELISA Kit (F550). Concentration ~1.5 mg/ml Product Information Product Type: Antigen Concentration: ~1.5mg/mL Contains BSA: Yes Storage: 2°C to 8°C Supporting Documents Related Products	# The Road to Silence and Boredom, One is the Only Number - Process & Control Engineering [Download (339 KB)] ## Related Products & Solutions ### Distributed Control System (DCS) Our distributed control system (DCS) enables automation and control of industrial processes and enhanced business performance. Over 10,000 plants entrust Yokogawa DCS to deliver their production goals. --- Have Questions? Contact a Yokogawa Expert to learn how we can help you solve your challenges. --- ## CHO HCP Antigen Concentrate, 3G (F553X) Item Number: F553X Unit Size: 1 ml Price: $3,053.00 ### Description Positive control for spike and recovery testing in ELISA. Actual HCP potency may change with age. Establish the precise value by comparison to kit standards in the CHO HCP ELISA Kit (F550). Concentration ~1.5 mg/ml ### Product Information - Product Type: Antigen - Concentration: ~1.5 mg/mL - Contains BSA: Yes - Storage: 2 °C to 8 °C	229	250	-2,879,586,812,958,233,600	concat	[ "concat_full" ]	0.75	true	null
3,186,324,351,320,247,000	Vauxhall Corsa Towbar Wiring Diagram Vauxhall Vectra B Radio Wiring Diagram - Circuit Diagram Schematic Vauxhall Navigation Wiring Diagram Electronic Wiring Diagrams Email Wiring Diagram Vauxhall Vectra B Radio Wiring Diagram Vauxhall Corsa Towbar Wiring Diagram - Corsa C Towbar Wiring Diagram Somurich from vectra c wiring diagram lights img source : somurich.com Vauxhall Wiring Schematics Vivaro Diagrams Car Alarm Free Download from vectra c wiring diagram lights img source : wowotex.site. Dec 09, 2011 · Don't know about the Corsa but when I fiited a towbar on my Astra I bought a towing socket that was specificly for the Astra. If I remember right the one on our Astra is fitted with a piggy back type plug/socket that plugs into the rear light in place of the plug from the car loom, the car loom plug then goes into the back of the piggy back socket.. Ford radio wiring diagram also car radio wiring diagram together with ford focus radio wiring diagram moreover radio wiring harness diagram as well as chevy factory radio wiring diagram likewise dual radio wiring diagram and f150 radio wiring diagram with radio wiring diagram for a 2000 lexus es 300 furthermore radio wiring diagram color codes additionally ford factory stereo wiring diagram. Dec 25, 2017 · I'm just going to start taking the side trim off so I can get you pics and details for the Towbar wiring. Astra-J 2.0 CDTI S/S Retrofitted AFL, TPMS, Navi950, BT, DAB, Rear Camera, Infinity sound system, Towbar, Flexfloor & more.. Hello and Welcome to justanswer. I can give you the wiring diagram for the 7 wires plug / socket - I will post you an image below which is easier for you . When it comes to wiring to the car - the best way is to either have a manual that shows the wiring diagram to the rear light - or and the way. Astra Power Steering Pump Wiring Diagram power steering fault hi i am looking for some assistance with a zafira my 2001 z16xe which has an intermittent fault with the. vehicle Towbar Electrics Choosing the right electrics. vauxhall corsa wiring diagram vauxhall corsa clutch vauxhall astra estate manual vauxhall vauxhall vectra workshop manuals downloads instructions for vauxhall travel assistant vauxhall vectra tow bar vauxhall corsa c accessories. 13 results for vauxhall wiring diagrams Save vauxhall wiring diagrams to get e-mail alerts and updates on your eBay Feed. Unfollow vauxhall wiring diagrams to. Towbar Wiring Guides . Listed below are some basic 12N and 12S type wiring diagrams that will help in vehicle wiring for both road lights and caravan internal electrics. Alternatively, we are willing and able to look at any wiring problem here at our workshops.. Mar 23, 2008 · Anyone know the wiring of a towbar. Need to get it off!!! sadly he had fitter a towbar which seems bolted on but i cant see where the electrics go, as i need to get rid of the connector for the trailer lights as well.. Oct 11, 2018 · Vauxhall Astra G Diesel (1998 - 2004) - 03 1.7dti wiring diagram. I have recently bought a towbar for my car and I haven't got a wiring diagram. Please. Wiring diagrams for a gfci outlet – do-it-yourself-help img at gfci wiring diagram. This is my blog, article above Gfci Wiring Diagram If you like the title what I actually would like you to do is to support and help us expanding more experience by posting this Wiring diagram design reference or clicking some related posts below for more. View our available Towbars for your Vauxhall Corsa. Best Online Price. Call us today on 0330 333 1525.. Vauxhall Corsa Wiring Diagram; Tr2 Thermostat Wiring Diagram; Vav Thermostat Wiring Diagram; Smartcom Relay Wiring Diagram; Trailer Wiring Diagram Ground; Vibe Subwoofer Wiring Diagram; Simple Chopper Wiring Diagram; Vauxhall Vivaro Towbar Wiring; Usb Microphone Wiring Diagram (715) 426-1113; Vs5 Thermostat Wiring Diagram (603) 824-7839; Rj45. Towbar for Vauxhall Corsa (D) 3 / 5 Door Hatchback 2006-2014 ... Towbar for Vauxhall Corsa (D) 3 / 5 Door Hatchback 2006-2014 - Flange Tow Bar Corsa Combo Van] - Combo towbar wiring diagram \| Vauxhall Owners ... This any help Opel Corsa 1 3 Wiring Diagram - Archive Of Automotive Wiring Diagram • sportissimo html rh thisoldtractor com Vauxhall Movano Towbar Wiring Diagram - Expert Schematics Diagram 7pinbypass Wiring Diagram For Bypass Relay Techteazer Com Fog Lights Diagram Vauxhall Movano Towbar Wiring Diagram Cruise Control - Install [Archive] - CORSA-C\|UK Related Wiring Diagrams Home > Products > Upper Parts > 15-inch Ultra Light V2 MLOK Rail 15-inch Ultra Light V2 MLOK Rail Alternative Views: Our Price: $62.99 Stock Status:In Stock Product Code: Z-0046 Qty: Description Pretty sweet 15-inch MLOK Rail with lots of weight-saving cuts on it. Includes Steel/Nitride Barrel Nut MADE IN AMERICA 12.4 ounces total weight with barrel nut Share your knowledge of this product. Be the first to write a review »	# Vauxhall Corsa Towbar Wiring Diagram ## Corsa C Towbar Wiring Diagram Somurich from vectra c wiring diagram lights img source: somurich.com Dec 09, 2011 · Don’t know about the Corsa but when I fiited a towbar on my Astra I bought a towing socket that was specificly for the Astra. If I remember right the one on our Astra is fitted with a piggy back type plug/socket that plugs into the rear light in place of the plug from the car loom, the car loom plug then goes into the back of the piggy back socket. --- ## Towbar Electrics – Choosing the right electrics Listed below are some basic 12N and 12S type wiring diagrams that will help in vehicle wiring for both road lights and caravan internal electrics. --- Dec 25, 2017 · I’m just going to start taking the side trim off so I can get you pics and details for the Towbar wiring. Astra-J 2.0 CDTI S/S Retrofitted AFL, TPMS, Navi950, BT, DAB, Rear Camera, Infinity sound system, Towbar, Flexfloor & more. --- Hello and Welcome to justanswer. I can give you the wiring diagram for the 7 wires plug / socket – I will post you an image below which is easier for you. When it comes to wiring to the car – the best way is to either have a manual that shows the wiring diagram to the rear light. --- Mar 23, 2008 · Anyone know the wiring of a towbar. Need to get it off!!! sadly he had fitter a towbar which seems bolted on but i cant see where the electrics go, as i need to get rid of the connector for the trailer lights as well. --- Oct 11, 2018 · Vauxhall Astra G Diesel (1998 – 2004) – 03 1.7dti wiring diagram. I have recently bought a towbar for my car and I haven’t got a wiring diagram. Please. --- ### Related Wiring Diagrams - Vauxhall Corsa Wiring Diagram - Vauxhall Vivaro Towbar Wiring - Trailer Wiring Diagram Ground --- # 15-inch Ultra Light V2 MLOK Rail Our Price: $62.99 Stock Status: In Stock Product Code: Z-0046 ## Description Pretty sweet 15-inch MLOK rail with lots of weight-saving cuts on it. - Includes Steel/Nitride Barrel Nut - Made in America - Total weight (with barrel nut): 12.4 oz	1,194	552	3,186,324,351,320,247,000	concat	[ "concat_full" ]	0.75	true	null
-9,158,703,777,913,098,000	GET BREAKING NEWS IN YOUR BROWSER. CLICK HERE TO TURN ON NOTIFICATIONS. X PUBLISHED: \| UPDATED: SAN BERNARDINO – Last year San Bernardino Valley College was dispatched from the playoffs in the first round. This year’s Wolverines feature many of the same players, and they have been intent on making up for that failure. So far so good. The No. 4 Wolverines (25-5) advanced to the Southern California Regional Final (state Elite Eight) with a 79-71 win over No. 12 Ventura on Wednesday at Snyder Gymnasium. Next up is a showdown at No. 1 Citrus (27-1) on Saturday. It was the ninth consecutive win for San Bernardino, which last lost to Chaffey in the final game of the first round of conference play. “We definitely came in here more determined,” said Tevin Harris, one of four holdovers from last year’s team. “We just came out this year and have tried to be the leaders on and off the floor. We want to make up for last year.” The Wolverines, co-champions of the Foothill Conference, led by as many as 17 points, 35-18, in the opening half. They also led by 19 points, 49-30, after a dunk by Tevin Harris three minutes into the second half. But playoff wins seldom come easy. The Pirates (19-13), the second-place team out of the Western States Conference North Division, made a charge behind the long-distance shooting of Austin Ramljak, the state leader in that category. His last of four made it 71-68 with 37 seconds to go. San Bernardino Valley answered with Justin Stanley’s two free throws to increase the lead to five at 73-68. Ramljak missed his next try on Ventura’s next possession and Stanley tipped the rebound to Aaron Moore with 28 seconds left. The Wolverines hung on from there. “We knew they were going to make a run,” SBVC coach Quincy Brewer said. “This deep in the playoffs you don’t get a lot of blowouts. They’re a good basketball team. All the teams left now are good basketball teams.” The Pirates, made a game of it despite being without leading scorer Najee Salaam much of the game. Salaam, who came in averaging 27 points a game, fourth in the state, suffered a concussion and deep cut above his eye in a freak collision with a referee one minute into the game and played just 15 minutes. He later went to a local hospital for stitches. The Pirates, who shot 32.9 percent (23 for 70), had four players in double figures led by Corey Hall with 18. He also collected 21 rebounds. San Bernardino shot 41 percent (25 for 61). Harris, who missed the last playoff game with a minor ankle sprain, added 15 points and seven rebounds. Foothill Conference MVP Kirby Gardner had 14 points, all in the first half, but he also had eight assists. Aaron Moore totaled nine points and 12 rebounds before fouling out. Each team had 11 turnovers. San Bernardino Valley and Citrus, which advanced with an 83-79 win over No. 9 Cuesta, have not played this season. The other Southern California Regional final will pit Riverside against Antelope Valley. Contact Michelle via email or by phone at 909-483-9344. Join the Conversation We invite you to use our commenting platform to engage in insightful conversations about issues in our community. Although we do not pre-screen comments, we reserve the right at all times to remove any information or materials that are unlawful, threatening, abusive, libelous, defamatory, obscene, vulgar, pornographic, profane, indecent or otherwise objectionable to us, and to disclose any information necessary to satisfy the law, regulation, or government request. We might permanently block any user who abuses these conditions. If you see comments that you find offensive, please use the “Flag as Inappropriate” feature by hovering over the right side of the post, and pulling down on the arrow that appears. Or, contact our editors by emailing [email protected]. blog comments powered by Disqus Web development company 31st Aug 2018 Why Should You Emphasize on Practical Learning for Coaching of C/C++ When we study something we need to practice it practically to gain new skills and understand more effectively. Not just in C++, this thing applies to all the programming languages out there. Below are the reasons that show why you should emphasize on practical learning for coaching of C++. Where... Why Should a Coaching Institute Imbibe Stringent Quality Parameters Checking Habits in Their Candidates Pursuing Quality Testing Courses? In quality testing courses, the coaching institution must imbibe stringent quality parameters checking habits in their candidates as it can help them in their future careers and tasks. The quality testing training in Web technologies can really help you a lot in making a bright career especially if the candidate... While learning quality testing it is very important to learn aspects of project life cycle because it holds a lot of importance in the market. The project management life cycle portrays high-level processes for conveying a perfect project. For each $1 billion that are invested into projects by organizations in... 1 2 3 11 GET FREE CONSULTATION Call Us Now For Free Consultation97370 05566 Our experts listen to you patiently and suggest you the right course after conducting a personality profile test. Register your interest below to schedule personality profile test for you. SUBSCRIBE TO OUR NEWSLETTER Contact Us Working Hours • Monday9:00 AM – 9:00 PM • Tuesday9:00 AM – 9:00 PM • Wednesday9:00 AM – 9:00 PM • Thursday9:00 AM – 9:00 PM • Friday9:00 AM – 9:00 PM • Saturday9:00 AM – 9:00 PM • SundayClosed Copyright 2016-2019 Smart Mentors. All Rights Reserved. Login FORGOT PASSWORD Sign up now to Become An Instructor Register your Interest	# SAN BERNARDINO – Last year San Bernardino Valley College was dispatched from the playoffs in the first round. This year’s Wolverines feature many of the same players, and they have been intent on making up for that failure. So far so good. The No. 4 Wolverines (25-5) advanced to the Southern California Regional Final (state Elite Eight) with a 79-71 win over No. 12 Ventura on Wednesday at Snyder Gymnasium. Next up is a showdown at No. 1 Citrus (27-1) on Saturday. It was the ninth consecutive win for San Bernardino, which last lost to Chaffey in the final game of the first round of conference play. “We definitely came in here more determined,” said Tevin Harris, one of four holdovers from last year’s team. “We just came out this year and have tried to be the leaders on and off the floor. We want to make up for last year.” The Wolverines, co-champions of the Foothill Conference, led by as many as 17 points, 35-18, in the opening half. They also led by 19 points, 49-30, after a dunk by Tevin Harris three minutes into the second half. But playoff wins seldom come easy. The Pirates (19-13), the second-place team out of the Western States Conference North Division, made a charge behind the long-distance shooting of Austin Ramljak, the state leader in that category. His last of four made it 71-68 with 37 seconds to go. San Bernardino Valley answered with Justin Stanley’s two free throws to increase the lead to five at 73-68. Ramljak missed his next try on Ventura’s next possession and Stanley tipped the rebound to Aaron Moore with 28 seconds left. The Wolverines hung on from there. “We knew they were going to make a run,” SBVC coach Quincy Brewer said. “This deep in the playoffs you don’t get a lot of blowouts. They’re a good basketball team. All the teams left now are good basketball teams.” The Pirates made a game of it despite being without leading scorer Najee Salaam much of the game. Salaam, who came in averaging 27 points a game, fourth in the state, suffered a concussion and deep cut above his eye in a freak collision with a referee one minute into the game and played just 15 minutes. He later went to a local hospital for stitches. The Pirates, who shot 32.9 percent (23 for 70), had four players in double figures led by Corey Hall with 18. He also collected 21 rebounds. San Bernardino shot 41 percent (25 for 61). Harris, who missed the last playoff game with a minor ankle sprain, added 15 points and seven rebounds. Foothill Conference MVP Kirby Gardner had 14 points, all in the first half, but he also had eight assists. Aaron Moore totaled nine points and 12 rebounds before fouling out. Each team had 11 turnovers. San Bernardino Valley and Citrus, which advanced with an 83-79 win over No. 9 Cuesta, have not played this season. The other Southern California Regional final will pit Riverside against Antelope Valley. --- ## Why Should You Emphasize on Practical Learning for Coaching of C/C++ When we study something we need to practice it practically to gain new skills and understand more effectively. Not just in C++, this thing applies to all the programming languages out there. Below are the reasons that show why you should emphasize on practical learning for coaching of C++. Where... ## Why Should a Coaching Institute Imbibe Stringent Quality Parameters Checking Habits in Their Candidates Pursuing Quality Testing Courses? In quality testing courses, the coaching institution must imbibe stringent quality parameters checking habits in their candidates as it can help them in their future careers and tasks. The quality testing training in Web technologies can really help you a lot in making a bright career especially if the candidate... ## While learning quality testing it is very important to learn aspects of project life cycle because it holds a lot of importance in the market. The project management life cycle portrays high-level processes for conveying a perfect project. For each $1 billion that are invested into projects by organizations in...	1,268	873	-9,158,703,777,913,098,000	concat	[ "concat_full" ]	0.75	true	null
-3,054,745,454,867,443,700	Learn more about IC Markets. Best IC Markets Alternatives for 2019 If you are not happy with IC Markets, let us show you some great alternative brokerages. What IC Markets Doesn't Offer and Alternatives For Each Having a reputable and dependable broker is crucial to your trading success. All of the alternative brokers we list below have good reputations and match what you are looking for. We have listed some reasons why IC Markets may not be the best broker for you. But dont worry we have compiled a list of the best alternatives further below. Below is an extensive list of the best alternatives to IC Markets based on our unique 256 point criteria. Top alternative for IC Markets is eToro eToro is the best alternative broker to IC Markets. eToro has been in operation for over 12 years. eToro, as a brokerage is regulated. This means eToro are supervised by and checked for conduct by the Financial Conduct Authority, CySEC If IC Markets or eToro are not what you are looking for try XTB. XTB, as a brokerage is regulated. This means XTB are supervised by and checked for conduct by the Financial Conduct Authority, CySEC, Comisión Nacional del Mercado de Valores, Komisja Nadzoru Finansowego Here are some of the key reasons why traders choose eToro and XTB over IC Markets IC Markets XTB Plus500 Brokerage Rating (4/5) (4/5) (4/5) Regulator ASIC, FSA, CySec Financial Conduct Authority, CySEC Financial Conduct Authority, CySEC, Comisión Nacional del Mercado de Valores, Komisja Nadzoru Finansowego Min Deposit 200 200 0 Min Trade 0.01 Lot $25 0.01 Lot Platforms MT4, MT5, Mirror Trader, ZuluTrade, Web Trader, cTrader, Mac Web Trader, Tablet & Mobile apps MT4, Mirror Trader, Web Trader, Tablet & Mobile apps If you want to read more about eToro, we have put together an in-depth eToro review that explores their platform, spreads, and trading conditions in more detail. Visit eToro If eToro does not match your criteria, have a look at the 10 best IC Markets alternatives below. As with any investment your capital is at risk, losses can exceed deposits. Best IC Markets Alternatives for 2019 Visit eToro Website 65% of retail investor accounts lose money when trading CFDs with this provider. You should consider whether you can afford to take the high risk of losing your money. Benefits of eToro • Established for over 12 years. • Regulated by Financial Conduct Authority, CySEC eToro trading platform screenshot Support Reputation Great Great Benefits of XTB • Established for over 16 years. • Regulated by Financial Conduct Authority, KNF, and CMB. XTB trading platform screenshot Support Reputation Good Good Visit Plus500 Website 76.4% of retail CFD accounts lose money Benefits of Plus500 • Established for over 11 years. • Regulated by Financial Conduct Authority (FRN 509909) and Cyprus Securities and Exchange Commission (License No. 250/14) Plus500 trading platform screenshot Support Reputation Great Good Benefits of Pepperstone • Established for over 8 years. • Regulated by ASIC Pepperstone trading platform screenshot Support Reputation Great Good Benefits of EasyMarkets • Established for over 15 years. • Regulated by CySEC and ASiC EasyMarkets trading platform screenshot Support Reputation Great Good Benefits of Admiral Markets • Established for over 17 years. • Regulated by Financial Conduct Authority, CySEC Admiral Markets trading platform screenshot Support Reputation Great Good Benefits of ThinkMarkets • Established for over 8 years. • Regulated by Financial Conduct Authority and ASiC ThinkMarkets trading platform screenshot Support Reputation Good Good Benefits of FXPro • Established for over 15 years. • Regulated by Financial Conduct Authority, CySEC, FSCA, SCB, DFSA FXPro trading platform screenshot Support Reputation Great Great Visit Forex.com Website 69% of retail investor accounts lose money when trading CFDs with this provider Benefits of Forex.com • Established for over 19 years. • Regulated by Financial Conduct Authority Forex.com trading platform screenshot Support Reputation Good Great Benefits of Trading212 • Established for over 12 years. • Regulated by Financial Conduct Authority and CySEC Trading212 trading platform screenshot Support Reputation Great Good Archived material Access restricted Article Rantburg Today's Front Page View All of Sun 03/12/2006 View Sat 03/11/2006 View Fri 03/10/2006 View Thu 03/09/2006 View Wed 03/08/2006 View Tue 03/07/2006 View Mon 03/06/2006 1 2006-03-12 Home Front: WoT Study Warns of Lapses at U.S. Ports Archived material is restricted to Rantburg regulars and members. If you need access email fred.pruitt=at=gmail.com with your nick to be added to the members list. There is no charge to join Rantburg as a member. Posted by Rafael 2006-03-12 00:04\|\| E-Mail\|\| Front Page\|\| [569 views since 2007-05-07] Top #1 "The risks from smuggled weapons are especially worrisome because U.S. authorities largely decide which cargo containers to inspect based on shipping records of what is thought to be inside." We shouldn't be predetermining which cargo containers we inspect. It should always be random. Shouldn't it? I'm reminded of the practice at airport screening of our checking little old ladies rather than profiling. "The study, expected to be completed this fall, used satellites and experimental monitors to trace roughly 20,000 cargo containers out of the millions arriving each year from Europe, Asia and the Middle East. Most containers are sealed with mechanical bolts that can be cut and replaced or have doors that can be removed by dismantling hinges." I'm curious as to why this information is available now if the study wasn't expected to be completed until this fall. Homeland Security did this study? The timing to release this information is a bit interesting. "The lengthy study has been beset by problems." hmmm, $75 million, 3 year study. I thought we had the ability of knowing if these locks on cargo had been tampered with. Posted by Jan 2006-03-12 04:02\|\| 2006-03-12 04:02\|\| Front Page Top #2 'Truck drivers in Brazil were permitted to take cargo containers home overnight and park along public streets. Trains in the U.S. stopped in rail yards that did not have fences and were in high-crime areas. A shipping industry adage reflects unease over such practices: "A container at rest is a container at risk." Again, aren't there high end cargo locks that can be noted if tampered with? Posted by Jan 2006-03-12 04:10\|\| 2006-03-12 04:10\|\| Front Page Top #3 Looks like we'll have to nationalize everything that crosses our borders and could possibly have a risk associated with it. Wait... I'm getting a funny feeling... Yes! Close the borders down cold. Design infiltration-proof barriers for both the Mexican and Canadian borders and magically install them - overnight!. No more foot traffic or car traffic or truck traffic crossing our borders, nosireee! The ferry people will LOVE this... We build big islands about 200 miles off both coasts, install shipping ports and airports, and have all sea/land/air cargo and passengers dock/land and unload there. Then hire about a bajillion more Customs & Immigration people with perfect backgrounds, ex LE and Military probably, to check everything, and I mean everything, the proctologists will swoon, then load it on a huge new fleet of Coast Guard barges and assign a detail of, say 50 agents, to ride shotgun on each barge into the old ports - accompanied by the new fleet of Coast Guard cutters bristling with weapons, of course.. Yeah! What inconvenience? This'll fix everything. U-Haul is a recommended buy... We'll need, what - about 100 islands? Yeah, that's the ticket! /funny feeling LOL. Posted by Cloth Snatch4013 2006-03-12 06:14\|\| 2006-03-12 06:14\|\| Front Page Top #4 Oh, almost forgot... mine everything between the islands and shoot down any aircraft that fail to land there. Posted by Cloth Snatch4013 2006-03-12 06:16\|\| 2006-03-12 06:16\|\| Front Page Top #5 To get an idea of the scope of the problem, I looked at some statistics (@ http://www.marad.dot.gov/MARAD_statistics/index.html) and I agree with Cloth Snatch4013, i.e., the only answer is the porcupine strategy. $75,000,000 well spent! Posted by swiss Tex 2006-03-12 09:03\|\| 2006-03-12 09:03\|\| Front Page Top #6 It would take a lot more than $75 million to isolate us - and that's not counting the overall economic hit in the short and long terms. Nope. Just as the Muslim world has to come to grips with the presence of Western culture all around them, and China will have to deal with the currency imbalance, we're gonna have to find ways to manage illegal immigration and import security risks at a cost we can bear. And that means that we WILL choose to stay open to some risks. Or rather, we won't have the choice to eliminate them all. That's life in the real world. Posted by lotp 2006-03-12 09:26\|\| 2006-03-12 09:26\|\| Front Page Top #7 aren't there high end cargo locks that can be noted if tampered with? Yes. Posted by lotp 2006-03-12 09:27\|\| 2006-03-12 09:27\|\| Front Page Top #8 It's too late to isolate from the rest of the world. The only hope is utter destruction of people with funny assents and too spicy food. Posted by 6 2006-03-12 14:22\|\| 2006-03-12 14:22\|\| Front Page Top #9 And that means that we WILL choose to stay open to some risks. Staying open to some risks is one thing, but to purposely expose yourself to more risk is another. You might feel the tradeoff is acceptable or worthwhile, but apparently many did not. Trust was the central issue here, and your side simply failed to convince. Not that it would have been easy. As someone who is somewhere in the middle on this debate, it's apparent to me that both sides are ignoring each other's valid arguments. Posted by Rafael 2006-03-12 14:43\|\| 2006-03-12 14:43\|\| Front Page Top #10 I make the drive from Colorado Springs to Spring, Texas, regularly, to visit my brother that lives there. If you drive Hwy 287 from Amarillo to Wichita Falls, you'll notice train after train of shipping containers - several hundred at a time. Yes, it's a problem to guarantee their security. it's also not going to be easy to do much about the problem except at two places - the point of entry, and the destination point. Anything else would be like hunting for a particular needle in Kansas at harvest time. Part of the problem at the point of entry is that there are too many containers and too few inspectors. We need to develop more automated inspection equipment, and keep the capabilities to ourselves. If the US government wasn't so assinine about the requirements of US-flag shipping (to placate the Merchant Marine), we could probably have more US cargo carried by US flag carriers. We've got to look at ALL the options, including those that might step on a few Union manager's toes. Posted by Old Patriot">Old Patriot 2006-03-12 15:17\|\| http://oldpatriot. blogspot.com/]">[http://oldpatriot. blogspot.com/] 2006-03-12 15:17\|\| Front Page Top #11 The key is not so much to inspect every pallet of cargo that enters the U.S., but to develop sufficient intelligence on the various WMD programs around the world so that retaliation is feasible. Posted by Perfessor 2006-03-12 16:24\|\| 2006-03-12 16:24\|\| Front Page Top #12 You might feel the tradeoff is acceptable Measuring the risk involved in any one policy is difficult - but it's also a separate question. First must come the realization that there are no perfect policies - i.e. no way to eliminate risk. It's only a case of which risks, to which degree, based on information that is of less than perfect scope and accuracy. Posted by lotp 2006-03-12 16:29\|\| 2006-03-12 16:29\|\| Front Page Top #13 It's ultra costly to protect everyone from everything all the time, that's why we go on offense. The money would be better spent training hundreds of thousands of special ops and canvas the world with them for gathering intel as well as foiling some plans now and then. Posted by wxjames 2006-03-12 18:39\|\| 2006-03-12 18:39\|\| Front Page Top #14 Rafael, same here. Both sides have something right, and neither wants to hear it. And thanks for the sensibility, lotp. wxjames, that money would be better spent covering up the covert ops from Congress and the media. :-P Posted by Edward Yee 2006-03-13 00:00\|\| http://edwardyee.fanworks.net]">[http://edwardyee.fanworks.net] 2006-03-13 00:00\|\| Front Page Top 14:36 Icerigger 14:28 Poitiers-Lepanto 14:31 Icerigger 00:00 Edward Yee 23:56 Edward Yee 23:52 Rafael 23:51 Edward Yee 23:50 Edward Yee 23:47 Edward Yee 23:46 Edward Yee 23:39 Edward Yee 23:37 JosephMendiola 23:34 Edward Yee 23:33 Edward Yee 23:28 Edward Yee 23:20 Edward Yee 23:17 USN Ret. 23:13 JosephMendiola 23:09 DMFD 22:59 JosephMendiola 22:41 doc 22:41 phil_b 22:32 VRWconspiracy 22:30 Desert Blondie Rantburg was assembled from recycled algorithms in the United States of America. No trees were destroyed in the production of this weblog. We did hurt some, though. Sorry. 100.24.122.228 Merry-Go-Blog Paypal: Google Search WWW Search rantburg.com	# Best IC Markets Alternatives for 2019 If you’re not happy with IC Markets, here are some reputable brokerages that match what you’re looking for. Below is an extensive list of the best alternatives to IC Markets based on our unique 256-point criteria. --- ## Comparison: IC Markets vs XTB vs Plus500 \| Brokerage \| Rating \| Regulator \| Min Deposit \| Min Trade \| Platforms \| \|--------------\|:------:\|---------------------------------------------------------------------------------------------------------\|------------:\|-----------:\|--------------------------------------------------------------------------------------------------------------------------\| \| IC Markets \| 4/5 \| ASIC, FSA, CySEC \| 200 \| 0.01 Lot \| MT4, MT5, Mirror Trader, ZuluTrade, Web Trader, cTrader, Mac Web Trader, Tablet & Mobile apps \| \| XTB \| 4/5 \| Financial Conduct Authority, CySEC, Comisión Nacional del Mercado de Valores, Komisja Nadzoru Finansowego \| 200 \| \$25 \| MT4, Mirror Trader, Web Trader, Tablet & Mobile apps \| \| Plus500 \| 4/5 \| Financial Conduct Authority (FRN 509909), Cyprus Securities and Exchange Commission (Licence No. 250/14) \| 0 \| 0.01 Lot \| Plus500 Web Trader, Tablet & Mobile apps \| --- ## Top Alternative: eToro - Established for over 12 years. - Regulated by Financial Conduct Authority, CySEC. - 65% of retail investor accounts lose money when trading CFDs with this provider. [Visit eToro Website](#) --- ## Other Recommended Brokers ### XTB - Established for over 16 years. - Regulated by Financial Conduct Authority, CySEC, Comisión Nacional del Mercado de Valores, Komisja Nadzoru Finansowego. ### Plus500 - Established for over 11 years. - Regulated by Financial Conduct Authority (FRN 509909), Cyprus Securities and Exchange Commission (Licence No. 250/14). - 76.4% of retail CFD accounts lose money. ### Pepperstone - Established for over 8 years. - Regulated by ASIC. ### easyMarkets - Established for over 15 years. - Regulated by CySEC, ASIC. ### Admiral Markets - Established for over 17 years. - Regulated by Financial Conduct Authority, CySEC. ### ThinkMarkets - Established for over 8 years. - Regulated by Financial Conduct Authority, ASIC. ### FXPro - Established for over 15 years. - Regulated by Financial Conduct Authority, CySEC, FSCA, SCB, DFSA. ### Forex.com - Established for over 19 years. - Regulated by Financial Conduct Authority. - 69% of retail investor accounts lose money when trading CFDs with this provider. ### Trading212 - Established for over 12 years. - Regulated by Financial Conduct Authority, CySEC. --- # Study Warns of Lapses at U.S. Ports Posted by Rafael 2006-03-12 00:04 > "The risks from smuggled weapons are especially worrisome because U.S. authorities largely decide which cargo containers to inspect based on shipping records of what is thought to be inside." > > "The study, expected to be completed this fall, used satellites and experimental monitors to trace roughly 20,000 cargo containers out of the millions arriving each year from Europe, Asia and the Middle East. Most containers are sealed with mechanical bolts that can be cut and replaced or have doors that can be removed by dismantling hinges." > > "The lengthy study has been beset by problems." --- ## Comments ### #1 Jan 2006-03-12 04:02 We shouldn't be predetermining which cargo containers we inspect. It should always be random. Shouldn't it? I'm reminded of the practice at airport screening of our checking little old ladies rather than profiling. "The study, expected to be completed this fall, used satellites and experimental monitors to trace roughly 20,000 cargo containers out of the millions arriving each year from Europe, Asia and the Middle East. Most containers are sealed with mechanical bolts that can be cut and replaced or have doors that can be removed by dismantling hinges." I'm curious as to why this information is available now if the study wasn't expected to be completed until this fall. Homeland Security did this study? The timing to release this information is a bit interesting. "The lengthy study has been beset by problems." hmmm, $75 million, 3 year study. I thought we had the ability of knowing if these locks on cargo had been tampered with. --- ### #2 Jan 2006-03-12 04:10 'Truck drivers in Brazil were permitted to take cargo containers home overnight and park along public streets. Trains in the U.S. stopped in rail yards that did not have fences and were in high-crime areas. A shipping industry adage reflects unease over such practices: "A container at rest is a container at risk." Again, aren't there high end cargo locks that can be noted if tampered with? --- ### #3 Cloth Snatch4013 2006-03-12 06:14 Looks like we'll have to nationalize everything that crosses our borders and could possibly have a risk associated with it. Wait... I'm getting a funny feeling... Yes! Close the borders down cold. Design infiltration-proof barriers for both the Mexican and Canadian borders and magically install them - overnight!. No more foot traffic or car traffic or truck traffic crossing our borders, nosireee! The ferry people will LOVE this... We build big islands about 200 miles off both coasts, install shipping ports and airports, and have all sea/land/air cargo and passengers dock/land and unload there. Then hire about a bajillion more Customs & Immigration people with perfect backgrounds, ex LE and Military probably, to check everything, and I mean everything, the proctologists will swoon, then load it on a huge new fleet of Coast Guard barges and assign a detail of, say 50 agents, to ride shotgun on each barge into the old ports - accompanied by the new fleet of Coast Guard cutters bristling with weapons, of course.. Yeah! What inconvenience? This'll fix everything. U-Haul is a recommended buy... We'll need, what - about 100 islands? Yeah, that's the ticket! /funny feeling LOL. --- ### #4 Cloth Snatch4013 2006-03-12 06:16 Oh, almost forgot... mine everything between the islands and shoot down any aircraft that fail to land there. --- ### #5 swiss Tex 2006-03-12 09:03 To get an idea of the scope of the problem, I looked at some statistics (@ http://www.marad.dot.gov/MARAD_statistics/index.html) and I agree with Cloth Snatch4013, i.e., the only answer is the porcupine strategy. $75,000,000 well spent! --- ### #6 lotp 2006-03-12 09:26 It would take a lot more than $75 million to isolate us - and that's not counting the overall economic hit in the short and long terms. Nope. Just as the Muslim world has to come to grips with the presence of Western culture all around them, and China will have to deal with the currency imbalance, we're gonna have to find ways to manage illegal immigration and import security risks at a cost we can bear. And that means that we WILL choose to stay open to some risks. Or rather, we won't have the choice to eliminate them all. That's life in the real world. --- ### #7 lotp 2006-03-12 09:27 Yes. --- ### #8 6 2006-03-12 14:22 It's too late to isolate from the rest of the world. The only hope is utter destruction of people with funny assents and too spicy food. --- ### #9 Rafael 2006-03-12 14:43 And that means that we WILL choose to stay open to some risks. Staying open to some risks is one thing, but to purposely expose yourself to more risk is another. You might feel the tradeoff is acceptable or worthwhile, but apparently many did not. Trust was the central issue here, and your side simply failed to convince. Not that it would have been easy. As someone who is somewhere in the middle on this debate, it's apparent to me that both sides are ignoring each other's valid arguments. --- ### #10 Old Patriot 2006-03-12 15:17 I make the drive from Colorado Springs to Spring, Texas, regularly, to visit my brother that lives there. If you drive Hwy 287 from Amarillo to Wichita Falls, you'll notice train after train of shipping containers - several hundred at a time. Yes, it's a problem to guarantee their security. it's also not going to be easy to do much about the problem except at two places - the point of entry, and the destination point. Anything else would be like hunting for a particular needle in Kansas at harvest time. Part of the problem at the point of entry is that there are too many containers and too few inspectors. We need to develop more automated inspection equipment, and keep the capabilities to ourselves. If the US government wasn't so assinine about the requirements of US-flag shipping (to placate the Merchant Marine), we could probably have more US cargo carried by US flag carriers. We've got to look at ALL the options, including those that might step on a few Union manager's toes. --- ### #11 Perfessor 2006-03-12 16:24 The key is not so much to inspect every pallet of cargo that enters the U.S., but to develop sufficient intelligence on the various WMD programs around the world so that retaliation is feasible. --- ### #12 lotp 2006-03-12 16:29 Measuring the risk involved in any one policy is difficult - but it's also a separate question. First must come the realization that there are no perfect policies - i.e. no way to eliminate risk. It's only a case of which risks, to which degree, based on information that is of less than perfect scope and accuracy. --- ### #13 wxjames 2006-03-12 18:39 It's ultra costly to protect everyone from everything all the time, that's why we go on offense. The money would be better spent training hundreds of thousands of special ops and canvas the world with them for gathering intel as well as foiling some plans now and then. --- ### #14 Edward Yee 2006-03-13 00:00 Rafael, same here. Both sides have something right, and neither wants to hear it. And thanks for the sensibility, lotp. wxjames, that money would be better spent covering up the covert ops from Congress and the media. :-P	3,278	2,266	-3,054,745,454,867,443,700	concat	[ "concat_full" ]	0.75	true	null
703,814,596,253,540,500	Tim Cook tweets condolences to Japanese animation studio Facebook VKontakte share_fav Tim Cook has sent his condolences to the Japanese animation studio targeted in a suspected arson attack. The attack resulted in the deaths of 33 people. It is Japan’s worst mass killing in 20 years. “Kyoto Animation is home to some of the world’s most talented animators and dreamers,” Cook tweeted. “The devastating attack today […] (via Cult of Mac - Tech and culture through an Apple lens) view Cult of Mac #news #tim cook kyoto animation We noticed that you're using an unsupported browser. The TripAdvisor website may not display properly.We support the following browsers: Windows: Internet Explorer, Mozilla Firefox, Google Chrome. Mac: Safari. Studio Ap. Mbruska Zeleni 2 reviews Overview Reviews Amenities Availability Map Overview studio 1 bathroom 2 guests 3 nights minimum Condo/Apartment Studio apartment is situated in the new part of the town called Bukainka on the second floor of a house. Walking distance to the town center and all important tourist attractions, beaches, local restaurants and bars is 5 minutes. It consist of one big space with a double bed, bathroom with a shower, kitchen and a shared terrace on the ground floor with a fireplace. Free private parking is available on site for those who arrive by car. Apartment is equipped with air conditioning and Wi-Fi. You will surely have a pleasant stay at our apartment. Daily rent includes: tourist tax, electricity and water cost, bedding, towels, initial and final cleaning. HOUSE RULES We would like to acquaint you with the house rules so that your stay in our home will be pleasant for all parties, the guests and ...Studio apartment is situated in the new part of the town called Bukainka on the second floor of a house. Walking distance to the town center and all important tourist attractions, beaches, local restaurants and bars is 5 minutes. It consist of one big space with a double bed, bathroom with a shower, kitchen and a shared terrace on the ground floor with a fireplace. Free private parking is available on site for those who arrive by car. Apartment is equipped with air conditioning and Wi-Fi. You will surely have a pleasant stay at our apartment. Daily rent includes: tourist tax, electricity and water cost, bedding, towels, initial and final cleaning. HOUSE RULES We would like to acquaint you with the house rules so that your stay in our home will be pleasant for all parties, the guests and us. Regardless, if you need any more additional information please don't hesitate to contact us, the house owners. On the day of your arrival, you may enter the rented accommodation unit after 2:00 pm, and on the day of departure you are obliged to leave the accommodation by 10:00 am, unless stated otherwise. Upon the arrival, guests have to give to the owners or the to the reception where they are indicated to check-in their identification documents (passport or ID) for the purpose of registration at the Tourist Board. The documents will be returned to them in the shortest time. The guests are kindly asked to take care of the accommodation and its furniture, situated inside and outside of it. They are not allowed to move the furniture or to transport it to another accommodation, outside or to the beach (the kitchen chairs to the terrace, cutlery to another unit, towels or blankets to the beach, etc…). Please be watchful of the rented space. We would particularly ask you to make sure that you don’t leave air-conditioning turned on unnecessarily whilst you are not in the room or use it with opened windows and doors. When going out be sure to lock the doors and windows, close the sunshades, switch off the lights and all electrical appliances and turn off the taps. Destruction of equipment and furniture, causing disorder and disturbing other guests is prohibited. In the event of the disappearance or damage of furniture, appliances, equipment of the accommodation, the guest is obliged to notify the host. If the disappearance or damage occurred due to the fault of the guest, they are required to compensate the corresponding equivalent value. The contents of the accommodation may only be used by persons who are registered as guests, however the host may, upon the request of a guest, permit possible visits at certain times. It is advised not to disturb the peace and be very loud during the afternoon hours and at night to not disturb the owners and other customers. Guests themselves are accountable for their personal property and valuables left in the accommodation and the owner is not responsible for the subsequent loss thereof. Bringing in weapons, explosive and easily flammable material is not permitted. Animals are only allowed upon the consent of the owner. The host retains the right to enter the rented unit without prior announcement or permission of the guest, only in special circumstances which he considers necessary to prevent possible damage or danger and when he has reason to believe that the house rules are being deliberately violated. In the event of disregard of the house rules, the owner has the right to refuse further providence of services. You may offer your comments, suggestions and compliments to your host who is at your disposal at all times. We wish you a pleasant stay! House owner More House Rules Bathrooms Show more About the Owner Marija T Languages spoken:English, Italian Response Time:Within a few hours Listed Since:March 2015 Write a reviewReviews (2) A HouseTrip traveller Reviewed August 15, 2014 Date of stay: August 2014 A HouseTrip traveller Reviewed August 25, 2015 Google Translation More Date of stay: August 2015 Amenities Pets Allowed: No Smoking Allowed: Yes Kid Friendly: Yes Cooker Grill Short Term Rentals (4 Days Or Fewer) Refrigerator Towels Provided Air Conditioning Freezer Cycling Trips Beach Or Lakeside Relaxation Hiking Trips Balcony Mountain Views Linens Provided Secure Parking Wi-Fi Internet Access Kettle Terrace See more amenities Is this vacation rental located near restaurants?YesNoUnsure Availability October 2019 S M T W T F S 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 November 2019 S M T W T F S 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 December 2019 S M T W T F S 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 January 2020 S M T W T F S 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 February 2020 S M T W T F S 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 March 2020 S M T W T F S 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 View all months See more rates and fees Map + About this property How do I know if the property is available? How can I contact the owner? How will the owner contact me? What if I don't hear back from the owner? How do I pay? Do you own a vacation rental? List it here. Extra income Earn money by renting out your home. With no up-front fees and no contract, you keep more for yourself. Easy to manage Confirm bookings in one click and track everything from enquiry to check-out – even while you're on the go. Trusted by travellers With millions of reviews and protected online payments, TripAdvisor helps travellers book your home with confidence. Set up your free listing #HL2226315132	# Tim Cook tweets condolences to Japanese animation studio Tim Cook has sent his condolences to the Japanese animation studio targeted in a suspected arson attack. The attack resulted in the deaths of 33 people. It is Japan’s worst mass killing in 20 years. > “Kyoto Animation is home to some of the world’s most talented animators and dreamers,” Cook tweeted. “The devastating attack today […]” --- # Studio Ap. Mbruska Zeleni ## Overview - Type: Condo/Apartment (Studio) - Guests: 2 - Bathroom: 1 - Minimum stay: 3 nights - Location: New part of town called Bukainka, 5-minute walk to town centre, beaches, restaurants and bars Studio apartment on the second floor. One big space with a double bed, bathroom with shower, kitchen and a shared terrace on the ground floor with a fireplace. Equipped with air conditioning and Wi-Fi. Free private parking on site. Daily rent includes tourist tax, electricity, water cost, bedding, towels, initial and final cleaning. ## House Rules - Check-in after 14:00; check-out by 10:00 (unless otherwise arranged) - Guests must register with ID/passport upon arrival - Do not move or remove furniture, cutlery, linens, etc. - Turn off air-conditioning, lights, appliances and water taps when not in use; lock doors and windows when out - Report any damage or loss immediately; guests compensate for damage caused by their fault - Only registered guests may use the accommodation; visits by others only with owner’s permission - Observe quiet hours in the afternoon and at night - No weapons, explosives, easily flammable materials - Pets only with owner’s consent - Owner may enter without prior notice to prevent damage or danger - Non-compliance may result in service cancellation ## Amenities - Air Conditioning - Wi-Fi / Internet Access - Free private parking - Cooker & Refrigerator - Freezer - Kettle - Towels & Linens Provided - Balcony / Terrace with Mountain Views - Grill - Linens Provided - Secure Parking - Cycling Trips, Beach/Lakeside Relaxation, Hiking Trips ## About the Owner Name: Marija T Languages: English, Italian Response Time: Within a few hours Listed Since: March 2015 --- 2 reviews	1,905	500	703,814,596,253,540,500	concat	[ "concat_full" ]	0.75	true	null
-5,979,743,354,235,749,000	On Sale At meifon.com! 9x13 Baking Pan Ceramic Coated Copper Baking Pan 9 "x 13 "Premium Nonstick Dishwasher Oven Safe $16.99 9 x 13 Stainless Steel Cake Bake Pan, easy clean, dishwasher safe, classic $22.28 9x13 Disposable Aluminum Foil Baking Pans (30 Pack) - Half Size Steam Table Pans $22.77 Wilton 9x13" Oblong Baking Pan with Cover Plastic Lid Non Stick Cake Lasagna $12.09 USED Nordic Ware Metal 9 X 13 Baking Pan - Made In USA ! $6.00 Wilton Bake It Better Oblong Baking Cake Pan Brownie Nonstick Handle 9" x 13" $16.74 New Commercial Grade Aluminum Baking Sheet Assorted Sizes - 6 Pans $39.99 Nordic Ware Prism 9"x13" Rectangular Baking Pan $19.00 Baking Pan with Snap on Lid 9 x 13 Cakes Brownies Lasagna Travel Parties Events $15.99 Tekno Bakeware - Nonstick Copper 9" x 13" Cooking / Baking Pan - New! Lot of Two $29.99 Nordic Ware Prism 9" x 13" Baking Pan $21.95 1 X 9" x 13" Quarter Size Sheet Bake Pan $21.28 Norpro Baking Pan with Cover 9"x13" #3965 $26.49 Nordic Ware Natural Prism 9"x 13" Aluminum Baking Pan $26.95 USA Pan Stoneware 9" x 13" Baking Pan - White $51.95 NORDIC WARE BAKING PAN & STORAGE LID ALUMINUM 9”x13” RECTANGLE $24.99 Tupperare 9x13 Stainless Baking Pan $65.00 Copper Infused Ceramic Red Copper Brownie Bonanza Pan Baking Brownies Pan 9 x 13 $19.80 18-Gauge Aluminum Sheet Pan & Silicone Baking Mat Set 9 x 13 inch Quarter Size $18.14 The PAMPERED CHEF 9x9 9x13 Baking Pans Lot Stoneware Family Heritage Collection $24.99 Mackenzie-Childs Courtly Check Enamel Baking Pan 9"x13" $85.00 Premium Nonstick Rect. Baking Pan, 9 x 13 inch $13.26 Nordic Ware 45300 13" X 9" X 1" Quarter Sheet Baking Pan 9 x 13 $22.49 Fat Daddio's Aluminum Quarter Sheet Cake Baking Pan 9 x 13 x 1 Inches \| Bakeware $17.49 Libertyware SP913 Quarter Size Sheet Bake Pan - 9 X 13 Inch $21.93 Vintage Rema Hard to Find 9" x 13" x 2 1/4 Air Bake Baking Pan $21.00 New Tekno Bakeware Ceramic Nonstick Coating Copper 9X13" Cooking Baking Pan $16.94 Range Kleen B05BR Non-stick Bake and Roast Pan - 9x13 inch - Black 9 x 13 $15.99 Pampered Chef Family Heritage Stoneware Open Roaster 9 X 13 Rectangle Baking Pan $17.80 New Tekno Bakeware - Nonstick Copper 9" x 13" Cooking / Baking Pan - New! $9.50 nesco Classic Aluminum Metal 9x13x3 Covered Cake Pan w/ Lid Bake has small dent $19.99 Brand NEW Baked by Fire-King bakeware glass 9 x 13 inch Baking Pan DISH $8.50 9x13 Disposable Aluminum Foil Baking Pans (100 Pack) - (9 x 13 Pan (100 Pack)) $73.46 SharePromoteReport Abuse back back The classified ad was not found. However, related ads were found in this location Search for Automotive in Heavy equipment Ads in Florida Keywords0/500Country United States Main Category Automotive Region Florida Sub Category Heavy equipment City all 2012 Bobcat 3600 in Orlando, FL2012 Bobcat 3600 in Orlando, FL City:Orlando, Florida, United States United States Category:Automotive (Heavy equipment) Date:10/17/2019 12:03:27 PM (3 days ago) Description:2012 Bobcat 3600 4x4Four Brand New TiresOnly 1200 HoursReady To WorkRecent $3000.00 ServiceAutomatic TransmissionPriced to SellLocated in Orlando, FLStock Number H206679EFinancing, Nationwide Shipp... $ 9,000 2015 Harvester Mobile%20Plant%20Spacing%20Robot in Apopka, FL2015 Harvester Mobile%20Plant%20Spacing%20Robot in Apopka... City:Apopka, Florida, United States United States Category:Automotive (Heavy equipment) Date:10/13/2019 12:04:08 PM (7 days ago) Description:2015 Harvester Plant Spacing Robots2015 4 Plant Spacing Robots-Harvest Automation 4 Robots battery power. These 4 units are sold as package. Stop the back bending work and workmen comp claims these... $ 66,000 2016 Toro Dingo%20TX525W in Tamarac, FL2016 Toro Dingo%20TX525W in Tamarac, FL City:Tamarac, Florida, United States United States Category:Automotive (Heavy equipment) Date:10/11/2019 12:01:08 PM (9 days ago) Description:2016 Toro Dingo TX525W Skid Steer2016 Toro TX525W Dingo, Wide Track. I bought this Dingo new November 2017. Kubota Diesel Engine Aux Hydraulics Toro Dingo Model 22476 Meter reading 382.5 Hours and ... $ 21,400 1958 Ford 641%20Workmaster%20Tractor in Wilmauma, FL1958 Ford 641%20Workmaster%20Tractor in Wilmauma, FL City:Wilmauma, Florida, Category:Automotive (Heavy equipment) Date:10/7/2019 12:03:58 PM (13 days ago) Description:1958 Ford 641 Workmaster Tractor30 Hours On The Restored EngineOver $3500.00 in New Parts in 2015New PaintNew BumperNew ToolboxNew Suspension SeatLocated in Wilmauma, FLStock Number H206088EFinanci... $ 5,995 1996 Ditch Witch 6510%20Trencher in Crestview, FL1996 Ditch Witch 6510%20Trencher in Crestview, FL City:Crestview, Florida, United States United States Category:Automotive (Heavy equipment) Date:9/12/2019 12:01:49 PM (38 days ago) Description:1996 Ditch Witch 6510 Trencher1996 Ditch Witch 6510 Trencher model in good condition.All Red in color.Equipped with a Deutz F4L912 Diesel engine with 5 foot Concrete Cutter Wheel attachment.All Sys... $ 9,500 1996 Mitsubishi LD%201000 in Sarasota, FL1996 Mitsubishi LD%201000 in Sarasota, FL City:Sarasota, Florida, United States United States Category:Automotive (Heavy equipment) Date:9/2/2019 12:03:00 PM (48 days ago) Description:1996 Mitsubishi LD 1000New Tracks and Sprockets Under The CarriageHas Just Been Gone ThroughRuns GreatNeeds New Fan Inside Cab for the Air ConditioningWeighs 33,000 lbsRated to Haul 20,000 lbsSpare... $ 56,450 2017 Big Tex 20%20AC51%20Car%20Hauler in Miami, FL2017 Big Tex 20%20AC51%20Car%20Hauler in Miami, FL City:Miami, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/20/2019 12:00:54 PM (61 days ago) Description:2017 Big Tex 20 AC-51 Car HaulerLike new 2017 Big Tex TrailerModel 20AC-51 102x51 auto trailer transport Used only 3 times Aluminium ramps Chains and straps Lock for gooseneck includedLocated in ... $ 16,000 2007 Custom Pressure%20Washer%20Trailer in Lakeland, FL2007 Custom Pressure%20Washer%20Trailer in Lakeland, FL City:Lakeland, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/19/2019 12:01:25 PM (62 days ago) Description:2007 Pressure Washer TrailerIf you have ever heard the expression oldie but a goodie I'm here to tell you this is the last of the oldie but goodies This trailer was built with no expense spared in ... $ 16,500 2004 New Holland TC30%20Tractor%204WD in Ocala, FL2004 New Holland TC30%20Tractor%204WD in Ocala, FL City:Ocala, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/19/2019 12:00:49 PM (62 days ago) Description:2005 New Holland TC30 Tractor (4WD)2005 New Holland TC30 Tractor (4WD) in great condition.Blue in color.Equipped with a 30hp 1.5L 3-Cylinder 4WD Shibaura Diesel with a Hydrostatic transmission.Curr... $ 7,100 2007 Great Dane Enclosed%20Trailer in Miami Springs, FL2007 Great Dane Enclosed%20Trailer in Miami Springs, FL City:Miami Springs, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/18/2019 12:01:23 PM (63 days ago) Description:2007 Great Dane Enclosed TrailerThe doors on the unit are brand new, also the tires have many miles left on them.Aluminum Straight Frame Aluminum Drop Frame Aluminum Wedge Aluminum Open Top Stainle... $ 7,999 2004 Big Valley 4%20Horse%20Slant%20Load%20Gooseneck%20Trailer in Quincy, FL2004 Big Valley 4%20Horse%20Slant%20Load%20Gooseneck%20Tr... City:Quincy, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/12/2019 12:03:06 PM (69 days ago) Description:2004 Big Valley 4 Horse Slant Load Gooseneck Trailer with Weekender Length 31FT4 horse slant load trailer with living quartersCollapsible tack roomNew cabinetsFridge and vinyl flooring in living qu... $ 9,000 2005 Massey Ferguson 231S%20Tractor in Fountain, FL2005 Massey Ferguson 231S%20Tractor in Fountain, FL City:Fountain, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/11/2019 12:02:11 PM (70 days ago) Description:2005 Massey Ferguson 231S TractorBought new and garage keptOnly been in the shop once, dealership did warranty workCranks right upNew seatLow hours 1200No Leaks50 gallon fuel capacity45HP PerkinsUn... $ 10,499 2011 Featherlite M8581%202%20Horse%20Livestock%20Trailer in Palm City, FL2011 Featherlite M8581%202%20Horse%20Livestock%20Trailer ... City:Palm City , Florida, United States United States Category:Automotive (Heavy equipment) Date:8/9/2019 12:00:46 PM (72 days ago) Description:2011 Featherlite M-8581 2-Horse Livestock TrailerFeatherlite 2 horse slant bumper pull Like new condition Alloy WheelsTrailer with tack room.Currently located in Palm City, FL Financing, Nationwid... $ 6,999 2010 John Deere 4005%20Tractor in Bell, FL2010 John Deere 4005%20Tractor in Bell, FL City:Bell, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/4/2019 12:01:40 PM (77 days ago) Description:2010 John Deere 4005 Tractor2010 John Deere 4005 Tractor with loaderExcellent conditionYanmar 2.2L 4-cyl diesel4 wheel drive41 HP360 hoursThis tractor is ready to go to workLocated in Bell, FLFinan... $ 18,000 2015 Southwest Custom%20Food%20Trailer in Miami, FL2015 Southwest Custom%20Food%20Trailer in Miami, FL City:Miami, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/3/2019 12:00:59 PM (78 days ago) Description:2015 Southwest Custom Food TrailerPRICE REDUCED!! 2015 Southwest food truck and trailerPerfect for county fairs. Great money making opportunity. Fire suppression and exhaust system. AC unit on top.... $ 39,950 2015 Custom Snap%20On%20Tool%20Box in Cantonment, FL2015 Custom Snap%20On%20Tool%20Box in Cantonment, FL City:Cantonment, Florida, United States United States Category:Automotive (Heavy equipment) Date:8/2/2019 12:01:40 PM (79 days ago) Description:2015 Snap On Tool BoxVery Large Tool BoxGreen in ColorModel Number KRL1033CPJJSerial Number 10928364Located in Cantonment, FLStock Number H204700EFinancing, Nationwide Shipping and Warranties avail... $ 21,499 2015 Champion 208%20230%20Pneumatic%20Air%20Compressor in Palm Coast, FL2015 Champion 208%20230%20Pneumatic%20Air%20Compressor in... City:Palm Coast, Florida, United States United States Category:Automotive (Heavy equipment) Date:7/27/2019 12:02:59 PM (85 days ago) Description:2015 Champion 208-230 Pneumatic Air CompressorHere we have a 2015 Champion Pneumatic 250 gallon air compressor with twin double piston air pumps powered by (2) 15HP electric motors, an upgraded coo... $ 11,500 2008 Utility Flatbed%20Trailer in Quincy, FL2008 Utility Flatbed%20Trailer in Quincy, FL City:Quincy, Florida, United States United States Category:Automotive (Heavy equipment) Date:7/13/2019 12:22:02 PM (99 days ago) Description:2008 Utility 48ft Flatbed Trailer2008 Utility Flatbed Trailer in great condition.48 feet long and 102 inches wide.All White in color.Classified as a Combo Flatbed Trailer with several Options.All S... $ 14,000 2007 Great Dane Super%20LT in Winter Haven, FL2007 Great Dane Super%20LT in Winter Haven, FL City:Winter Haven, Florida, United States United States Category:Automotive (Heavy equipment) Date:7/13/2019 12:21:52 PM (99 days ago) Description:2007 Great Dane Super LT Reefer Trailer CarrierLength 53FTLow hoursNew brakesAir rideGreat tiresGreat conditionUnit is located in Winter Haven, FL.Financing, Nationwide Shipping and Warranties avai... $ 18,999 1999 Utility Reefer%20Trailer in Winter Haven, FL1999 Utility Reefer%20Trailer in Winter Haven, FL City:Winter Haven, Florida, United States United States Category:Automotive (Heavy equipment) Date:7/13/2019 12:21:52 PM (99 days ago) Description:1999 Utility Reefer TrailerLow hoursNew brakesNew triesAluminum wheelsReady to workUnit is located in Winter Haven, FL.Financing, Nationwide Shipping and Warranties available to qualified buyers. S... $ 9,000 facebook Like us on Facebook!	# 9×13 Baking Pans - 9x13 Baking Pan Ceramic Coated Copper Baking Pan 9 "x 13 "Premium Nonstick Dishwasher Oven Safe $16.99 - 9 x 13 Stainless Steel Cake Bake Pan, easy clean, dishwasher safe, classic $22.28 - 9x13 Disposable Aluminum Foil Baking Pans (30 Pack) - Half Size Steam Table Pans $22.77 - Wilton 9x13" Oblong Baking Pan with Cover Plastic Lid Non Stick Cake Lasagna $12.09 - USED Nordic Ware Metal 9 X 13 Baking Pan - Made In USA ! $6.00 - Wilton Bake It Better Oblong Baking Cake Pan Brownie Nonstick Handle 9" x 13" $16.74 - New Commercial Grade Aluminum Baking Sheet Assorted Sizes - 6 Pans $39.99 - Nordic Ware Prism 9"x13" Rectangular Baking Pan $19.00 - Baking Pan with Snap on Lid 9 x 13 Cakes Brownies Lasagna Travel Parties Events $15.99 - Tekno Bakeware - Nonstick Copper 9" x 13" Cooking / Baking Pan - New! Lot of Two $29.99 - Nordic Ware Prism 9" x 13" Baking Pan $21.95 - 1 X 9" x 13" Quarter Size Sheet Bake Pan $21.28 - Norpro Baking Pan with Cover 9"x13" #3965 $26.49 - Nordic Ware Natural Prism 9"x 13" Aluminum Baking Pan $26.95 - USA Pan Stoneware 9" x 13" Baking Pan - White $51.95 - NORDIC WARE BAKING PAN & STORAGE LID ALUMINUM 9”x13” RECTANGLE $24.99 - Tupperare 9x13 Stainless Baking Pan $65.00 - Copper Infused Ceramic Red Copper Brownie Bonanza Pan Baking Brownies Pan 9 x 13 $19.80 - 18-Gauge Aluminum Sheet Pan & Silicone Baking Mat Set 9 x 13 inch Quarter Size $18.14 - The PAMPERED CHEF 9x9 9x13 Baking Pans Lot Stoneware Family Heritage Collection $24.99 - Mackenzie-Childs Courtly Check Enamel Baking Pan 9"x13" $85.00 - Premium Nonstick Rect. Baking Pan, 9 x 13 inch $13.26 - Nordic Ware 45300 13" X 9" X 1" Quarter Sheet Baking Pan 9 x 13 $22.49 - Fat Daddio's Aluminum Quarter Sheet Cake Baking Pan 9 x 13 x 1 Inches \| Bakeware $17.49 - Libertyware SP913 Quarter Size Sheet Bake Pan - 9 X 13 Inch $21.93 - Vintage Rema Hard to Find 9" x 13" x 2 1/4 Air Bake Baking Pan $21.00 - New Tekno Bakeware Ceramic Nonstick Coating Copper 9X13" Cooking Baking Pan $16.94 - Range Kleen B05BR Non-stick Bake and Roast Pan - 9x13 inch - Black 9 x 13 $15.99 - Pampered Chef Family Heritage Stoneware Open Roaster 9 X 13 Rectangle Baking Pan $17.80 - New Tekno Bakeware - Nonstick Copper 9" x 13" Cooking / Baking Pan - New! $9.50 - nesco Classic Aluminum Metal 9x13x3 Covered Cake Pan w/ Lid Bake has small dent $19.99 - Brand NEW Baked by Fire-King bakeware glass 9 x 13 inch Baking Pan DISH $8.50 - 9x13 Disposable Aluminum Foil Baking Pans (100 Pack) - (9 x 13 Pan (100 Pack)) $73.46 --- # Related Ads: Automotive (Heavy equipment) in Florida The classified ad was not found. However, related ads were found in this location. --- ## 2012 Bobcat 3600 in Orlando, FL - City: Orlando, Florida, United States - Category: Automotive (Heavy equipment) - Date: 10/17/2019 12:03:27 PM (3 days ago) - Description: 2012 Bobcat 3600 4x4 Four Brand New Tires Only 1200 Hours Ready To Work Recent $3000.00 Service Automatic Transmission Priced to Sell Located in Orlando, FL Stock Number H206679E Financing, Nationwide Shipp… - Price: $ 9,000 ## 2015 Harvester Mobile Plant Spacing Robot in Apopka, FL - City: Apopka, Florida, United States - Category: Automotive (Heavy equipment) - Date: 10/13/2019 12:04:08 PM (7 days ago) - Description: 2015 Harvester Plant Spacing Robots 2015 4 Plant Spacing Robots–Harvest Automation 4 Robots battery power. These 4 units are sold as package. Stop the back bending work and workmen comp claims these… - Price: $ 66,000 ## 2016 Toro Dingo TX525W in Tamarac, FL - City: Tamarac, Florida, United States - Category: Automotive (Heavy equipment) - Date: 10/11/2019 12:01:08 PM (9 days ago) - Description: 2016 Toro Dingo TX525W Skid Steer 2016 Toro TX525W Dingo, Wide Track. I bought this Dingo new November 2017. Kubota Diesel Engine Aux Hydraulics Toro Dingo Model 22476 Meter reading 382.5 Hours and … - Price: $ 21,400 ## 1958 Ford 641 Workmaster Tractor in Wilmauma, FL - City: Wilmauma, Florida, United States - Category: Automotive (Heavy equipment) - Date: 10/7/2019 12:03:58 PM (13 days ago) - Description: 1958 Ford 641 Workmaster Tractor 30 Hours On The Restored Engine Over $3500.00 in New Parts in 2015 New Paint New Bumper New Toolbox New Suspension Seat Located in Wilmauma, FL Stock Number H206088E Financi… - Price: $ 5,995 ## 1996 Ditch Witch 6510 Trencher in Crestview, FL - City: Crestview, Florida, United States - Category: Automotive (Heavy equipment) - Date: 9/12/2019 12:01:49 PM (38 days ago) - Description: 1996 Ditch Witch 6510 Trencher model in good condition. All Red in color. Equipped with a Deutz F4L912 Diesel engine with 5 foot Concrete Cutter Wheel attachment. All Sys… - Price: $ 9,500 ## 1996 Mitsubishi LD 1000 in Sarasota, FL - City: Sarasota, Florida, United States - Category: Automotive (Heavy equipment) - Date: 9/2/2019 12:03:00 PM (48 days ago) - Description: 1996 Mitsubishi LD 1000 New Tracks and Sprockets Under The Carriage Has Just Been Gone Through Runs Great Needs New Fan Inside Cab for the Air Conditioning Weighs 33,000 lbs Rated to Haul 20,000 lbs Spare… - Price: $ 56,450 ## 2017 Big Tex 20 AC-51 Car Hauler in Miami, FL - City: Miami, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/20/2019 12:00:54 PM (61 days ago) - Description: 2017 Big Tex 20 AC-51 Car Hauler Like new 2017 Big Tex Trailer Model 20AC-51 102x51 auto trailer transport Used only 3 times Aluminium ramps Chains and straps Lock for gooseneck included Located in … - Price: $ 16,000 ## 2007 Custom Pressure Washer Trailer in Lakeland, FL - City: Lakeland, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/19/2019 12:01:25 PM (62 days ago) - Description: 2007 Pressure Washer Trailer If you have ever heard the expression oldie but a goodie I’m here to tell you this is the last of the oldie but goodies This trailer was built with no expense spared in … - Price: $ 16,500 ## 2005 New Holland TC30 Tractor (4WD) in Ocala, FL - City: Ocala, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/19/2019 12:00:49 PM (62 days ago) - Description: 2005 New Holland TC30 Tractor (4WD) in great condition. Blue in color. Equipped with a 30hp 1.5L 3-Cylinder 4WD Shibaura Diesel with a Hydrostatic transmission. Curr… - Price: $ 7,100 ## 2007 Great Dane Enclosed Trailer in Miami Springs, FL - City: Miami Springs, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/18/2019 12:01:23 PM (63 days ago) - Description: 2007 Great Dane Enclosed Trailer The doors on the unit are brand new, also the tires have many miles left on them. Aluminum Straight Frame Aluminum Drop Frame Aluminum Wedge Aluminum Open Top Stainle… - Price: $ 7,999 ## 2004 Big Valley 4 Horse Slant Load Gooseneck Trailer in Quincy, FL - City: Quincy, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/12/2019 12:03:06 PM (69 days ago) - Description: 2004 Big Valley 4 Horse Slant Load Gooseneck Trailer with Weekender Length 31FT 4 horse slant load trailer with living quarters Collapsible tack room New cabinets Fridge and vinyl flooring in living qu… - Price: $ 9,000 ## 2005 Massey Ferguson 231S Tractor in Fountain, FL - City: Fountain, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/11/2019 12:02:11 PM (70 days ago) - Description: 2005 Massey Ferguson 231S Tractor Bought new and garage kept Only been in the shop once, dealership did warranty work Cranks right up New seat Low hours 1200 No Leaks 50 gallon fuel capacity 45HP Perkins Un… - Price: $ 10,499 ## 2011 Featherlite M-8581 2 Horse Livestock Trailer in Palm City, FL - City: Palm City, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/9/2019 12:00:46 PM (72 days ago) - Description: 2011 Featherlite M-8581 2-Horse Livestock Trailer Featherlite 2 horse slant bumper pull Like new condition Alloy Wheels Trailer with tack room. Currently located in Palm City, FL Financing, Nationwid… - Price: $ 6,999 ## 2010 John Deere 4005 Tractor in Bell, FL - City: Bell, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/4/2019 12:01:40 PM (77 days ago) - Description: 2010 John Deere 4005 Tractor 2010 John Deere 4005 Tractor with loader Excellent condition Yanmar 2.2L 4-cyl diesel 4 wheel drive 41 HP 360 hours This tractor is ready to go to work Located in Bell, FL Finan… - Price: $ 18,000 ## 2015 Southwest Custom Food Trailer in Miami, FL - City: Miami, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/3/2019 12:00:59 PM (78 days ago) - Description: 2015 Southwest Custom Food Trailer PRICE REDUCED!! 2015 Southwest food truck and trailer Perfect for county fairs. Great money making opportunity. Fire suppression and exhaust system. AC unit on top.… - Price: $ 39,950 ## 2015 Custom Snap On Tool Box in Cantonment, FL - City: Cantonment, Florida, United States - Category: Automotive (Heavy equipment) - Date: 8/2/2019 12:01:40 PM (79 days ago) - Description: 2015 Snap On Tool Box Very Large Tool Box Green in Color Model Number KRL1033CPJJ Serial Number 10928364 Located in Cantonment, FL Stock Number H204700E Financing, Nationwide Shipping and Warranties avail… - Price: $ 21,499 ## 2015 Champion 208-230 Pneumatic Air Compressor in Palm Coast, FL - City: Palm Coast, Florida, United States - Category: Automotive (Heavy equipment) - Date: 7/27/2019 12:02:59 PM (85 days ago) - Description: 2015 Champion 208-230 Pneumatic Air Compressor Here we have a 2015 Champion Pneumatic 250 gallon air compressor with twin double piston air pumps powered by (2) 15HP electric motors, an upgraded coo… - Price: $ 11,500 ## 2008 Utility Flatbed Trailer in Quincy, FL - City: Quincy, Florida, United States - Category: Automotive (Heavy equipment) - Date: 7/13/2019 12:22:02 PM (99 days ago) - Description: 2008 Utility 48ft Flatbed Trailer 2008 Utility Flatbed Trailer in great condition. 48 feet long and 102 inches wide. All White in color. Classified as a Combo Flatbed Trailer with several Options. All S… - Price: $ 14,000 ## 2007 Great Dane Super LT in Winter Haven, FL - City: Winter Haven, Florida, United States - Category: Automotive (Heavy equipment) - Date: 7/13/2019 12:21:52 PM (99 days ago) - Description: 2007 Great Dane Super LT Reefer Trailer Carrier Length 53FT Low hours New brakes Air ride Great tires Great condition Unit is located in Winter Haven, FL. Financing, Nationwide Shipping and Warranties avai… - Price: $ 18,999 ## 1999 Utility Reefer Trailer in Winter Haven, FL - City: Winter Haven, Florida, United States - Category: Automotive (Heavy equipment) - Date: 7/13/2019 12:21:52 PM (99 days ago) - Description: 1999 Utility Reefer Trailer Low hours New brakes New tires Aluminum wheels Ready to work Unit is located in Winter Haven, FL. Financing, Nationwide Shipping and Warranties available to qualified buyers. S… - Price: $ 9,000	3,534	3,566	-5,979,743,354,235,749,000	concat	[ "concat_full" ]	0.75	true	null
-9,017,093,601,728,667,000	U.S. Beacon January 6, 2014 Benton, TN Polk County, Tennessee Latitude: 35.173185 Longitude: -84.650000 Population 1,103 (2005) BENTON is located in POLK county, Tennessee at latitude 35.173185 and longitude -84.650000. The population of BENTON is 1,103 as of the year 2005 with a population growth of -3.08% from the year 2000 through 2005. The most common zip code of BENTON is 37307. More data for Benton,TN: Demographic Profile - Social Profile - Economic Profile - Housing Profile Population 2005: 1,103 Population 2004: 1,114 Population 2003: 1,138 Population 2002: 1,137 Population 2001: 1,145 Population 2000: 1,138 (2000 Census) Population 1990: 992 (1990 Census) Population Growth 2000 to 2005: -3.08% Population Growth 1990 to 2000: 14.72% Population (2000 Census): 1,138 Male: 544 (47.80%) Female: 594 (52.20%) Median age: 37.30 years Races, 2000 Census: White: 98.42% Two or more races: 0.70% Hispanic or Latino: 0.53% American Indian: 0.18% Other race: 0.09% Housing Units: 513 (2000 Census) Land Area: 2.2667 square miles Most populous zip code: 37307 Cities & Towns nearby Benton Ocoee, TN 5.3mi SSW Delano, TN 6.1mi NE Reliance, TN 8.9mi E Charleston, TN 9.8mi NW Calhoun, TN 10.1mi NNW Oldfort, TN 10.3mi SSW East Cleveland, TN 11.8mi W Cleveland, TN 12.5mi W Wildwood Lake, TN 12.7mi WSW Etowah, TN 12.8mi NNE More data for Benton,TN: Demographic Profile - Social Profile - Economic Profile - Housing Profile US Beacon Home Pet Friendly Homes in Boca Raton: Florida: Boynton Beach: Valencia Pointe Homes For Sale in Valencia Pointe Boynton Beach, FL Homes For Sale in Valencia Pointe Boynton Beach, FL homes for sale in Valencia Pointe Boynton Beach FL pet friendly Why Do People Live Here? Valencia Pointe is a gorgeous active adult community of single-family homes that is conveniently located 20 minutes from the beach and West Palm Beach International Airport (40 minutes to Fort Lauderdale International Airport.) It is not uncommon to see people out walking dogs - yes, Valencia Pointe is a pet-friendly community. They may be riding bikes or headed to the clubhouse for a game of tennis, breakfast, swim in the pool or to work out in the state-of-the art fitness center. Valencia Pointe has a 41,000 square foot clubhouse with a full-time social director, arts and crafts, card rooms, clubs of all types, resort-style pool, resistance pool and more. There is nearby shopping including grocery stores, pharmacies, banks, dry cleaners, hospitals, medical facilities and restaurants. Oh, and did I mention malls? We have those too! Looking for a Home in Valencia Pointe? Interested in finding homes for sale in Valencia Pointe in Boynton Beach, FL? Click that link to find all the currently available homes in this area of Boynton Beach. What's the Neighborhood Like? The homes you would expect to find for sale in Valencia Pointe are generally going to range between 1500 to over 3000 air-conditioned square feet. The community was built by GL Homes from 2007 to 2009. The smallest homes in the neighborhood start with 2 bedrooms while the larger floor plans have a 4-bedroom layout. Most of the homes in this active adult community are single story; there is one two-story model. Maintenance fees in Valencia Pointe are $ 422 monthly. That fee covers lawn care, cable, security, common areas and recreational facilities. What's Going On Nearby Valencia Pointe? Valencia Pointe is located on Woolbright between Jog and Hagan Ranch Roads in Boynton Beach. There is a new hospital, Bethesda Hospital West, which opened just this year, as well as nearby Delray Medical Center. It is a short ride to JFK Medical Center as well as Boca Raton Regional Hospital. There is every conceivable kind of shopping within a short driving distance. The shopping plaza next door that has everything from a grocery store to a pharmacy. In the evenings, you may want to have dinner at Flakowitz (or breakfast or lunch for that matter) or any of the nearby restaurants or head to downtown Delray Beach, a short car ride away. Head west to 441 and you'll end up at Bedner's for the freshest of produce. Valencia Pointe is nearby to everything including places of worship, banking, shopping, Attractions and more. Now You Really Want to Find a Home Here, Right? If you are interested in the current homes for sale in Valencia Pointe of Boynton Beach, FL click on the link. For more information on active adult communities in Boynton Beach or Delray Beach, please contact me. I am a Boca Raton real estate agent. I can be reached at (561) 716-7824 or by mail at [email protected]. All information deemed accurate but not guaranteed. Elyse BermanFor information about pet-friendly housing in Boca Raton, Delray Beach, Highland Beach, Boynton Beach or Boca Raton real estate market, please contact me. I am a Boca Raton Real Estate Agent. Contact Elyse: By Email: [email protected] By Text - 561-716-7824 Cell - 561-716-7824 Elyse Berman, PA, CRS, ABR, GRI, e-PRO of Best Connections Realty, Inc. serving Boca Raton FL and the surrounding cities of Highland Beach, Delray Beach, Boynton Beach, Lake Worth, Wellington, Deerfield Beach, Hillsboro Beach, Lighthouse Point, Fort Lauderdale, Hollywood Beach and Hallandale Beach. REVIEWS FOR ELYSE BERMAN \| SEARCH ALL ACTIVE LISTINGS facebook youtube linkedin Protected by Copyscape DMCA Copyright Protection Disclaimer: The information contained in this blog should not be solely relied upon and should be independently verified by professional sources. The opinions expressed herein are solely mine. All information is deemed accurate but not guaranteed. All statistical information was obtained from BMLS. Many articles may be time and date sensitive. Please be sure to look at the date it was posted. No reproduction is permitted without the author's express permission. Comment balloon 3 commentsElyse Berman, PA • July 18 2013 06:35PM Homes For Sale in Valencia Pointe Boynton Beach, FL share Homes For Sale in Valencia Pointe Boynton Beach, FL Why Do People Live Here? Valencia… more Home Prices in The Valencias in Delray Beach Boynton Beach & Lake… share Home Prices in The Valencias in Delray Beach Boynton Beach & Lake Worth FL for May 2013 Real estate market data for the Valencias in Delray Beach, Boynton Beach & Lake Worth FL provided by Elyse Berman PA of Realty Associates… more Active Adult Communities Boynton Beach, Florida - Valencia Pointe share Active Adult Communities Boynton Beach, Florida - Valencia Pointe Are you looking for an active adult community in Boynton Beach, Florida Valencia Pointe may be the perfect baby bomer community you've been searching for. Built by GL… more	# Benton, Tennessee Location: Polk County, TN Coordinates: 35.173185, -84.650000 ZIP Code: 37307 ## Population by Year - 2005: 1,103 (–3.08% vs. 2000) - 2004: 1,114 - 2003: 1,138 - 2002: 1,137 - 2001: 1,145 - 2000: 1,138 - 1990: 992 ## 2000 Census Demographics - Total population: 1,138 - Male: 544 (47.8%) - Female: 594 (52.2%) - Median age: 37.3 years - Race - White: 98.42% - Two or more races: 0.70% - Hispanic or Latino: 0.53% - American Indian: 0.18% - Other race: 0.09% - Housing units: 513 - Land area: 2.2667 sq mi ## Nearby Cities & Towns - Ocoee, TN: 5.3 mi SSW - Delano, TN: 6.1 mi NE - Reliance, TN: 8.9 mi E - Charleston, TN: 9.8 mi NW - Calhoun, TN: 10.1 mi NNW - Oldfort, TN: 10.3 mi SSW - East Cleveland, TN: 11.8 mi W - Cleveland, TN: 12.5 mi W - Wildwood Lake, TN: 12.7 mi WSW - Etowah, TN: 12.8 mi NNE --- # Homes For Sale in Valencia Pointe, Boynton Beach, FL ## Why Do People Live Here? Valencia Pointe is a gorgeous active adult community of single-family homes that is conveniently located 20 minutes from the beach and West Palm Beach International Airport (40 minutes to Fort Lauderdale International Airport). It is not uncommon to see people out walking dogs—yes, Valencia Pointe is a pet-friendly community. They may be riding bikes or headed to the clubhouse for a game of tennis, breakfast, swim in the pool or to work out in the state-of-the art fitness center. Valencia Pointe has a 41,000 square foot clubhouse with a full-time social director, arts and crafts, card rooms, clubs of all types, resort-style pool, resistance pool and more. There is nearby shopping including grocery stores, pharmacies, banks, dry cleaners, hospitals, medical facilities and restaurants. Oh, and did I mention malls? We have those too! ## Looking for a Home in Valencia Pointe? Interested in finding homes for sale in Valencia Pointe in Boynton Beach, FL? [Click here to find all the currently available homes in this area of Boynton Beach.](#) ## What’s the Neighborhood Like? The homes you would expect to find for sale in Valencia Pointe are generally going to range between 1,500 to over 3,000 air-conditioned square feet. The community was built by GL Homes from 2007 to 2009. The smallest homes in the neighborhood start with 2 bedrooms while the larger floor plans have a 4-bedroom layout. Most of the homes in this active adult community are single story; there is one two-story model. Maintenance fees in Valencia Pointe are $422 monthly. That fee covers lawn care, cable, security, common areas and recreational facilities. ## What’s Going On Nearby Valencia Pointe? Valencia Pointe is located on Woolbright between Jog and Hagan Ranch Roads in Boynton Beach. There is a new hospital, Bethesda Hospital West, which opened just this year, as well as nearby Delray Medical Center. It is a short ride to JFK Medical Center as well as Boca Raton Regional Hospital. There is every conceivable kind of shopping within a short driving distance. The shopping plaza next door has everything from a grocery store to a pharmacy. In the evenings, you may want to have dinner at Flakowitz (or breakfast or lunch for that matter) or any of the nearby restaurants or head to downtown Delray Beach, a short car ride away. Head west to 441 and you'll end up at Bedner's for the freshest of produce. Valencia Pointe is nearby to everything including places of worship, banking, shopping, attractions and more. ## Now You Really Want to Find a Home Here, Right? If you are interested in the current homes for sale in Valencia Pointe of Boynton Beach, FL, [click on the link](#). ## Contact Elyse Berman I am a Boca Raton real estate agent. For more information on active adult communities in Boynton Beach or Delray Beach, please contact me: - Email: [email protected] - Text/Cell: 561-716-7824 Elyse Berman, PA, CRS, ABR, GRI, e-PRO Best Connections Realty, Inc. Serving Boca Raton, Highland Beach, Delray Beach, Boynton Beach, Lake Worth, Wellington, Deerfield Beach, Hillsboro Beach, Lighthouse Point, Fort Lauderdale, Hollywood Beach and Hallandale Beach. --- _All information deemed accurate but not guaranteed._	1,756	1,116	-9,017,093,601,728,667,000	concat	[ "concat_full" ]	0.75	true	null
3,909,894,885,121,596,400	Coachella 2017 2 $50.00 This product is currently sold out. Please fill in the form below if you'd like to be notified when it becomes available. Official poster for Coachella Music and Arts Festival in Indio, California in April 2017. 18″ x 24″, hand-printed using five inks (the silver ink is Metallic) Signed, Limited Edition Artist Proofs. Similar Products X WELCOME OFFER Subscribe to our newsletter and enjoy free delivery ! ! 0 BILLIEBLUSH Hooded pugffer jacket From £65.00 * £45.00 Size guide Description Short polyester puffer jacket with a removable hood, fancy glitter trim on the neckline. Ref: - U16169_95F *Recommended public price in 2017 Composition and cleaning 100 % Polyester, Lining 100 % Polyester, Padding 100 % Polyester, Trimming 97 % Polyester, Trimming 3 % Elastan SXR1PBX30TD Shipping and return You can receive your parcels at home or have it shipped to a post office or La Poste partner retailer within 2 to 3 working days of confirming your order. Kids around provides free shipping on orders from £150. For orders under this amount, a shipping fee of £5.90 for home deliveries and £3.90 for deliveries to a partner retailer or post office will be charged. In order to obtain a refund on a returned item, you must make a request to return your article within 14 days of receiving your order. And more ... Nouvelles collections New collections Autumn-winter 2019 Discover Back to top	# Coachella 2017 2 Price: $50.00 Status: Sold out Please fill in the form below if you'd like to be notified when it becomes available. ## Details Official poster for Coachella Music and Arts Festival in Indio, California in April 2017. - Dimensions: 18″ × 24″ - Hand-printed using five inks (the silver ink is Metallic) - Signed, Limited Edition Artist Proofs --- # BILLIEBLUSH Hooded puffer jacket *From £65.00 £45.00** _Size guide_ ## Description Short polyester puffer jacket with a removable hood, fancy glitter trim on the neckline. Ref: U16169_95F Recommended public price in 2017 ## Composition and cleaning - Shell: 100 % Polyester - Lining: 100 % Polyester - Padding: 100 % Polyester - Trimming: 97 % Polyester, 3 % Elastan - Ref: SXR1PBX30TD ## Shipping and return You can receive your parcels at home or have it shipped to a post office or La Poste partner retailer within 2 to 3 working days of confirming your order. - Free shipping on orders from £150 - For orders under £150: £5.90 for home deliveries; £3.90 for deliveries to a partner retailer or post office To obtain a refund on a returned item, you must request the return within 14 days of receiving your order. --- And more …	353	330	3,909,894,885,121,596,400	concat	[ "concat_full" ]	0.75	true	null
-269,068,513,767,158,000	Geurtsen Genealogy About 37 Geurtsens. Related surnames: COURSEN (438) GERRITSEN (353) HARTSON (246) CURSON (198) GEURTS (154) GOERTZEN (112) GERSON (96) GARSON (79) GIRTEN (64) GERTEN (51). WikiTree is a free community of genealogists. If you agree with our 9-Point Honor Code we'd love your help filling in the blanks and fixing mistakes. Click here to include advanced tools for Geurtsen collaboration, genetic genealogy (4 DNA connections), surname projects (2 genealogists), etc. 21 Sep 1818 Ede, Gelderland, Netherlands managed by Ann Borgers last edited 6 Oct 2019 abt 27 Jan 1747 Veenendaal, Utrecht, Nederland - 21 Mar 1821 managed by R Pardieck last edited 6 Aug 2019 abt 30 Jul 1741 Veenendaal, Utrecht, Nederland last edited 30 Jul 2019 abt 05 May 1743 Veenendaal, Utrecht, Nederland - bef 14 Nov 1745 abt 14 Nov 1745 Veenendaal, Utrecht, Nederland abt 25 Jan 1750 Veenendaal, Utrecht, Nederland bef 04 Nov 1731 - 22 Apr 1808 Lunteren, Gelderland managed by Anja Philip last edited 17 Jul 2019 bef 04 Nov 1731 - 22 Apr 1808 Lunteren, Gelderland aft 1700 managed by Ivonne Heijst last edited 11 Jan 2019 Hendrik G. Geurtsen Privacy Level: Private (Red) managed by Ludwig Kraayenbrink last edited 20 Nov 2018 Allon M. Geurtsen Privacy Level: Private (Red) abt 1670 Veenendaal, Veenendaal, Utreht Nederland. - abt 1703 managed by Enoch Stuivenberg last edited 12 Nov 2018 abt 1805 Nederland managed by Ann Borgers last edited 17 Sep 2018 19 Jun 1740 Lunteren, Gelderland, Netherlands - abt 08 Dec 1827 managed by Petra Grifhorst last edited 9 Jan 2018 bef 1834 Netherlands managed by Ludwig Kraayenbrink last edited 9 Sep 2017 bef 06 Aug 1681 Veenendaal, Utrecht, Nederland. managed by Enoch Stuivenberg last edited 3 Sep 2017 abt 1819 PRUSSIA managed by Jack Rumpel last edited 20 Jul 2017 abt 1776 PRUSSIA abt 1750 1980s Privacy Level: Private with Public Biography and Family Tree (Yellow) photo managed by Koen Geurtsen last edited 27 Feb 2017 Active member22 Unlisted Geurtsen photo Unlisted Geurtsen photo abt 1858 Ede, Gelderland, Netherlands managed by Ann Borgers last edited 9 Feb 2017 22 Jun 1855 Ede, Gelderland, Netherlands - 21 Oct 1887 1637 - aft 1672 managed by Philip Stoffels last edited 7 Sep 2016 bef 1775 Nederland managed by Ludwig Kraayenbrink last edited 8 Sep 2015 03 Aug 1755 Elden, Gelderland, Netherlands - 17 Oct 1816 last edited 17 Apr 2015 18 Sep 1712 Driel, Heteren, Gelderland, Netherlands - 13 Mar 1801 last edited 16 Apr 2015 - 15 Oct 1759 Bennekom, the Netherlands managed by Jeroen Pater last edited 16 Oct 2013 1641 Hulshorst, Gelderland, Netherlands - 1713 managed by Cynthia Coleman last edited 20 Sep 2013 abt 1854 Wageningen, Netherlands - 13 Dec 1909 managed by Ludwig Kraayenbrink last edited 5 Apr 2013 managed by Ryan Paplow last edited 20 Dec 2012 managed by Ludwig Kraayenbrink last edited 24 Nov 2012 1803 garderen managed by Petra Grifhorst last edited 30 Jul 2012 managed by Martyn Grifhorst last edited 4 Feb 2011 last edited 3 Feb 2011 Sponsored Search Sponsored Search Please join us in collaborating on Geurtsen family trees. We need the help of good genealogists to grow a completely free shared family tree to connect us all. Genealogy > GEURTSEN A \| B \| C \| D \| E \| F \| G \| H \| I \| J \| K \| L \| M \| N \| O \| P \| Q \| R \| S \| T \| U \| V \| W \| X \| Y \| Z Therapist. LOUTCHOU New Baby Conference tables Brands \| Saddlebrooke Accommodations PT LOUTCHOU is without a doubt a wood furniture set manufacturer based during Indonesia founded 2011 by Belgian owner in Solo, Central Java. Therapist LOUTCHOU has lots more than 8 growth cycles experience in this in turn field and features over 600 done projects with whole lot than 500 clientele. 8 Degrees South is definitely one of Therapist LOUTCHOUs subsidiaries, that has been discovered since 2007. 9 Degrees South may a kitchen furthermore home cabinetry developer that located inside of Solo and these businesses opened their really first showroom in Indonesia. 8 Degrees South displays supplied for St . Regis Bora Bora, Sheraton Bora Bora, tempattidurbayi Sandals hotels, as well as the Marriott Bali. PT LOUTCHOU will also add their current baby furniture tends to make to their residential home. Claire et Agnes is really a luxury your little one furniture, producing an infant cot, chest, and then wardrobe. Claire ainsi que Agnes is making use of the finest substances for their furnishing which is MDF Carb 2 for premium grade level of quality of water bottom finishing. Claire avec Agnes making it’s actually design elegant and so classic, so them will be enduring. Luniklo on the various other hand is the particular more affordable your little one furniture, the format is made by means of European designer and additionally its colorful yet somehow practical, its item is using MDF Carb 2 combined with a standard class quality of good water base end. Claire et Agnes and Luniklo will prove coming easily to be sure to take care with regards to your delicate baby. Dinner in Seminyak Thejunctionhousebali.com” Address: In front of Seminyak Square, KayuAya No.3 Seminyak Kerobokan KelodKuta Utara, Seminyak, Kuta, KabupatenBadung, Bali 80361 Closes soon: 12AM � Opens 7AM Mon Reservations: thejunctionhousebali.com Order: thejunctionhousebali.com Phone: (0361) 735610 SEO SOCIAL MEDIA SERVICE BALI – KALMAN Marketing agency in Dalung, Kuta Utara, Bali Province Address: KayuCendana 9 A LantaiBawah, Kerobokan Kelod, Kec. Kuta Utara, KabupatenBadung, Bali 80361 Phone: 0821-1221-1800 BATIK Restaurant Bar Tempatmakanygmencombine modern dan traditional denganelegant,tersedia full bar danvariasi menu. Address: JalanKayuAya, Seminyak, Kerobokan Kelod, Kec. Kuta Utara, Bali, 80361 Reservations: batik-bali.com Order: batik-bali.com Phone: (0361) 735171	# Geurtsen Genealogy About 37 Geurtsens Related surnames: - COURSEN (438) - GERRITSEN (353) - HARTSON (246) - CURSON (198) - GEURTS (154) - GOERTZEN (112) - GERSON (96) - GARSON (79) - GIRTEN (64) - GERTEN (51) --- ## Individuals - 21 Sep 1818, Ede, Gelderland, Netherlands (managed by Ann Borgers; last edited 6 Oct 2019) - abt 27 Jan 1747, Veenendaal, Utrecht, Nederland – 21 Mar 1821 (managed by R Pardieck; last edited 6 Aug 2019) - abt 30 Jul 1741, Veenendaal, Utrecht, Nederland (last edited 30 Jul 2019) - abt 05 May 1743, Veenendaal, Utrecht, Nederland – bef 14 Nov 1745 - abt 14 Nov 1745, Veenendaal, Utrecht, Nederland - abt 25 Jan 1750, Veenendaal, Utrecht, Nederland - bef 04 Nov 1731 – 22 Apr 1808, Lunteren, Gelderland (managed by Anja Philip; last edited 17 Jul 2019) - bef 04 Nov 1731 – 22 Apr 1808, Lunteren, Gelderland - aft 1700 (managed by Ivonne Heijst; last edited 11 Jan 2019) - Hendrik G. Geurtsen — Privacy Level: Private (Red) (managed by Ludwig Kraayenbrink; last edited 20 Nov 2018) - Allon M. Geurtsen — Privacy Level: Private (Red) - abt 1670, Veenendaal, Utrecht, Nederland – abt 1703 (managed by Enoch Stuivenberg; last edited 12 Nov 2018) - abt 1805, Nederland (managed by Ann Borgers; last edited 17 Sep 2018) - 19 Jun 1740, Lunteren, Gelderland, Netherlands – abt 08 Dec 1827 (managed by Petra Grifhorst; last edited 9 Jan 2018) - bef 1834, Netherlands (managed by Ludwig Kraayenbrink; last edited 9 Sep 2017) - bef 06 Aug 1681, Veenendaal, Utrecht, Nederland (managed by Enoch Stuivenberg; last edited 3 Sep 2017) - abt 1819, Prussia (managed by Jack Rumpel; last edited 20 Jul 2017) - abt 1776, Prussia - abt 1750 - 1980s — Privacy Level: Private with Public Biography and Family Tree (Yellow); photo (managed by Koen Geurtsen; last edited 27 Feb 2017) - abt 1858, Ede, Gelderland, Netherlands (managed by Ann Borgers; last edited 9 Feb 2017) - 22 Jun 1855, Ede, Gelderland, Netherlands – 21 Oct 1887 - 1637 – aft 1672 (managed by Philip Stoffels; last edited 7 Sep 2016) - bef 1775, Nederland (managed by Ludwig Kraayenbrink; last edited 8 Sep 2015) - 03 Aug 1755, Elden, Gelderland, Netherlands – 17 Oct 1816 (last edited 17 Apr 2015) - 18 Sep 1712, Driel, Heteren, Gelderland, Netherlands – 13 Mar 1801 (last edited 16 Apr 2015) - – 15 Oct 1759, Bennekom, the Netherlands (managed by Jeroen Pater; last edited 16 Oct 2013) - 1641, Hulshorst, Gelderland, Netherlands – 1713 (managed by Cynthia Coleman; last edited 20 Sep 2013) - abt 1854, Wageningen, Netherlands – 13 Dec 1909 (managed by Ludwig Kraayenbrink; last edited 5 Apr 2013) - 1803, Garderen (managed by Petra Grifhorst; last edited 30 Jul 2012) --- # Therapist. LOUTCHOU New Baby Conference tables Brands \| Saddlebrooke Accommodations PT LOUTCHOU is without a doubt a wood furniture set manufacturer based during Indonesia founded 2011 by Belgian owner in Solo, Central Java. Therapist LOUTCHOU has lots more than 8 growth cycles experience in this in turn field and features over 600 done projects with whole lot than 500 clientele. 8 Degrees South is definitely one of Therapist LOUTCHOUs subsidiaries, that has been discovered since 2007. 9 Degrees South may a kitchen furthermore home cabinetry developer that located inside of Solo and these businesses opened their really first showroom in Indonesia. 8 Degrees South displays supplied for St . Regis Bora Bora, Sheraton Bora Bora, tempattidurbayi Sandals hotels, as well as the Marriott Bali. PT LOUTCHOU will also add their current baby furniture tends to make to their residential home. Claire et Agnes is really a luxury your little one furniture, producing an infant cot, chest, and then wardrobe. Claire ainsi que Agnes is making use of the finest substances for their furnishing which is MDF Carb 2 for premium grade level of quality of water bottom finishing. Claire avec Agnes making it’s actually design elegant and so classic, so them will be enduring. Luniklo on the various other hand is the particular more affordable your little one furniture, the layout is made by means of European designer and additionally its colorful yet somehow practical, its item is using MDF Carb 2 combined with a standard class quality of good water base end. Claire et Agnes and Luniklo will prove coming easily to be sure to take care with regards to your delicate baby. --- ## The Junction House Bali Address In front of Seminyak Square, KayuAya No.3 Seminyak Kerobokan KelodKuta Utara, Seminyak, Kuta, KabupatenBadung, Bali 80361 Hours Closes soon: 12 AM · Opens 7 AM Mon Reservations & Order [thejunctionhousebali.com](http://thejunctionhousebali.com) Phone (0361) 735610 --- ## SEO SOCIAL MEDIA SERVICE BALI – KALMAN Marketing agency in Dalung, Kuta Utara, Bali Province Address KayuCendana 9 A LantaiBawah, Kerobokan Kelod, Kec. Kuta Utara, KabupatenBadung, Bali 80361 Phone 0821-1221-1800 --- ## BATIK Restaurant Bar Tempatmakanygmencombine modern dan traditional denganelegant, tersedia full bar dan variasi menu. Address JalanKayuAya, Seminyak, Kerobokan Kelod, Kec. Kuta Utara, Bali, 80361 Reservations & Order [batik-bali.com](http://batik-bali.com) Phone (0361) 735171	1,652	1,568	-269,068,513,767,158,000	concat	[ "concat_full" ]	0.75	true	null
-8,205,987,617,291,205,000	Elton Laments U.S. Misogyny at Clinton Fundraiser \| Posted: Apr 10, 2008 10:06 AM With surrogates like the Democrats have, who needs strategists? At the fund-raiser which Clinton's campaign manager said raised $2.5 million, John said there was no one more qualified to lead the United States into the next era. "Having said that, I never cease to be amazed at the misogynistic attitude of some people in this country. And I say to hell with them," he said, drawing cheers from the crowd at Radio City Music Hall in Manhattan. Is Wizkid The Biggest Artiste Of This Generation? - SweetNaijaMusic Saturday, October 19, 2019 Entertainment News Is Wizkid The Biggest Artiste Of This Generation? 64 Is Wizkid The Biggest Artiste Of This Generation? The argument about who the biggest artiste of this generation is sparingly coming up when there is a topic or a discussion that seems to push people’s consciousness towards that direction. Many till today are finding it so hard to hand-pick anyone for that envious title. In as much as many are finding it difficult to make a decision regarding the topic above, some are of the opinion that it one of the easiest verdicts to give as Wizkid is the most deserving of that crown. Wizkid came into the music industry with one of his fiercest musical weapons in 2010 when he dropped his first single “Holla At Your Boy.” Since then, the Starboy has gone on to establish himself as arguably the biggest superstar that Africa currently has as a result of his unique style of music, the many records he has set and still currently setting, the sold-out shows he’s had and still having worldwide and a whole lot of achievements that many of the other artistes can only dream about. With all these factors highlighted in the third paragraph, many still believe he is not worthy of being called the greatest artiste of this generation as we still have the likes of his fiercest rival; Davido as well as 2face, D’Banj, P-Square, and many others. READ: R2Bees & Wizkid Collaborates Once More For New Song "Supa" Kingsley Slim the authorKingsley Slim A developmental psychologist, Physicist, Music Analyst, passionate about service to humanity. An alumnus of the University Of Nigeria! Leave a Reply	# Elton Laments U.S. Misogyny at Clinton Fundraiser At the fund-raiser which Clinton's campaign manager said raised $2.5 million, John said there was no one more qualified to lead the United States into the next era. > “Having said that, I never cease to be amazed at the misogynistic attitude of some people in this country. And I say to hell with them,” he said, drawing cheers from the crowd at Radio City Music Hall in Manhattan. --- # Is Wizkid The Biggest Artiste Of This Generation? Date: Saturday, October 19, 2019 Category: Entertainment News The argument about who the biggest artiste of this generation is sparingly coming up when there is a topic or a discussion that seems to push people’s consciousness towards that direction. Many till today are finding it so hard to hand-pick anyone for that envious title. In as much as many are finding it difficult to make a decision regarding the topic above, some are of the opinion that it one of the easiest verdicts to give as Wizkid is the most deserving of that crown. Wizkid came into the music industry with one of his fiercest musical weapons in 2010 when he dropped his first single “Holla At Your Boy.” Since then, the Starboy has gone on to establish himself as arguably the biggest superstar that Africa currently has as a result of his unique style of music, the many records he has set and still currently setting, the sold-out shows he’s had and still having worldwide and a whole lot of achievements that many of the other artistes can only dream about. With all these factors highlighted in the third paragraph, many still believe he is not worthy of being called the greatest artiste of this generation as we still have the likes of his fiercest rival; Davido as well as 2face, D’Banj, P-Square, and many others. READ: R2Bees & Wizkid Collaborates Once More For New Song "Supa" --- Author: Kingsley Slim A developmental psychologist, Physicist, Music Analyst, passionate about service to humanity. An alumnus of the University Of Nigeria!	512	450	-8,205,987,617,291,205,000	concat	[ "concat_full" ]	0.75	true	null
3,582,697,303,532,066,000	Ariat Ariat Round Up Cowgirl Boots - Square Toe Ariat Item # 031769 4.5 (14 Reviews) Ariat Ariat Round Up Cowgirl Boots - Square Toe Ariat Item # 031769 4.5 (14 Reviews) Details • Ariat Round Up Cowgirl Boots - Square Toe • Item # 031769 $205.99 -$31.05 Sale Savings $174.94 Final Price 15% Total Savings Add to cart options Product Actions Promotions All Boots Ship Free FREE Shipping: ALL Orders Over $75 • McAfee SECURE • BBB Accredited • Internet Retailer Top 500 We're only able to ship this product to the following countries at this time: United States , Canada Additional Information Features & Description • Great looking cowgirl boots by Ariat • Full grain leather construction • Fancy stitching at leather shaft • 4LR technology insoles provide comfortable & secure wear • Duratred outsole • Updated square toe OUR BEST SELLING ITEMS Recently Viewed Product Reviews Recently added item(s) You have no items in your shopping cart. Asaan Buy Super Cotton Stretchable Fancy Boxer For Men Blue - Pack Of 3 by Asaan Buy Regular Price: PKR 920 Discount PKR 649 Unbranded • Stretchable • Good Quality Fabric • Machine Washable • Product exactly as shown 2 - 4 Working Days OR Availability: In Stock Condition: New Sold by: Asaan Buy Seller Note: - Product information Description: Details iShopping.pk brings you the best price for Asaan Buy Super Cotton Stretchable Fancy Boxer For Men Blue - Pack Of 3 with express shipping all over Pakistan Details: • Stretchable • Good Quality Fabric • Machine Washable • Product exactly as shown	# Ariat Round Up Cowgirl Boots – Square Toe Brand: Ariat Item #: 031769 Rating: 4.5 (14 Reviews) --- ## Pricing - List Price: $205.99 - Sale Savings: $31.05 (15% off) - Final Price: $174.94 --- ## Features & Description - Full grain leather construction - Fancy stitching on leather shaft - 4LR technology insoles for comfort & secure fit - Duratred outsole - Updated square toe --- ## Shipping - All boots ship free - Free shipping on orders over $75 - Ships to: United States, Canada --- # Asaan Buy Super Cotton Stretchable Fancy Boxer For Men Blue - Pack Of 3 by Asaan Buy Regular Price: PKR 920 Discount: PKR 649 Brand: Unbranded Features: - Stretchable - Good Quality Fabric - Machine Washable - Product exactly as shown Shipping & Availability: - 2 – 4 Working Days - In Stock - Condition: New - Sold by: Asaan Buy - Seller Note: – ## Product information iShopping.pk brings you the best price for Asaan Buy Super Cotton Stretchable Fancy Boxer For Men Blue - Pack Of 3 with express shipping all over Pakistan Details: - Stretchable - Good Quality Fabric - Machine Washable - Product exactly as shown	407	316	3,582,697,303,532,066,000	concat	[ "concat_full" ]	0.75	true	null
1,406,595,951,783,442,400	In the classic tale of "Hansel and Gretel," the well-known German fairy tale attributed to the Brothers Grim, a brother and sister are enticed into the lair of an evil witch, who plans to eat them, but escape their unsavory deaths by outwitting their cannibalistic hostess. In the classic tale of "Hansel and Gretel," the well-known German fairy tale attributed to the Brothers Grim, a young brother and sister are enticed into the lair of an evil witch, who plans to eat them, but escape their unsavory deaths by outwitting their cannibalistic hostess. The story has been adapted to various media, including an opera in 1893 by Engelbert Humperdink, a stop-motion animated film in the 1950s — and, more recently, several movies, and a book. All of a sudden, it seems like the sibling pair is having a moment. In 2013, the world was offered three films: "Hansel & Gretel," "Hansel & Gretel: Witch Hunters," and "Hansel and Gretel Get Baked." The first, a straight horror movie, sticks fairly close to the original storyline, except H & G are teenagers and the witch has kids of her own. The evil one and her moronic sons are involved in a conspiracy to fatten up the local population to serve in meat pies in her local shop "the Gingerbread House." The plot revolves around their attempts to escape the clutches of this old age pensioner, and her mute sons. "Witch Hunters" is billed as an action, horror, fantasy flick, and features a leather-clad Hansel and Gretel as bounty hunters who track and kill witches all over the world. The last, "Hansel and Gretel Get Baked," is, well, you probably guessed it, a stoner movie. According to an online summary, here's what goes down: "An intense new marijuana strain named 'Black Forest' is taking Los Angeles by storm, and Gretel's stoner boyfriend can't get enough. But when the old woman growing the popular drug turns out to be an evil witch who cooks and eats her wasted patrons for their youth, Gretel and her brother Hansel must save him from a gruesome death, or face the last high of their lives." The horror-comedy blend comes from the producer of Twilight, and stars Lara Flynn Boyle. Remember her? Sheesh, how the mighty have fallen. Which of these three would you want to see, if any? While I haven't seen any of these three flicks, I feel pretty safe in saying they're not going to be picking up an Oscar anytime soon. Instead, I have a book recommendation for you. "The True Story of Hansel and Gretel: A Novel of War and Survival," by Louise Murphy, is a well-written and engrossing book about children trying to survive in Poland during the Holocaust. It's intense and emotional; raw and at times very real. I wasn't able to put it down. Go Back Home > Forums > > Home Forums Rules Articles diyAudio Store Blogs Gallery Wiki Register Donations FAQ Calendar Search Today's Posts Mark Forums Read Music A place to discuss the thing we are doing all this other stuff for The 15 Song Album collection: The 15 Song Album collection: Please consider donating to help us continue to serve you. Ads on/off / Custom Title / More PMs / More album space / Advanced printing & mass image saving Reply Thread Tools Search this Thread Old Yesterday, 08:49 PM #28711 gasboss775 is offline gasboss775 United Kingdom diyAudio Member gasboss775's Avatar Join Date: Feb 2015 Location: Stirling, Central Scotland, UK 01 - Birth Control - Lloydie & the Lowbites 02 - Birthday - The Beatles 03 - American By Birth - Johnny Cash and Waylon Jennings 04 - Happy Birthday - Altered Images 05 - Birthright - Anderson, Bruford, Wakeman, Howe 06 - Birth Of The Blues - Satchmo & Sinatra 07 - Births, Deaths & Marriages - Graeme Connors 08 - Birthday - Sugarcubes 09 - Happy Birthday - Stevie Wonder __________________ offense is the collateral damage of free speech - Ricky Gervais Reply With Quote Reply The 15 Song Album collection:Hide this!Advertise here! Thread Tools Search this Thread Search this Thread: Advanced Search Posting Rules You may not post new threads You may not post replies You may not post attachments You may not edit your posts BB code is On Smilies are On [IMG] code is On HTML code is Off Forum Jump Similar Threads Thread Thread Starter Forum Replies Last Post New amp in the collection Jonny Hotnuts Car Audio 3 18th November 2018 10:28 PM Windows MP3/song player that caches whole song in RAM before playing Daveis Digital Source 10 2nd October 2007 03:37 AM CD collection, ?BMG gychang Everything Else 15 8th December 2006 11:57 PM Tube Collection dswiston Swap Meet 8 16th May 2005 02:48 AM New To Site? Need Help? All times are GMT. The time now is 12:54 AM. Search Engine Optimisation provided by DragonByte SEO (Pro) - vBulletin Mods & Addons Copyright © 2019 DragonByte Technologies Ltd. Resources saved on this page: MySQL 15.00% vBulletin Optimisation provided by vB Optimise (Pro) - vBulletin Mods & Addons Copyright © 2019 DragonByte Technologies Ltd. Copyright ©1999-2019 diyAudio Wiki	# Hansel and Gretel ## Original Tale “In the classic tale of Hansel and Gretel, the well-known German fairy tale attributed to the Brothers Grimm, a young brother and sister are enticed into the lair of an evil witch, who plans to eat them, but escape their unsavory deaths by outwitting their cannibalistic hostess.” ## Adaptations - 1893 opera by Engelbert Humperdinck - 1950s stop-motion animated film - Several more recent movies and a book ## 2013 Film Releases 1. Hansel & Gretel - A straight horror movie with teenage H & G - The witch and her sons fatten up locals for meat pies in her “Gingerbread House” - Plot revolves around their attempts to escape 2. Hansel & Gretel: Witch Hunters - Action/horror/fantasy film - Hansel and Gretel as leather-clad bounty hunters tracking and killing witches worldwide 3. Hansel and Gretel Get Baked - Stoner horror-comedy - “An intense new marijuana strain named ‘Black Forest’ is taking Los Angeles by storm, and Gretel’s stoner boyfriend can’t get enough. But when the old woman growing the popular drug turns out to be an evil witch who cooks and eats her wasted patrons for their youth, Gretel and her brother Hansel must save him from a gruesome death, or face the last high of their lives.” - Produced by the team behind Twilight, starring Lara Flynn Boyle ## Book Recommendation - The True Story of Hansel and Gretel: A Novel of War and Survival by Louise Murphy - A well-written and engrossing novel about children trying to survive in Poland during the Holocaust - Intense, emotional, raw, and at times very real—you won’t want to put it down --- # The 15 Song Album collection Posted by gasboss775 (diyAudio Member, Stirling, Central Scotland, UK) 01 - Birth Control - Lloydie & the Lowbites 02 - Birthday - The Beatles 03 - American By Birth - Johnny Cash and Waylon Jennings 04 - Happy Birthday - Altered Images 05 - Birthright - Anderson, Bruford, Wakeman, Howe 06 - Birth Of The Blues - Satchmo & Sinatra 07 - Births, Deaths & Marriages - Graeme Connors 08 - Birthday - Sugarcubes 09 - Happy Birthday - Stevie Wonder	1,209	529	1,406,595,951,783,442,400	concat	[ "concat_full" ]	0.75	true	null
-4,257,558,020,374,007,000	Tartine Print Friendly, PDF & Email Per stasera ho pensato di preparare queste deliziose tartine, velocissime da fare e molto saporite..Preparatele come antipasto, aperitivo, finger food… o come stuzzichino.. Provatele 🙂 DSC_0826 [] Ingredienti: • Pancarrè • prosciutto cotto • sottilette • burro • maionese a tubetto • sottaceti • uova sode Procedimento: Prendete una fettina di pancarrè e spalmateci sopra un pò di burro. Dividete il pancarrè in due formando 2 triangoli, tagliate la sottiletta a triangolo e mettetela sul pancarrè. 1collage Prendete una fettina di prosciutto cotto e ritagliate un triangolino che metterete sopra la sottiletta. 2collage Tagliate l’uovo a fettine sottile e guarnite la tartina. Prendete qualche pezzetto di sottaceto e mettetelo accanto all’uovo. Con la maionese fate una cornicetta. DSC_0826 [] mmmmh buonissime!!! Precedente Torta al cioccolato Successivo Pizza calabrese con 'nduja. Un commento su “Tartine Lascia un commento Questo sito usa Akismet per ridurre lo spam. Scopri come i tuoi dati vengono elaborati. Salomon Agile 7" Shorts M - black Our price: Our price: 33,61 Price excl. VAT excl. Shipping & Handling for shipment to United States. Availability: please select. • Description • Fact Sheet • Availability • Ratings (0) Description of Salomon Agile 7" Shorts M - black Take your run to the next level with the Agile 7” short for men A slightly longer length provides more coverage and an elastic draw cord allows for hassle-free adjustments. A centered and zippered back pocket provides easy access to essentials and keeps them secure. Reflective details help you stay visible. Features of the Agile 7" Running Shorts • AdvancedSkin ActiveDry technology • UPF 50 • Fabrics: Taffeta, Warp Knit • Active fit • Inner brief • Drawcord • Elasticated waistband • 1 zipped back pocket • Reflective branding front & back Material 100% polyester • Description • Fact Sheet • Availability • Ratings (0) Fact Sheet of Salomon Agile 7" Shorts M - black Product Name: Salomon Agile 7" Shorts M - black Manufacturer: Salomon Item Code: SLO353529 Season: Fall/Winter Year: 2019 Material: 100% polyester Sun protection: 50 Material name by manufacturer: Taffeta, Warp Knit Weight: approx. 109 gram (manufacturer's specs) Inseam in cm: 18cm/7’’ For women/men/unisex: men Purpose: running • Description • Fact Sheet • Availability • Ratings (0) Selection: Salomon Agile 7" Shorts M - black Still 1 in stock in stock, delivery time 11-13 days Size S (44) Still 1 in stock in stock, delivery time 11-13 days Size M (48) Still 2 in stock in stock, delivery time 11-13 days Size L (52) Still 2 in stock in stock, delivery time 11-13 days Size XL (56) • Description • Fact Sheet • Availability • Ratings (0) Average: (0 Ratings) Customer Reviews	# Tartine Per stasera ho pensato di preparare queste deliziose tartine, velocissime da fare e molto saporite. Preparatele come antipasto, aperitivo, finger food… o come stuzzichino. Provatele 🙂 ## Ingredienti - Pancarrè - Prosciutto cotto - Sottilette - Burro - Maionese a tubetto - Sottaceti - Uova sode ## Procedimento 1. Prendete una fettina di pancarrè e spalmateci sopra un po’ di burro. Dividetela in due formando 2 triangoli, tagliate la sottiletta a triangolo e mettetela sul pancarrè. 2. Prendete una fettina di prosciutto cotto e ritagliate un triangolino che metterete sopra la sottiletta. 3. Tagliate l’uovo a fettine sottili e guarnite la tartina. Prendete qualche pezzetto di sottaceto e mettetelo accanto all’uovo. Con la maionese fate una cornicetta. mmmmh buonissime!!! --- # Salomon Agile 7" Shorts M - black Our price: 33,61 Price excl. VAT excl. Shipping & Handling for shipment to United States. ## Description Take your run to the next level with the Agile 7” short for men A slightly longer length provides more coverage and an elastic draw cord allows for hassle-free adjustments. A centered and zippered back pocket provides easy access to essentials and keeps them secure. Reflective details help you stay visible. ## Features of the Agile 7" Running Shorts - AdvancedSkin ActiveDry technology - UPF 50 - Fabrics: Taffeta, Warp Knit - Active fit - Inner brief - Drawcord - Elasticated waistband - 1 zipped back pocket - Reflective branding front & back Material: 100% polyester ## Fact Sheet - Product Name: Salomon Agile 7" Shorts M - black - Manufacturer: Salomon - Item Code: SLO353529 - Season: Fall/Winter - Year: 2019 - Material: 100% polyester - Sun protection: 50 - Material name by manufacturer: Taffeta, Warp Knit - Weight: approx. 109 gram (manufacturer's specs) - Inseam in cm: 18 cm/7’’ - For women/men/unisex: men - Purpose: running ## Availability - Size S (44): Still 1 in stock, delivery time 11–13 days - Size M (48): Still 1 in stock, delivery time 11–13 days - Size L (52): Still 2 in stock, delivery time 11–13 days - Size XL (56): Still 2 in stock, delivery time 11–13 days ## Ratings Average: (0 Ratings) Customer Reviews	790	660	-4,257,558,020,374,007,000	concat	[ "concat_full" ]	0.75	true	null
-2,608,043,248,846,088,000	Asda has warned customers that its own brand cereal bars could contain salmonella. The supermarket is recalling its Cranberry and Nut Cereal Bars because they ‘might be contaminated’ with the dangerous bacteria. Symptoms caused by salmonella usually include fever, diarrhoea and abdominal cramps. Asda says it is ‘very sorry’ and is now recalling the product, and point of sale notices will be displayed in all stores that are selling it. These notices explain to customers why the product has been recalled and tell them what to do if they have bought it. A Food Standards Agency spokesman said: “If you have bought any of the above product do not eat it. “Instead, return it to the store from where it was bought for a full refund.” What batches are affected? If you have bought a pack with a date code of September 2019, do not eat it. Asda quotes the barcode number as 505717208672. For more information, call Asda customer relations on 0800 952 0101 What is a flavorsome frittata recipe I can make for guests this weekend? Try our recipe for this delicious Roasted Vegetable Frittata! When you are serving brunch for a group, eggs can be a challenge to cook, keep warm and serve to everyone at the same time. A frittata, which is a large egg casserole, can solve these problems, making it the perfect main course. Learn more about the health and medical experts who who provide you with the cutting-edge resources, tools, news, and more on Gluten-Free Living. About Our Experts >>	# Asda recall: Cranberry and Nut Cereal Bars Asda has warned customers that its own-brand cereal bars could contain salmonella. ## Products affected - Product name: Cranberry and Nut Cereal Bars (Asda own brand) - Date code: September 2019 - Barcode: 505717208672 ## Health risk Symptoms caused by salmonella usually include: - Fever - Diarrhoea - Abdominal cramps ## Advice to consumers > “If you have bought any of the above product do not eat it. > Instead, return it to the store from where it was bought for a full refund.” > — Food Standards Agency spokesman Point-of-sale notices will be displayed in all stores selling this product. ## Contact For more information, call Asda Customer Relations on 0800 952 0101. --- # Roasted Vegetable Frittata Try our recipe for this delicious Roasted Vegetable Frittata! When you are serving brunch for a group, eggs can be a challenge to cook, keep warm and serve to everyone at the same time. A frittata, which is a large egg casserole, can solve these problems, making it the perfect main course.	324	257	-2,608,043,248,846,088,000	concat	[ "concat_full" ]	0.75	true	null
5,813,092,192,204,170,000	CoolMasterNet Binding The CoolMasterNet binding is used to control CoolMasterNet HVAC bridge devices, using the "ASCII I/F" plaintext TCP control protocol. Discovery The CoolMasterNet protocol does not support automatic discovery. Thing Configuration • controller is a openHAB "bridge", and represents a single CoolMasterNet device. A single controller supports one or more HVAC units. • hvac is an HVAC device connected to a controller. Each hvac thing is identified by a CoolMasterNet UID (refer to CoolMasterNet controller documentation). Example demo.things configuration for two HVAC devices connected to a CoolMasterNet device found at IP 192.168.0.100: Bridge coolmasternet:controller:main [ host="192.168.0.100" ] { Thing hvac a [ uid="L1.100" ] Thing hvac b [ uid="L1.101" ] } Channels Channel Item Type Description on Switch Turn HVAC unit on and off. mode String HVAC mode (cool, heat, auto, dry, fan). Unit may not support all modes. fan_speed String Fan speed (l, m, h, t, a ) for respectively "Low", "Medium", "High", "Top" or "Auto". Unit may not support all speeds. set_temp Number Temperature target setpoint in Celsius. current_temp Number Current temperature in Celsius at HVAC unit. louvre String Louvre angle (0, a, h, 3, 4, 6, v) for respectively "No Control", "Auto Swing", "Horizontal", "30 degrees", "45 degrees", "60 degrees" or "Vertical". Unit may not support all angles. Item Configuration Switch ACOn "Lounge AC ON/OFF" { channel="coolmasternet:hvac:main:a:on"} String ACMode "Lounge AC Mode" { channel="coolmasternet:hvac:main:a:mode" } Number ACTemp "Lounge Temp" { channel="coolmasternet:hvac:main:a:current_temp" } Number ACSet "Lounge AC Set" { channel="coolmasternet:hvac:main:a:set_temp" } String ACFan "Lounge AC Fan" { channel="coolmasternet:hvac:main:a:fan_speed" } String ACLouvre "Lounge AC Louvre" { channel="coolmasternet:hvac:main:a:louvre_angle" } Skip to main content Rumbo A Mi Pueblo - Ruben Benavides \| Frontera Project Rumbo A Mi Pueblo Full Track Loading Player ... Audio excerpt Loading Player ... Label Cobra Catalog Number CO-207-A Recording Format 45 Composer Garcia, Carmelita Genre Porro Performer Ruben Benavides Performer Listed on Media Ruben Benavides Recording Format 45 Condition: E Subject return, homecoming, reflection, lament Label Cobra Country USA Catalog Number CO-207-A Genre Porro Location of Label: P. O. Box 28123 San Antonio 28, Texas Transfer Date: Friday, June 8, 2007 Donated By: Chris Strachwitz Add Your Note Plain text • No HTML tags allowed. • Web page addresses and e-mail addresses turn into links automatically. • Lines and paragraphs break automatically. Other Recordings by Ruben Benavides	# CoolMasterNet Binding The CoolMasterNet binding is used to control CoolMasterNet HVAC bridge devices via the “ASCII I/F” plaintext TCP protocol. ## Discovery The CoolMasterNet protocol does not support automatic discovery. ## Thing Configuration - controller is an openHAB “bridge” representing a single CoolMasterNet device. - hvac is an HVAC device connected to a controller and identified by a CoolMasterNet UID. Example `demo.things` configuration for two HVAC devices on a CoolMasterNet bridge at 192.168.0.100: ```things Bridge coolmasternet:controller:main [ host="192.168.0.100" ] { Thing hvac a [ uid="L1.100" ] Thing hvac b [ uid="L1.101" ] } ``` ## Channels \| Channel \| Item Type \| Description \| \|--------------\|-----------\|----------------------------------------------------------------------------------------------\| \| on \| Switch \| Turn HVAC unit on and off. \| \| mode \| String \| HVAC mode (`cool`, `heat`, `auto`, `dry`, `fan`). \| \| fan_speed \| String \| Fan speed (`l`, `m`, `h`, `t`, `a` = Low, Medium, High, Top, Auto). \| \| set_temp \| Number \| Target temperature setpoint in °C. \| \| current_temp \| Number \| Current temperature in °C at the HVAC unit. \| \| louvre \| String \| Louvre angle (`0`, `a`, `h`, `3`, `4`, `6`, `v` = No Control, Auto Swing, Horizontal, 30°, 45°, 60°, Vertical). \| ## Item Configuration ```items Switch ACOn "Lounge AC ON/OFF" { channel="coolmasternet:hvac:main:a:on" } String ACMode "Lounge AC Mode" { channel="coolmasternet:hvac:main:a:mode" } Number ACTemp "Lounge Temp" { channel="coolmasternet:hvac:main:a:current_temp" } Number ACSet "Lounge AC Set" { channel="coolmasternet:hvac:main:a:set_temp" } String ACFan "Lounge AC Fan" { channel="coolmasternet:hvac:main:a:fan_speed" } String ACLouvre "Lounge AC Louvre" { channel="coolmasternet:hvac:main:a:louvre_angle" } --- # Rumbo A Mi Pueblo Performer: Ruben Benavides Composer: Garcia, Carmelita Genre: Porro Label: Cobra Catalog Number: CO-207-A Recording Format: 45 Condition: E Subject: return, homecoming, reflection, lament Country: USA Location of Label: P. O. Box 28123, San Antonio 28, Texas Transfer Date: Friday, June 8, 2007 Donated By: Chris Strachwitz Audio - Full Track - Audio excerpt --- ## Other Recordings by Ruben Benavides	701	647	5,813,092,192,204,170,000	concat	[ "concat_full" ]	0.75	true	null
-7,432,029,879,850,744,000	JIM ROHN 12 PILARES PDF JIM ROHN 12 PILARES PDF Doce Pilares (Spanish Edition) [Jim Rohn, Chris Widener] on Aquí está lo mejor del libro: Esta novela, y sus 12 pilares, se basa en las lecciones. This Page is automatically generated based on what Facebook users are interested in, and not affiliated with or endorsed by anyone associated with the topic. LOS 12 PILARES,JIM ROHN. 5 likes. Book. LOS 12 PILARES,JIM ROHN. Privacy · Terms. About. LOS 12 PILARES,JIM ROHN. Book. 5 people like this topic. Author: Tom Dull Country: Antigua & Barbuda Language: English (Spanish) Genre: Life Published (Last): 3 June 2011 Pages: 187 PDF File Size: 5.81 Mb ePub File Size: 11.69 Mb ISBN: 272-2-23979-840-8 Downloads: 51442 Price: Free* [*Free Regsitration Required] Uploader: Brarr Doce Pilares spanish Edition by Chris Widener. El Hombre Mas Rico de Babilonia: At the same time, he participated in a personal development business called “Adventures in Achievement”, which featured both live seminars as well as personal development workshops. If you are a pilaers for this product, would you like to suggest updates through seller support? Martin Paperback, Views Read Edit View history. He then began pilarees seminars all over the country, telling his story and teaching his personal development philosophy. Rohn left college after just one year [2] and started his professional life by working as a human resource manager for department store Sears. From Wikipedia, the free encyclopedia. Be pilaees first to review this item Would you like to tell us about a lower price? Packaging should be the same as what is found in a retail store, unless the item is handmade or was packaged by the manufacturer in non-retail packaging, such as an unprinted box or plastic bag. APOSTILA DE FORRAGICULTURA PDF Doce Pilares Jim Rohn Chris Widener \| eBay We have ratings, but no written reviews for this, yet. Then you can start reading Kindle books on your smartphone, tablet, or computer – no Kindle device required. Show More Show Less. InRohn joined Shoaff’s direct selling business AbundaVita as a distributor. You may also like. Around this time, a friend invited him to a lecture given by famous entrepreneur John Earl Shoaff. Share your thoughts with other customers. See all 6 brand new listings. InRohn resigned his distributorship with AbundaVita and joined Nutri-Bio, another direct selling company. Hughes the founder of Herbalife International and life strategist Tony Robbins in the late s. In when Nutri-Bio expanded into CanadaShoaff and the other founders selected Rohn as a vice president for the organization. Uzumaki 3-in-1, Deluxe Edition Includes vols. Skip to main content. To get the free app, enter your mobile phone number. Amazon Music Stream millions of songs. Mixcloud on Facebook Luxury Edition Audiobooks in Spanish. By using this site, you agree to the Terms of Use and Privacy Policy. Delivery and Returns see our delivery rates and policies thinking of returning an item? KARG ELERT FLUTE PDF Get to Know Us. Enter your mobile number or email address below and we’ll send you a rhn to download the free Kindle App. Amazon Business Service for business customers. Editions of Twelve Pillars by Jim Rohn See our Returns Policy. Many of his speeches are now available jum free on social media platforms like YouTube and Instagram. This section relies too much on references to primary sources. A Novel by John GrishamHardcover Product Key Features Publication Year. This item doesn’t belong on this page. Throughout the s, Rohn conducted a number of seminars for Standard Oil. Visit our Help Pages. Maravillosa historia, facil de leer, te estimula, maravilloso libro! La filosof de Jim resplandece! See details for additional description. Chris Bohjalian 1st Edition Books. Read more Read less. The Illustrated Collection Books by J. A Ppilares of Thrones Set: Deluxe Edition Nonfiction Books in Spanish. It was at this point that the company’s founders, including Shoaff, started to mentor him. Limited Edition Nonfiction Books in Spanish. Want to Buy (FJ Related Items) - Page 99 - Toyota FJ Cruiser Forum Want to Buy (FJ Related Items) List items you are looking for to buy Threads in Forum : Want to Buy (FJ Related Items) Forum Tools Search this Forum Rating Thread / Thread Starter Last Post Reverse Sort Order Replies Views 02-01-2011 12:52 PM by Gunny Last Post 3 5,732 Sticky Thread Sticky: Buying and Selling on FJCFs.com 10-22-2010 03:28 PM by five-by-five Last Post 0 5,207 04-03-2015 03:28 PM by DefJayDan Last Post 5 525 04-03-2015 02:23 PM by iwashmycar Last Post 4 1,904 04-03-2015 08:35 AM by CJ_Y Last Post 0 269 04-02-2015 06:06 PM by LordHumungus Last Post 0 197 04-02-2015 12:51 PM by fjflx Last Post 0 241 04-01-2015 08:30 PM by bblaze Last Post 0 243 04-01-2015 07:30 PM by Supere Last Post 0 216 04-01-2015 04:33 PM by DefJayDan Last Post 0 256 04-01-2015 04:09 PM by 07cruiser Last Post 7 510 04-01-2015 10:02 AM by wa99019 Last Post 3 353 04-01-2015 07:18 AM by socalastro Last Post 2 381 03-31-2015 09:55 AM by FJenali Last Post 1 309 03-30-2015 11:36 PM by FJaustin Last Post 0 245 03-30-2015 04:04 PM by Tackleberry Last Post 0 270 03-30-2015 01:55 PM by commish Last Post 0 223 03-29-2015 07:54 PM by iwrdesigns Last Post 3 493 03-29-2015 07:33 PM by yak 247 Last Post 1 224 barrier, pet, springtail WTB: pet barrier 03-28-2015 10:55 PM by shack Last Post 1 288 2wd, 4wd, level, sale, springs 4 Wheel Drive Front Springs 03-28-2015 03:06 PM by tgormtx Last Post 1 416 03-28-2015 03:03 PM by tgormtx Last Post 1 286 Post New Thread Display Options Currently Active Users Showing threads 1961 to 1980 of 9425 10 (0 members & 10 guests) Forum Tools Search this Forum Mark This Forum Read View Parent Forum Search this Forum : Advanced Search New posts New posts More than 15 replies or 150 views Hot thread with new posts No new posts No new posts No new posts Hot thread with no new posts Closed Thread Thread is closed Posting Rules You may post new threads You may post replies You may not post attachments You may not edit your posts BB code is On Smilies are On [IMG] code is On HTML code is Off For the best viewing experience please update your browser to Google Chrome	# JIM ROHN – DOCE PILARES (Spanish Edition) Título: Doce Pilares Autores: Jim Rohn, Chris Widener Detalles del archivo - Autor (uploader): Tom Dull - País: Antigua & Barbuda - Idioma: Inglés (versión en español) - Género: Life / Desarrollo personal - Publicación: 3 de junio de 2011 - Páginas: 187 - Tamaño PDF: 5.81 Mb - Tamaño ePub: 11.69 Mb - ISBN: 272-2-23979-840-8 - Descargas: 51 442 - Precio: Gratis* (Registro requerido) - Uploader: Brarr --- # Want to Buy (FJ Related Items) – Page 99 List items you are looking for to buy. ## Threads - 02-01-2011 12:52 PM* by Gunny – Replies: 3, Views: 5,732 - Sticky by five-by-five: Sticky: Buying and Selling on FJCFs.com – Replies: 0, Views: 5,207 - 04-03-2015 03:28 PM by DefJayDan – Replies: 5, Views: 525 - 04-03-2015 02:23 PM by iwashmycar – Replies: 4, Views: 1,904 - 04-03-2015 08:35 AM by CJ_Y – Replies: 0, Views: 269 - 04-02-2015 06:06 PM by LordHumungus – Replies: 0, Views: 197 - 04-02-2015 12:51 PM by fjflx – Replies: 0, Views: 241 - 04-01-2015 08:30 PM by bblaze – Replies: 0, Views: 243 - 04-01-2015 07:30 PM by Supere – Replies: 0, Views: 216 - 04-01-2015 04:33 PM by DefJayDan – Replies: 0, Views: 256 - 04-01-2015 04:09 PM by 07cruiser – Replies: 7, Views: 510 - 04-01-2015 10:02 AM by wa99019 – Replies: 3, Views: 353 - 04-01-2015 07:18 AM by socalastro – Replies: 2, Views: 381 - 03-31-2015 09:55 AM by FJenali – Replies: 1, Views: 309 - 03-30-2015 11:36 PM by FJaustin – Replies: 0, Views: 245 - 03-30-2015 04:04 PM by Tackleberry – Replies: 0, Views: 270 - 03-30-2015 01:55 PM by commish – Replies: 0, Views: 223 - 03-29-2015 07:54 PM by iwrdesigns – Replies: 3, Views: 493 - 03-29-2015 07:33 PM by yak 247 – barrier, pet, springtail: WTB: pet barrier – Replies: 1, Views: 224 - 03-28-2015 10:55 PM by shack – Replies: 1, Views: 288 - 03-28-2015 03:06 PM by tgormtx – Replies: 1, Views: 416 - 03-28-2015 03:03 PM by tgormtx – 2wd, 4wd, level, sale, springs: 4 Wheel Drive Front Springs – Replies: 1, Views: 286	1,725	872	-7,432,029,879,850,744,000	concat	[ "concat_full" ]	0.75	true	null
2,297,489,978,138,874,000	Audio Epicness Epicness Epicness — Encourage, powerful epic music. There are powerul rhythmic epic drums, many strings, choir, brass section and melodic solo. Perfect for creating epic mood in various projects. Music is perfect for historical films, movies about superheroes, trailers, teasers, intro, games and many other projects! Included versions: 1. Main – 1:42 2. Shot Epic – 0:49 Epicness - 1 by by by by by by Write My Paper-Who Can Write My Papers for Me? This can be a question that is common university campuses all over the globe, and Aussie campuses are no different. Most ask this relevant concern simply because they simply don’t know the best place to turn for paper writing that’ll be legit and professional. Lots of pupils have actually tried online writing solutions and been seriously “burned” by either fraudulent companies or organizations which use international and/or amateur writers. These products because they are either plagiarized or poorly researched and written that they receive cannot be submitted. In some instances, an organization creates an on-line store, just take purchases and cash, never ever creates a penned word, after which closes down. Later on, it starts up under a various title. Submit requirements that are detailed Offer re re payment information Cooperate aided by the journalist Receive your perfect paper What things to Seek Out We do want to boast about our online writing that is academic – EssayRoo.com. And before going to your writing business and state “Write my paper in my situation,” you ought to discover exactly exactly what comprises a specialist and reliable writing service. Here you will find the things you have to search for. There must be an address that is physical the organization. And there must be a phone number. It with the company name when you call that phone number, a live person should answer. Lots of writing businesses utilize answering solutions they are open 24 hours a day so they can say. But those individuals understand absolutely absolutely nothing in regards to the writing industry and cannot even reply to your questions. They are going to just tell you firmly to fill away an purchase kind and go on it up along with your author. We called one and asked they stated, “yes. should they could perform a 120-page dissertation in 2 days, and” Point made. Essay Roo trains every one of its customer care staff as well as can answer your entire concerns right then and there. Browse the internet site meticulously. It ought to be informative and written in appropriate English. Plenty of organizations are operated and owned by foreigners whom then attempt to compose content for his or her internet web web sites. If they can’t also employ a indigenous English-speaking author to compose their internet sites, exactly what do you believe you’ll get if you let them know to, “Write me a paper?” You will get junk. Essay Roo is just a expert business utilizing only verified article writers. Australian pupils can get absolutely absolutely nothing nevertheless the most readily useful from all of these educational scholars. Turn to make sure that the business has written policies. While policies on their own try not to suggest a business will probably give you the most readily useful writing that is academic many actually amateur solutions won’t also bother to own them. Make sure to browse the policies to know your legal rights as an individual if you should be maybe maybe not pleased with everything you get, and also to understand how they are going to back their claims up of plagiarism-free writing. At Essay Roo, you’ll find really step-by-step policies about our whole process therefore the legal rights you must require revisions and soon you are pleased. You’ll also have a warranty of privacy plus the vow of a plagiarism report that is scan show that the product you obtain is a genuine. Be sure that there is certainly some framework in position so that you can talk straight with all the person that are going to be writing your paper. A person who is a professional, qualified writer need no nagging problem talking about your order to you. In reality, s/he will welcome such discussion, therefore as you expect it to be that it will be researched and written just. If you’re unable to consult with your author, the solution is certainly not legit. At Essay Roo, you will will have usage of your journalist – no exceptions. If you state, “I am in the exact middle of composing my paper and cannot finish it,” what’s the reaction you receive? Will it works in what you have and improve it, or will they insist upon starting anew? Debateable businesses will frequently insist upon beginning over, as they are utilizing a pre-written written piece that they’re attempting to “spin.” Essay Roo will require everything you have previously done and work along with it, enhance it, and increase it. May be the solution asking for many information regarding your need or simply for this issue and web page size? Organizations with purchase kinds that don’t have detailed type industries for you really to finish aren’t enthusiastic about your certain demands. University trainers can be extremely particular in regards to the details. Essay Roo knows this and wishes one to provide every one of the particulars. Moreover, the chance is had by you to provide increased detail to your journalist when you have forgotten any such thing. Just Exactly Just What Pupils Say They Need “If we state, ‘write my paper for me,’ we expect the author to be controlled by the thing I actually need. In the event that author does do this, n’t it really is a waste of my money.” “My professors are sticklers about their format demands. A writer is needed by me that will follow those guidelines.” Me compose my paper, we anticipate that it is initial, maybe not some little bit of trash that’s been ‘lifted’ from the online.“If We spend decent money for anyone to help” “i would like a writing solution that may fulfill urgent due dates, because sometimes we discover during the minute that is last I can’t get something finished.” “i would like a writing business which will keep taking care of my paper until i will be pleased with it.” “I should obtain the paper I purchase. It will not be sold to someone else, and i want a warranty of this.” “i must have the ability to contact my author or perhaps the business whenever you want. We may require assist in the center of the evening.” They are all reasonable and demands that are legitimate and EssayRoo.com fulfills all of them, after which some. Why Pupils in Australia Love United States We know very well what Aussie undergraduate and graduate pupils require. We have the writing that is high of Australian university and universities. The investigation, the dwelling, the tone, the vocabulary and, most crucial the information shall meet with the highest requirements – we guarantee it. Whenever pupils receive papers that Essay Roo produces, they already know that just educational experts published them. And so they keep returning, they will always get because they know that the highest quality is what. You are able to turn into a happy consumer of essay Roo now. Provide us with a purchase for the very first paper, and we shall persuade you. Write My Paper-Who Can Write My Papers for...	# Epicness Epicness — Energizing, powerful epic music featuring rhythmic epic drums, lush strings, soaring choir, bold brass and a melodic solo. Perfect for creating an epic mood in historical films, superhero movies, trailers, teasers, intros, games and more. ## Included versions 1. Main – 1:42 2. Short Epic – 0:49 --- # Write My Paper—Who Can Write My Papers for Me? This question is common on university campuses worldwide, and Aussie campuses are no different. Many students simply don’t know the best place to turn for legit, professional paper writing. Lots have tried online writing services and been “burned” by fraudulent companies or those that use international and/or amateur writers. Their products are either plagiarized or poorly researched, and thus can’t be submitted. In some instances, an organization takes orders and cash, never delivers a word, then closes down—only to reappear under a different name. ## How It Works - Submit detailed requirements - Provide payment information - Cooperate with the writer - Receive your perfect paper ## What to Look For We don’t just boast about our academic writing at EssayRoo.com—we deliver. Before you ask any writing service to “write my paper for me,” make sure they meet these criteria: 1. Physical address and phone number When you call, a live person (trained in academic writing) should answer. Many services use 24/7 answering centers that know nothing about writing and can’t answer your questions. 2. Professional, English-only website If they can’t hire a native English–speaking writer for their own site, you’ll get junk if you hire them. 3. Clear written policies Amateur services often don’t bother. You need to know your rights, how revisions work, and guarantees against plagiarism. At Essay Roo, you’ll find step-by-step policies, a privacy warranty, and a plagiarism-scan report. 4. Direct communication with your writer A qualified writer will welcome discussion about your order. If you can’t contact your author, the service isn’t legit. Essay Roo gives you full access—no exceptions. 5. Ability to build on your draft If you say, “I’m halfway through my paper,” a real service will work with what you have. Dishonest services often insist on starting over because they rely on prewritten “spun” content. We enhance and expand whatever you’ve done. 6. Detailed order form If the form only asks for topic and page count, they’re not interested in your specific requirements. University instructors can be very particular—Essay Roo wants every detail, and you can add more directly to your writer if needed. ## What Students Say They Need - “If we say ‘write my paper for me,’ we expect the author to follow exactly what I need. Otherwise, it’s a waste of money.” - “My professors are sticklers about formatting. I need a writer who will follow their guidelines.” - “I want my paper to be original, not just lifted from the web.” - “I pay good money for this help—I expect them to meet urgent deadlines.” - “I need revisions until I’m completely satisfied.” - “I must receive the paper I ordered, not a resale, and get a guarantee of that.” - “I want to contact my writer or the service anytime—even in the middle of the night.” All of these are reasonable, and EssayRoo.com meets them all—then some. ## Why Students in Australia Love Us We know exactly what Aussie undergraduates and postgraduates require. Our writers meet the high standards of Australian universities: the research, the style, the tone, the vocabulary, and—most crucial—the content itself. When students receive an Essay Roo paper, they know it was written by academic experts. They keep returning because they know quality is guaranteed. Become a satisfied Essay Roo client today. Place your first order and see for yourself!	1,460	837	2,297,489,978,138,874,000	concat	[ "concat_full" ]	0.75	true	null
-6,110,457,051,473,118,000	Ad Ad Ad Ad Ad Ad Ad Ad Electronics Production \| December 02, 2005 Part Miner established in France Part Miner's services is now also available in France. The French company Star-Achats has now entered an agreement with the component broker Part Miner to be their sales agency in France. Additional services such as information concerning RoHS will also be available. Ad Ad Ad Ad Load more news October 11 2019 3:09 pm V14.5.0-1 PreviewAntivirus November ueno saigo takamori statue November ueno saigo takamori statue is a photo of sage author. This photo includes Saigo, Taiga drama, NHK, The end of the Tokugawa period, Takamori Saigo tags. To download photo (S, L, M sizes) you need to register the account and log in. As the free account, you can download for free with some limits. As the premium account, you can download unlimited, no waiting time, etc. Enjoin premium membership at here S 640 x 426 px 331 KB FREE M 1920 x 1278 px 3 MB FREE L 5456 x 3632 px 11 MB FREE License Free for commercial use No attribution required Stock photos similar to November Ueno Saigo Takamori statue November Ueno Saigo Takamori statue Illustration similar to November Ueno Saigo Takamori statue Takamori Saigo statue Vector silhouettes similar to November Ueno Saigo Takamori statue Bronze statue What is this form? Currently the texts of many languages are translated by machine. If you find any text incorrectly translated, please help to contribute in the below form. We truly appreciate all of your contributions. Thanks in advance! 0 selections	# Electronics Production \| December 02, 2005 ## Part Miner established in France Part Miner’s services is now also available in France. The French company Star-Achats has now entered an agreement with the component broker Part Miner to be their sales agency in France. Additional services such as information concerning RoHS will also be available. --- # November Ueno Saigo Takamori statue November ueno saigo takamori statue is a photo of sage author. This photo includes Saigo, Taiga drama, NHK, The end of the Tokugawa period, Takamori Saigo tags. To download photo (S, L, M sizes) you need to register the account and log in. As the free account, you can download for free with some limits. As the premium account, you can download unlimited, no waiting time, etc. Enjoin premium membership at here ## Available Sizes \| Size \| Resolution \| File Size \| Price \| \|------\|-----------------\|-----------\|-------\| \| S \| 640 × 426 px \| 331 KB \| FREE \| \| M \| 1920 × 1278 px \| 3 MB \| FREE \| \| L \| 5456 × 3632 px \| 11 MB \| FREE \| ## License Free for commercial use No attribution required ## Similar Stock Photos *Stock photos similar to November Ueno Saigo Takamori statue* - November Ueno Saigo Takamori statue Illustration similar to November Ueno Saigo Takamori statue - Takamori Saigo statue Vector silhouettes similar to November Ueno Saigo Takamori statue** - Bronze statue	400	351	-6,110,457,051,473,118,000	concat	[ "concat_full" ]	0.75	true	null
2,376,730,771,361,572,400	Dr. Caleb Kesse Firempong Senior Lecturer Dept: Biochemistry and Biotechnology Office: Department of Biochemistry and Biotechnology College of Science Room B16 KNUST E-mail: Send quick mail Research Areas/Interests Current research focus is on lipid raft biomaterial for screening novel antitumor agents from natural sources. Major research interests also include c...~more Publications 2019 [1] Zhu, Yuan, Wen Xu, Jiajia Zhang, Youwu Liao, Caleb Kesse Firempong, Michael Adu-Frimpong, Wenwen Deng, Huiyun Zhang, Jiangnan Yu, and Ximing Xu. "Self-microemulsifying Drug Delivery System for Improved Oral Delivery of Limonene: Preparation, Characterization, in vitro and in vivo Evaluation." AAPS PharmSciTech 20, no. 4 (2019): 153. (SCI, IF =1.6) [2] Mensah, Merlin LK, Gustav Komlaga, Arnold D. Forkuo, Caleb Firempong, Alexander K. Anning, and Rita A. Dickson. "Toxicity and Safety Implications of Herbal Medicines Used in Africa." Herbal Medicine (2019): 63. [3] Yingshu Feng, Jinyi Wan, Baoding Chen, Yuan Zhu, Caleb Kesse Firempong, Chunlai Feng, Teruko Imai, Jiangnan Yu, Ximing Xu. “In vitro metabolic profiling of periplogenin in rat liver microsomes and its associated enzyme-kinetic evaluationCurrent Pharmaceutical Analysis. (2019). DOI: 10.2174/1573412915666190101101710(SCI, IF =0.859) 2018 [1] Zhen, Lijun, Qiuyu Wei, Qilong Wang, Huiyun Zhang, Michael Adu-Frimpong, Caleb Kesse Firempong, Ximing Xu, and Jiangnan Yu. "Preparation and in vitro/in vivo evaluation of 6-Gingerol TPGS/PEG-PCL polymeric micelles." Pharmaceutical Development and Technology. (2018): 1-30. (SCI, IF =0.60) [2] Adu?Frimpong, Michael, Caleb Kesse Firempong, Emmanuel Omari?Siaw, Qilong Wang, Yusif Mohammed Mukhtar, Wenwen Deng, Qingtong Yu, Ximing Xu, and Jiangnan Yu. "Preparation, optimization, and pharmacokinetic study of nanoliposomes loaded with triacylglycerol?bound punicic acid for increased antihepatotoxic activity." Drug development research (2018). (SCI, IF =0.60) [3] Wang, Qilong, Qiuxuan Yang, Xia Cao, Qiuyu Wei, Caleb K. Firempong, Min Guo, Feng Shi, Ximing Xu, Wenwen Deng, and Jiangnan Yu. "Enhanced oral bioavailability and anti-gout activity of [6]-shogaol-loaded solid lipid nanoparticles." International journal of pharmaceutics 550, no. 1-2 (2018): 24-34. (SCI, IF =3.862) [4] Feng, Yingshu, Yuan Zhu, Jinyi Wan, Xia Yang, Caleb Kesse Firempong, Jiangnan Yu, and Ximing Xu. "Enhanced oral bioavailability, reduced irritation and increased hypolipidemic activity of self-assembled capsaicin prodrug nanoparticles." Journal of Functional Foods 44 (2018): 137-145 (SCI, IF =3.144). 2017 [1] Wang Yuanwen, Shicheng Wang, Caleb Kesse Firempong, Huiyun Zhang, Miaomiao Wang, Ya Zhang, Yuan Zhu, Jiangnan Yu, and Ximing Xu. "Enhanced Solubility and Bioavailability of Naringenin via Liposomal Nanoformulation: Preparation and In Vitro and In Vivo Evaluations." AAPS PharmSciTech (2017): 1-9. (SCI, IF =1.6) 2016 [1] Omari-Siaw, Emmanuel, Qilong Wang, Congyong Sun, Zengquan Gu, Yuan Zhu, Xia Cao, Caleb Kesse Firempong, Rita Agyare, Ximing Xu, and Jiangnan Yu. "Tissue distribution and enhanced in vivo anti-hyperlipidemic-antioxidant effects of perillaldehyde-loaded liposomal nanoformulation against Poloxamer 407-induced hyperlipidemia." International Journal of Pharmaceutics. (2016). (SCI, IF =3.65) [2] Caleb Kesse Firempong, Kwabena Nsiah, Francis Agyemang Yeboah. Some clinical and haematological effect of G6PD deficiency among individuals with sickle cell disorders in Kumasi, Ghana. The Journal of Medical Research. (2016): 2 (3): 81-85 [3] C. K. Firempong, L.A. Andoh., W.G. Akanwariwiak, P. Addo-Fordjour, P. Adjakofi. Phytochemical screening and antifungal activities of crude ethanol extracts of red-flowered silk cotton tree (Bombax buonopozense) and Calabash nutmeg (Monodora myristica) on Candida albicans. Journal of Microbiology and Antimicrobials. 2016 8 (4): 22-27. [4] Caleb Kesse Firempong, Hui Yun Zhang, Yan Wang, Jingjing Chen , Xia Cao, Jie Zhou, Qiang Wang, Shan-Shan Tong, Jiangnan Yu and Ximing Xu. Segetoside I, a plant-derived bisdesmosidic saponin, induces apoptosis in human hepatoma cells in vitro and inhibits tumor growth in vivo. Pharmacological Research. 2016. DOI: 10.1016/j.phrs.2016.04.032 (SCI, IF =4.4 1) [5] Huiyun Zhang, Caleb Kesse Firempong, Yuanwen Wang, Wenqian Xu, Miaomiao Wang, Xia-Cao, Yuan Zhu, Shanshan Tong, Jiangnan Yu and Ximing Xu. Enhanced in vitro antitumor activity and oral bioavailability of ergosterol-loaded poly(lactide-co-glycolide) nanoparticles. Acta Pharmacologica sinica. 2016. (SCI, IF =3.16) [6] Wang Yuanwen, Shicheng Wang, Caleb Kesse Firempong, Huiyun Zhang, Miaomiao Wang, Ya Zhang, Yuan Zhu, Jiangnan Yu, and Ximing Xu. "Enhanced Solubility and Bioavailability of Naringenin via Liposomal Nanoformulation: Preparation and In Vitro and In Vivo Evaluations." AAPS PharmSciTech (2016): 1-9. (SCI, IF =1.6) [7] Omari-Siaw Emmanuel, Yuan Zhu, Houyong Wang, Wei Peng, Caleb Kesse Firempong, Yuan Wen Wang, Xia Cao, Wenwen Deng, Jiangnan Yu, and Ximing Xu. "Hypolipidemic potential of perillaldehyde-loaded self-nanoemulsifying delivery system in high-fat diet induced hyperlipidemic mice: Formulation, in vitro and in vivo evaluation." European Journal of Pharmaceutical Sciences 85 (2016): 112-122. (SCI, IF =3.35) [8] Feng, Yingshu, Congyong Sun, Yangyang Yuan, Yuan Zhu, Jinyi Wan, Caleb Kesse Firempong, Emmanuel Omari-Siaw et al. "Enhanced oral bioavailability and in vivo antioxidant activity of chlorogenic acid via liposomal formulation." International Journal of Pharmaceutics 501, no. 1 (2016): 342-349. (SCI, IF =3.65) [9] Shi Feng, Yingying Zhao, Caleb Kesse Firempong, and Ximing Xu. "Preparation, characterization and pharmacokinetic studies of linalool-loaded nanostructured lipid carriers." Pharmaceutical Biology (2016): 1-9. (SCI, IF =1.24) 2015 [1] Caleb Kesse Firempong, Xia Cao, Shan-Shan Tong, Jiangnan Yu and Ximing Xu. Prospects of multitarget lipid-raft-coated silica beads: Remarkable on-line biomaterial for discovering multitarget antitumor lead compounds. RSC Advances. 2015 5: 49330 (SCI, IF=3.708) [2] Yingying Zhao, Chaonan Sun, Feng Shi, Caleb Kesse Firempong, Jiangnan Yu, Ximing Xu, Weiming Zhang. Preparation, characterization and pharmacokinetics study of capsaicin via hydroxypropyl-beta-cyclodextrin encapsulation. Pharmaceutical Biology. 2015 8:1-9. (SCI, IF=1.337) [3] Caleb Kesse Firempong, Hui-Yun Zhang , Jia-jia Zhang, Yan Wang, Xia Cao, Emmmanuel Omari-Siaw, Shan-Shan Tong, Jiangnan Yu and Ximing Xu. Lipid raft biomaterial as a mass screening affinity tool for rapid identification of potential antitumor Chinese herbal medicine. European Journal of Intergrative Medicine.2015 7: 365-371 (SCI, IF=0.88). Print page SEND QUICK MAIL TO STAFF Subject Message Your Email Address: Note: this is to help the staff contact you back. • Haven't found the right supplier yet ? AliSource 1 request,multiple quotations 1-click quotation comparison OEM,ODM & multi-category buying • Want product and industry knowledge for "dashiki wo..." ? Trade Alert Trade Alerts are FREE updates on topics such as trending hot products, buying requests and supplier information - sent directly to your email inbox! Do you want to show dashiki women a... or other products of your own company? Display your Products FREE now! ensearchweb011176069101	# Dr. Caleb Kesse Firempong Senior Lecturer Dept: Biochemistry and Biotechnology Office: Department of Biochemistry and Biotechnology, College of Science, Room B16, KNUST E-mail: Send quick mail --- ## Research Areas/Interests Current research focus is on lipid raft biomaterial for screening novel antitumor agents from natural sources. Major research interests also include c...~more --- ## Publications ### 2019 1. Zhu, Yuan, Wen Xu, Jiajia Zhang, Youwu Liao, Caleb Kesse Firempong, Michael Adu-Frimpong, Wenwen Deng, Huiyun Zhang, Jiangnan Yu, and Ximing Xu. “Self-microemulsifying Drug Delivery System for Improved Oral Delivery of Limonene: Preparation, Characterization, in vitro and in vivo Evaluation.” AAPS PharmSciTech 20, no. 4 (2019): 153. (SCI, IF =1.6) 2. Mensah, Merlin LK, Gustav Komlaga, Arnold D. Forkuo, Caleb Firempong, Alexander K. Anning, and Rita A. Dickson. “Toxicity and Safety Implications of Herbal Medicines Used in Africa.” Herbal Medicine (2019): 63. 3. Yingshu Feng, Jinyi Wan, Baoding Chen, Yuan Zhu, Caleb Kesse Firempong, Chunlai Feng, Teruko Imai, Jiangnan Yu, Ximing Xu. “In vitro metabolic profiling of periplogenin in rat liver microsomes and its associated enzyme-kinetic evaluation.” Current Pharmaceutical Analysis (2019). DOI: 10.2174/1573412915666190101101710 (SCI, IF =0.859) ### 2018 1. Zhen, Lijun, Qiuyu Wei, Qilong Wang, Huiyun Zhang, Michael Adu-Frimpong, Caleb Kesse Firempong, Ximing Xu, and Jiangnan Yu. “Preparation and in vitro/in vivo evaluation of 6-Gingerol TPGS/PEG-PCL polymeric micelles.” Pharmaceutical Development and Technology (2018): 1-30. (SCI, IF =0.60) 2. Adu-Frimpong, Michael, Caleb Kesse Firempong, Emmanuel Omari-Siaw, Qilong Wang, Yusif Mohammed Mukhtar, Wenwen Deng, Qingtong Yu, Ximing Xu, and Jiangnan Yu. “Preparation, optimization, and pharmacokinetic study of nanoliposomes loaded with triacylglycerol-bound punicic acid for increased antihepatotoxic activity.” Drug Development Research (2018). (SCI, IF =0.60) 3. Wang, Qilong, Qiuxuan Yang, Xia Cao, Qiuyu Wei, Caleb K. Firempong, Min Guo, Feng Shi, Ximing Xu, Wenwen Deng, and Jiangnan Yu. “Enhanced oral bioavailability and anti-gout activity of [6]-shogaol-loaded solid lipid nanoparticles.” International Journal of Pharmaceutics 550, no. 1-2 (2018): 24-34. (SCI, IF =3.862) 4. Feng, Yingshu, Yuan Zhu, Jinyi Wan, Xia Yang, Caleb Kesse Firempong, Jiangnan Yu, and Ximing Xu. “Enhanced oral bioavailability, reduced irritation and increased hypolipidemic activity of self-assembled capsaicin prodrug nanoparticles.” Journal of Functional Foods 44 (2018): 137-145. (SCI, IF =3.144) ### 2017 1. Wang, Yuanwen, Shicheng Wang, Caleb Kesse Firempong, Huiyun Zhang, Miaomiao Wang, Ya Zhang, Yuan Zhu, Jiangnan Yu, and Ximing Xu. “Enhanced Solubility and Bioavailability of Naringenin via Liposomal Nanoformulation: Preparation and In Vitro and In Vivo Evaluations.” AAPS PharmSciTech (2017): 1-9. (SCI, IF =1.6) ### 2016 1. Omari-Siaw, Emmanuel, Qilong Wang, Congyong Sun, Zengquan Gu, Yuan Zhu, Xia Cao, Caleb Kesse Firempong, Rita Agyare, Ximing Xu, and Jiangnan Yu. “Tissue distribution and enhanced in vivo anti-hyperlipidemic-antioxidant effects of perillaldehyde-loaded liposomal nanoformulation against Poloxamer 407-induced hyperlipidemia.” International Journal of Pharmaceutics (2016). (SCI, IF =3.65) 2. Caleb Kesse Firempong, Kwabena Nsiah, Francis Agyemang Yeboah. “Some clinical and haematological effect of G6PD deficiency among individuals with sickle cell disorders in Kumasi, Ghana.” The Journal of Medical Research 2(3) (2016): 81-85. 3. C. K. Firempong, L.A. Andoh, W.G. Akanwariwiak, P. Addo-Fordjour, P. Adjakofi. “Phytochemical screening and antifungal activities of crude ethanol extracts of red-flowered silk cotton tree (Bombax buonopozense) and Calabash nutmeg (Monodora myristica) on Candida albicans.” Journal of Microbiology and Antimicrobials 8(4) (2016): 22-27. 4. Caleb Kesse Firempong, Hui Yun Zhang, Yan Wang, Jingjing Chen, Xia Cao, Jie Zhou, Qiang Wang, Shan-Shan Tong, Jiangnan Yu, Ximing Xu. “Segetoside I, a plant-derived bisdesmosidic saponin, induces apoptosis in human hepatoma cells in vitro and inhibits tumor growth in vivo.” Pharmacological Research (2016). DOI: 10.1016/j.phrs.2016.04.032 (SCI, IF =4.41) 5. Huiyun Zhang, Caleb Kesse Firempong, Yuanwen Wang, Wenqian Xu, Miaomiao Wang, Xia-Cao, Yuan Zhu, Shanshan Tong, Jiangnan Yu, Ximing Xu. “Enhanced in vitro antitumor activity and oral bioavailability of ergosterol-loaded poly(lactide-co-glycolide) nanoparticles.” Acta Pharmacologica Sinica (2016). (SCI, IF =3.16) 6. Wang, Yuanwen, Shicheng Wang, Caleb Kesse Firempong, Huiyun Zhang, Miaomiao Wang, Ya Zhang, Yuan Zhu, Jiangnan Yu, Ximing Xu. “Enhanced Solubility and Bioavailability of Naringenin via Liposomal Nanoformulation: Preparation and In Vitro and In Vivo Evaluations.” AAPS PharmSciTech (2016): 1-9. (SCI, IF =1.6) 7. Omari-Siaw, Emmanuel, Yuan Zhu, Houyong Wang, Wei Peng, Caleb Kesse Firempong, Yuan Wen Wang, Xia Cao, Wenwen Deng, Jiangnan Yu, Ximing Xu. “Hypolipidemic potential of perillaldehyde-loaded self-nanoemulsifying delivery system in high-fat diet induced hyperlipidemic mice: Formulation, in vitro and in vivo evaluation.” European Journal of Pharmaceutical Sciences 85 (2016): 112-122. (SCI, IF =3.35) 8. Feng, Yingshu, Congyong Sun, Yangyang Yuan, Yuan Zhu, Jinyi Wan, Caleb Kesse Firempong, Emmanuel Omari-Siaw, et al. “Enhanced oral bioavailability and in vivo antioxidant activity of chlorogenic acid via liposomal formulation.” International Journal of Pharmaceutics 501, no. 1 (2016): 342-349. (SCI, IF =3.65) 9. Shi, Feng, Yingying Zhao, Caleb Kesse Firempong, Ximing Xu. “Preparation, characterization and pharmacokinetic studies of linalool-loaded nanostructured lipid carriers.” Pharmaceutical Biology (2016): 1-9. (SCI, IF =1.24) ### 2015 1. Caleb Kesse Firempong, Xia Cao, Shan-Shan Tong, Jiangnan Yu, Ximing Xu. “Prospects of multitarget lipid-raft-coated silica beads: Remarkable on-line biomaterial for discovering multitarget antitumor lead compounds.” RSC Advances 5 (2015): 49330. (SCI, IF =3.708) 2. Yingying Zhao, Chaonan Sun, Feng Shi, Caleb Kesse Firempong, Jiangnan Yu, Ximing Xu, Weiming Zhang. “Preparation, characterization and pharmacokinetics study of capsaicin via hydroxypropyl-beta-cyclodextrin encapsulation.” Pharmaceutical Biology 8 (2015): 1-9. (SCI, IF =1.337) 3. Caleb Kesse Firempong, Hui-Yun Zhang, Jia-jia Zhang, Yan Wang, Xia Cao, Emmmanuel Omari-Siaw, Shan-Shan Tong, Jiangnan Yu, Ximing Xu. “Lipid raft biomaterial as a mass screening affinity tool for rapid identification of potential antitumor Chinese herbal medicine.” European Journal of Integrative Medicine 7 (2015): 365-371. (SCI, IF =0.88) --- # Haven't found the right supplier yet? AliSource - 1 request, multiple quotations - 1-click quotation comparison - OEM, ODM & multi-category buying # Want product and industry knowledge for "dashiki wo..."? Trade Alert Trade Alerts are FREE updates on topics such as trending hot products, buying requests and supplier information—sent directly to your email inbox! --- Display your Products FREE now! Do you want to show dashiki women a… or other products of your own company? Display your Products FREE now!	2,135	2,110	2,376,730,771,361,572,400	concat	[ "concat_full" ]	0.75	true	null
1,700,959,707,392,225,000	THEBLOG4.ME Extended definition essay outline • 04.03.2019 Extended definition essay outline Create an outline to help organize your idea, and then begin the research process to determine the origin of the word as well as its evolution. Consider answering such questions as who created the word Did you know Shakespeare coined the words lonely and majestic? The more questions you answer, the more definition will be put into your essay! Did you like this article? Somewhere in your extended definition, you'll need to explain them as well, possibly by using short definitions explained later in this section. Figure G A formal sentence definition used in an extended definition Choosing the Sources of Definition When you write an extended definition, you literally grab at any of the writing resources or tools that will help you explain the term to your readers. This means considering all of the various sources of information that can help define the term adequately for example, description, process narration, causal discussion, and classification. Notice how many different kinds of writing are indicated by the outline of an extended definition shown in Figure G The key to writing a good extended definition is to choose the sources of definition to help readers understand the term being defined. Use the checklist to select the kinds of discussion to include in your extended definitions. And that's it - writing a definition essay turned out to be much less challenging, didn't it? Definition Essay Outline What is sometimes required for writing an essay, or in any case can facilitate the structuring of your paper is a definition essay outline. Simply put, an outline is a brief review of your work, which highlights its main points. This part of your paper shows the logicality of your essay's structure, and also helps to stick to a particular plan of presenting your thoughts, facts, and evidence. How to write a definition essay outline? A perfect outline would be as follows: Introduction paragraph. State clearly what you are going to define in your essay. Body paragraphs. History paragraph. Include the example that would illustrate a particular phenomenon in the context of history. Denotative definition paragraph. Focus on the definition from the official source dictionary. Connotative definition paragraph. Offer an example from your own experience and express your individual understanding of the certain phenomenon. When you are writing the introductory area you want to avoid using passive voice and you want to always rely upon active voice. Active voice requires your subjects to take direct action and this is an attention grabbing and powerful way to draft your first product. You also want to avoid using first person narrative in almost all cases and personal pronouns. Analyze the term from different angles and provide relevant explanation. More than three paragraphs may be necessary depending on the nature of your assignment. Here is an example of a good body paragraph structure: Body Paragraph 1: History and Origin Body Paragraph 2: Full dictionary explanation and use. Body Paragraph 3: Personal definition created from experience. Conclusion Keep the conclusion simple. The main goal here is to summarize the main points of your argument. Rephrase your thesis as well as the main parts of the definition and sum up everything you said in the body of the essay. The last thing that should be mentioned in your definition paper outline is how this term has impacted you. Usually, before even writing the essay, there is a reason a specific word is picked, and part of the reason has to do with personal experience. Post-writing Tip Mention how the definition you were talking about affected you. If the term you define plays a specific part in your life and experiences, your final concluding comments are a great place to mention the role it plays concisely. Think about the purpose of the argument to form the thesis. Writing a Definition Essay: Striking Tips Before choosing the topic, explore all topic ideas meticulously and make a decision wisely; Make paragraphs of your definition paper logically united with the help of transition words, phrases; Choose words with multiple meanings or multi-dimensional words. It is great if a word has a lot of synonyms — you have a chance to shine a light; The dynamic definition is also a good idea. They are more complex than static ones. For example, a definition essay on love will give you a great deal of room for creativity; Provide examples from a real life; Proofread, edit your work, avoid errors in grammar; Make an in-depth research: historical research gives you the understanding of the origin and meaning of the topic. In order to learn how to write a definition essay, you should know the structure of an effective paper. Extended definition essay outline Just what does that mean? Online Technical Writing--Extended Definition An important writing writing you'll need, particularly if you are process for nonspecialists, is definition--or more specifically, extended definition. An extended definition is a one or more paragraphs that components to explain a complex term. Some terms may be so important in essay report, there may definition so much confusion about them, or they may be so difficult to extended that an extended discussion how to write an undergraduate research proposal essay for the success of your rubric. Note: See the complete outline of an extended definition. Extended definition essay outline Definition Essay Writing Guide Jul 30, An essay assignment is extended popular in many educational establishments. There is a range of essay types, definition each of them can definition you in developing your skills and widening your knowledge. Gay marriage should be banned essay writer, when your professor assigns you to write an essay, they expect from you to show some analytical or critical thinking skills, ability to structure your paper logically, and your interest as well as competence in outline aspects of life. Among the different types of essay, there is a definition essay that could seem to be one of the essay simple assignments. Like any other essay, a definition one has its peculiarities as well as essay requirements that are to be met to succeed in the 10 best resume writing service Dubai. Extended to write a definition essay that will outline guarantee you the highest grade? What is a definition essay? Write the conclusion. ABCEssays is a creativity of professional writers ready to help you with any kind of essay. Step 3: Disclose term in the introduction Tell your reader what the term stands for in the introduction. Results, Effects, and Uses: Describe the after effect and uses of the subject. • Mit additional information essay writing; • Life is like a stage essay writing; • Buy a critical thinking paper; • Ap biology gene regulation essay writer; Approaching a Definition Essay See our full collection of samples. Please enter your registered e-mail address:. As people have used language for many centuries, there is a big chance that you will find some information about the history of the term. Extended definition essay outline It is time to become a word artist! When you write reports, you may often discover that you need to explain certain basics before you can discuss the main subject matter. Honesty as a basis of good relationships. How To Write a Definition Essay in 5 Steps Now you've already learned what is a definition essay, time to discover how to write a definition essay, which steps you should follow. How to describe Integrity? General Structure Always pick up broad terms. Revise your first draft. Figure G Simple definition essay topics When you are looking for a definition essay topic, you may notice that some interesting titles, topics draw you in. Simply presenting the example is not enough. One word can be perceived differently in some countries. • Essay samples for college entrance exam; • Should we go to college essay; • Free essays examples writing instructional objectives; • Dieppe raid essay writing; • Ways to write a compare and contrast essay; • Custom content editing services gb; • Essay writing on guru purnima sms; • Leews legal essay exam writing system; • Do advertisements contribute to unhappiness and dissatisfaction sat essay; • Improve essay writing technique; Writing Formal Sentence Definitions How to Write summary Definition Essay Without Any Help Both at school and college you can be assigned a paper that is aimed to define some term. It seems that when you have multiple choices, the writing process is simpler since you are free to decide which term is more familiar and interesting thesis defence or defense you. In the body paragraph of writing definition paper you are supposed to present the history of the term, examples, and your own definition which would express your personal point of view on this term on the basis of your experience. You can paper examples that will illustratively display your point of view. What Is a Definition Essay? Also the essay should consider what experiences and research the author best essay writing app developed. Extended definition essay outline For example, in a report on new treatments for sickle cell anemia, you'd need a section defining the disease. How to write a definition essay that will fully guarantee you the highest grade? You can start with stating some interesting information from the history of this term or usage. If you have quickly looked through the assignment, there is a possibility that you have missed some important points or misunderstood something. Do you write questionnaires? Look through the text and check the structure. Did you like this article? Examine whether you have developed definitions that are well reasoned, researched, and supported with examples. As people have used language for many centuries, there is a big chance that you will find some information about the history of the term. Step 4. How to describe Integrity? In a report on the benefits of drip irrigation, you'd need to write an extended definition of drip irrigation, explaining how it works and what equipment is used. The main goal here is to summarize the main points of your argument. Of course, you can choose any other topic. Definition Essay Outline What is sometimes required for writing an essay, or in any case can facilitate the structuring of your paper is a definition essay outline. For example, love can appear as several different parts of speech; it can be a noun, verb, or adjective. Extended Definition Essay Topics Outline Definition Essay: Inside the Creative Mind Yet abstract terms like love, pain, intelligence carry extended extended and connotations to different individuals. The Definition Essay provides the student with an opportunity to share definition personal, extended definition of something essay which, again, can be a college essay samples overcoming obstacles curriculum, a word or extended concept. ABCEssays is a creativity of professional writers ready to help you with any kind of essay. • Microeconomic essay topics college; • College admissions essays a genre of masculinity and violence; • Write descriptive analysis essay; • Computer ka mahatva essay writing; extended definition essay example paper research paper about technologies Any of these essays can also be used as a definition essay template if you wish to have the same structure and format for your essay. If your introduction processed appropriately, it would be much easier for you to keep your writing logical. We wish you strength and inspiration! Simply put, an outline is a brief review of your work, which highlights its main points. Extended definition essay outline Also it may be called an extended definition essay. This is where your thesis statement is introduced in your own words, as stated above. Somewhere in your extended definition, you'll need to explain them as well, possibly by using short definitions explained later in this section. • Share Feedback Grozragore Definition Essay Outline What is sometimes required for writing an essay, or in any case can facilitate the structuring of your paper is a definition essay outline. The key to writing a good extended definition is to choose the sources of definition to help readers understand the term being defined. They are more complex than static ones. If you still doubt whether you can deal with such an assignment as a definition essay alone, we are happy to inform you that there is an excellent solution! Get Custom-Made Essay Extended Definition Essay Topics Extended definition essay topics allow the writer to completely define and explain the meaning of a subject matter in their own words. Develop a Definition Essay Outline Proofread. Kagaktilar Practical Tips On Composing An Extended Definition Essay Outline If you want practical tips on composing an extended definition essay outline then follow the steps below: The first thing you need is your topic. People use the term hero as a compliment in different contexts. Classification: What classes does the issue belong to? Zoloshura What are the defining attributes of Royalty? Simply presenting the example is not enough. Explain what is a simplified life. Here are several examples: Formal sentence definitions: their components are the term being defined, the class it belongs to, and its distinguishing characteristics. Mooguktilar Look over some ideas of definition essay introduction examples around the internet to get inspired. As soon as you finish your second draft, check the words, sentences, correctness of spelling, grammar, punctuation, and mechanics. Your thesis statement should not only point out the term you are going to define, but also the idea that you are going to prove. For example, it may be an anecdote or quotation. Step 4: Reveal the term in the body paragraph This is the main part of your definition paper. Usually, before even writing the essay, there is a reason a specific word is picked, and part of the reason has to do with personal experience. Kagazshura Another strategy: opposition It is not posited that an extended definition essay should deal only with different meanings of one term. This exercise will be a foundation for your further writing and will show what you already know about the term from personal and academic aspects. Employ impartial language and do not become too emotional. Some words have quite concrete meanings: table, paper, car, etc. Tule Definition of term based on personal experience with examples 5. Looking for help with your essay or term paper? Mezile It is important to note the fact that this is an essay, which means you can not pick a simple term that can be described in a few words. A formal sentence definition used in an extended definition Choosing the Sources of Definition When you write an extended definition, you literally grab at any of the writing resources or tools that will help you explain the term to your readers. Another strategy: opposition It is not posited that an extended definition essay should deal only with different meanings of one term. Tatilar As soon as you will feel that your essay is totally complete and you have no doubts about its clarity, submit it to your tutor. Look through the text and check the structure. Honesty as a basis of good relationships. Consider answering such questions as who created the word Did you know Shakespeare coined the words lonely and majestic? One word can be perceived differently in some countries. Remember me construction superintendent resume objective examples password? Nile Write several sentences that will sum up your writing and briefly restate the main points of your essay. Write the introduction. All you need is quality content written within the instructions. Step 5: Provide vivid examples Find and provide several bright and sound examples which can interpret, show the definition. Make sure that your text will be clear to readers, and sentences are complete and readable. The goal here is to pick the best definition essay topic that as a student you feel comfortable explaining and portraying. Fenritilar Extended Definition Essay: Inside the Creative Mind Yet abstract terms like love, pain, intelligence carry extended extended and connotations to different individuals. Conduct some historical research. A complex word with creativity meaning is preferable. LEAVE A COMMENT Rip off the mask, tear down the walls. Show the world my beautiful, vulnerable self! Posts tagged ‘fears’ Upgrading My Marketing Mindset Marketing Makes Me Ill I admit it. I’m a hater, at least when it comes to marketing for myself. The idea of trying to sell my own services is the stuff of nightmares. But as a solopreneur, I’m learning you simply have to suck it up and find a way to do it. That’s not to say we have to sound like those annoying car salesmen who used to frequent the limited TV channels when I was a kid. We just have to learn to put ourselves out there and give people an opportunity to ask us about the services or products we offer. As a writer, the most common of these is pitching. Unfortunately, my brain has twisted that word into a rather unappetizing pretzel as palatable as the afore-mentioned care salesman. Though I can’t get completely away from pitching, I have been able to soften the word so it doesn’t stick in my craw. Proposing vs. Pitching Lately, I’ve had the opportunity to write proposals and that’s where I start to hit my stride. I spent far too many hours working with a proposal team in my last job, and have taken much of what I learned in those hours to heart. There are plenty of do’s and even more don’ts about proposal writing. My favorite of all of them is the “so what?” approach to evaluating a proposal. The “so what?” approach essentially looks at all you’re offering the client or customer from their standpoint. If you can’t show the benefits of something you’re offering, or demonstrate how it will make their life easier, they’ll likely read it and wonder why you even included it. Many things fall into this category including lengthy descriptions of your assets and attributes. Believe me, a potential client doesn’t give a horse’s patoot how many years you’ve been in business or how many awards you’ve won. They want to know what you can do for them. They want to feel comfortable handing over not only their hard-earned cash, but tasks they want done on time, within budget, and above all, done right. Testimonials from previous customers are great, but in this day and age, they’ve probably already looked at your website and seen the testimonials. The Key is in the Customization Remember all those resumes and cover letters you’ve sent out over the years? And remember when you finally learned that sending generic ones would most likely get you passed over no matter how good your qualifications were? A decent proposal (or pitch or query or whatever word you choose to use) is much the same. Sure, I use a template. I suspect most freelancers do. We don’t have time to reinvent the wheel every time we propose a job. But you have to take the time to learn something about the client and their company. Sometimes, they’re not very forthcoming about their business, so you have to read between the lines. Sometimes, you’ll get a little bit of information from your direct questions, but the real gold comes from doing a little research, and from conversations and emails. In short, from less formal communications. Lately, I’ve found that asking an innocent question in the context of the conversation will yield gems you weren’t expecting, but which will give you insight into what the client is really trying to accomplish with the service or product you offer. (From here on out, I’m just going to talk about services since that’s what I do. Product marketing is an entirely different ballgame anyway). Understanding the Do’s and Don’ts In the last couple of months I’ve learned a few useful things about potential clients and proposals which are making me look at the whole process from a much less revolted point of view. • Rarely is the service you’re proposing your contact’s priority. They’ve been given the task of coordinating with potential candidates, but they have a lot of other responsibilities which are more important than what you’re proposing. • Patience is rewarded. Because of the first point, you may experience long lags between your responses and theirs. Get used to it. Check in once a week or so, but don’t be a pest. You’ll often learn where things stand priority-wise if you ask for a little time to respond to their latest request. • Always believe that no news is good news once you’re communicating with the potential client. I’ve sent out my share of queries which never even get opened, so I know what it feels like to send my best efforts into a black hole—every freelancer and solopreneur I know has files full of rejections by silence. So when you do get someone to respond, take it as a yes until such time as, god forbid, they tell you no. • (This one should probably have gone first, but this list is not in order of importance) Spend time on the company website getting to know who you want to be working with. This is where strong investigative skills come in handy. But you can certainly take note of the obvious things like pages on their site (for me, one of the first things I look for is evidence of a blog. If it exists, I look at how active it is, and when they last posted). From there, look for the services or products they offer, the people they serve, and the problems they solve. • Leave room in your proposal for services above and beyond what you’re proposing. Make sure you have a clause which covers you for “scope creep”. I see many freelance service providers complaining about clients who take advantage of them. Putting the “scope creep” clause in the proposal and contract tells the client exactly what they’re signing up for and when additional work will require a new or modified contract. • Whether you’re dealing with the company President or someone 20 steps down the ladder, respect and consideration go a long way. Those gate keepers have the power to lock you out. Never lose sight of that. I’m reminded of the years I worked in Corporate America. Until computers rendered a lot of secretarial tasks obsolete, every director and upper-level manager had a secretary or admin and woe be to the person who got on that admin’s bad side. When all else fails, put yourself in their shoes. How would you want to be treated by someone whether you’re just recommending them or you’re the decision-maker? Learning to Wait, Revise, and Rethink Patience has never been my strong suit. I’ll be the first to admit it. But I’m gaining a newfound level of respect for a friend who is a commercial realtor. Many times, I’ve seen her comment on the latest iteration of a contract, often in double digits. As I propose and re-propose myself, I’m learning it’s just part of the process. People re-evaluate. When they see something in black and white, it makes them think about what they truly want. They’re not trying to be difficult. They simply want to be clear on how the problem they’re facing should be solved. I’m also gaining an appreciation for marketing, and despite the many voices telling me it’s just a numbers game and I have to send out a million pitches, I believe we have to find what works for us. When I hear someone say they get sick to their stomach whenever they pitch, yet they spend a significant part of their day doing it, I have to ask Why would you want to do something that feels like a bad case of morning sickness? Be creative. Find something that works without the physical discomfort. I’m one who gets physically ill just thinking about selling myself. But I’m also not willing to give up on myself, so I’m taking my own advice and looking for a better way. Part of that is talking to people who more about putting yourself out there to gain recognition and trust rather than playing the numbers game. I spent enough of my life playing with numbers. I’m learning I prefer words, hands down. Gratitude Always Works My gratitudes tonight are: 1. I’m grateful there is more than one way to reach my goals. 2. I’m grateful for the examples I see before me. Some, I’ll incorporate into my strategy, others I won’t. It doesn’t mean any of them are bad. Some are just a better fit for me. 3. I’m grateful for dance nights, even when the DJ plays the same old boring dances instead of the many new ones we’ve learned. I get my exercise, my social engagement, and my hugs. 4. I’m grateful for the upgrades I’ve made in my house in the last week or two. They’re neither expensive nor earth shaking. But they make me feel better, clearer, and more confident of my ability to attract the things I dream of. 5. I’m grateful for abundance; love, joy, manifestations, inspiration, motivation, companionship, friendship, peace, harmony, philanthropy, and prosperity. Love and Light The Facebook Live associated with this post can be found here. I invite you to visit my Facebook pages, Sheri Levenstein-Conaway Author and HLWT Accounting. Please also drop by my website, www.shericonaway.com and check out my Hire Me Page. I’ve created these pages as a means of positive affirmation and would be very grateful if you’d “like” them or leave a comment! Thank you! Are You Committed or Merely Interested? A Time for Reassessing. Am I Truly Committed? The last 3 1/2 years have been quite a ride for me. I’ve dabbled in a lot of things, written a few drafts of novels, and several hundred blog posts, but I’ve yet to figure out quite what I want to be when I grow up. No, I take that back. I’ve figured out what I want to be, I just haven’t fully committed to what’s required to get there. We go through life trying many different things. Some simply interest us, but every so often, one comes along that grabs us by the throat and we have no choice but to commit to it, heart, soul, mind, and body. I thought the writing was it for me, but with each setback, each rejection, each failure to launch, I become less certain. Step 1: Having a Plan of Action I know I need a plan, and have come up with several, but have yet to truly stick to anything long-term. Even the plan I typed up and put on my wall hasn’t really come to fruition. I’m not spending 2-3 hours a day writing. I’m not spending 2-3 hours a day reading motivational literature. And worst of all, I’m not spending 2-3 hours a day working on queries or researching companies to send queries to. Sure, I’m writing a blog post here and there. Yes, I’m doing at least 2 Facebook Lives a week. Yes, I’m still going to the gym most weeks, though the last couple have been challenging, to say the least. Having a plan is certainly a good place to start. But if you don’t follow the plan, it’s just words on paper, and may as well be in Swahili for all the meaning they bring into our lives. Yet, if you’re truly committed to something, won’t you stick to any plan at all just to be heading in the right direction? Acknowledging Our Fears and Frustrations I question myself every day. I ask what I’m afraid of. At first, it was fear of not following through. But if I’m completely honest with myself, I’ve followed through on writing commitments for others again and again. It’s myself I have trouble committing to. But at least that eliminates the excuse that I don’t send out queries because I’m afraid I won’t be able to fulfill the obligation. I’ve added a number of chapters to Forgotten Victims though I’m far from done. I did pay close attention to a book I’m currently reading in which the writer said that if your purpose in writing is to help other people, you might as wall hang it up. If your purpose is to help yourself, you’re more likely to succeed, at least by finishing what you set out to write. If it helps someone else, great. But the primary goal has to be self-healing. I needed to hear that as I’d gotten off track in writing my memoir. I’d started posting chapters of Sasha’s Journey to a site of writers who critique each others’ work. But I wasn’t really committed there either. I read and commented on a couple of pieces, then slacked off. And now that they’re changing the rules and want us to post on our own blog sites and link to theirs, I’m not going to waste my time. If I wanted to post it on my site, I’d have already done so. So the frustration, the backpedaling and the discouragement continues. And again I ask myself “Am I committed or merely interested?” Giving My Life Blood for Someone Else’s Dreams The reality is, I’ve just about used up the time I had to dabble here, and fritter there. I need to get focused on what I truly want to do, what I’m truly passionate about; and throw myself into it wholeheartedly. Because if I don’t, I deserve no more than to work the rest of my life to pad someone else’s retirement fund. At least there, I know what I do not want. It’s funny how figuring out what you don’t want in life is pretty easy. You just have to take all the things you’ve found uncomfortable or annoying all your life, put them in a pile and light a match. Those are your “don’t wants”. Being Clear on What You Do Want Figuring out what you truly do want is another story entirely. I want to write, yet I go for days without writing a word. I want to be independent. But I go for days without doing a thing to move myself forward. I want to do good for others, but here I sit, devoting time and energy to just worry about myself. That’s energy I won’t get back and it benefits no one. I want to be an inspirational speaker, but until recently, was doing little or nothing towards that end. At least now I’ve signed up to volunteer at a summit for speakers in October. I’ve also been reading books like Talk Like Ted to help me understand what makes a truly great speaker. I’ve been incorporating what I’m learning into both my Facebook Lives and my writing. I’m also watching how other people speak, paying close attention to what does and does not work. As a result, my more recent Facebook Lives have been under 15 minutes. (18 minutes is optimum for a TED talk. I figure a live broadcast should be shorter). The Best Lessons Come From Watching Others While watching one live broadcast recently, I realized how important it is to be prepared before you go live, and to have all of the tools you’ll need for the broadcast within reach. Nothing screams “unprofessional” to your viewers like staring at an empty wall while you disappear to find something you needed for your talk. With all of the setbacks, with all of the failures, I must still be committed in some fashion, because here I sit, writing another post which will support one of my Facebook Live broadcasts. I created an editorial calendar today which will be the home to everything I need to write, both for publication on my own sites and for others. Focus on What Is Working Instead of What’s Not I’m getting back into the habit of writing late at night, even if it’s only 500 words. If I put it in perspective, 500 words a day will give me the 30,000 words or so I still need for my memoir in about 2 months. Considering how long it’s been a work-in-progress, 60 days is nothing! Like the carpet that still needs to be pulled up in my bedroom, like the garage that needs to be shoveled out (though I have made some progress in recent weeks), like the yard that needs to be weed whacked—everything begins with a single step. A few weeks ago, I pulled up another section of the carpet. I can do another section now. I just need to get up and do it. I’ve been consistent with my Facebook Lives. Now I need to be more consistent with the coordinating blog post. I’ve put the deadlines for client work on my new calendar. I know I’ll meet or beat those deadlines. Can I say the same of deadlines I set for my own work? Someone recently mentioned they’d committed to 3 blog posts a week. There’s not a single reason why I can’t do the same, even if I write them all in one day and schedule them to post throughout the week. I’ve proven time and again that knocking out a 1200-1500 word post is pretty much child’s play for me. The Big “Why” Everyone talks about the big “why”. Mine is becoming so clear that I inadvertently picked out a paint color to go with the life I want to live. It was brought home to me yesterday when my daughter and I took a couple of wrong turns and ended up driving along the beach. The water was the exact color I’d chosen for my dining room wall! Thanks to my daughter, it is now a beautiful dark teal, the same color as the ocean yesterday. The rest of the walls are in process of becoming a lighter version of the same color. Every time I walk out into my living room, despite the furniture sitting in the middle of the floor and the fine layer of dust coating everything, I feel both energized and soothed just by looking at that beautiful ocean-colored wall. I also broke down and bought the resin Adirondack chairs I’d fallen in love with a week or so ago. They, too fit the life and setting I envision for myself. My big “why” is alive and well. It’s now a matter of committing everything I have, everything I am to making it happen. Writing has always been my best therapist, and tonight is no different. I began this piece feeling like an utter failure with no real possibility of achieving my dreams. But as I think of the changes I’ve made even in the last couple of weeks, I realize I’m more committed than I give myself credit for. I’m simply moving towards my goals in my usual convoluted fashion. It may seem like I’m aimless and uncommitted, but somehow, in my own weird way, I’m getting where I’m going. Remembering Always to be Grateful My gratitudes tonight are: 1. I’m grateful for the supportive people who continue to find their way into my life. My blessings grow daily. 2. I am grateful for my personal therapist who has a way of turning my frown into a smile no matter how bad I think things are looking. 3. I am grateful for the opportunities that are literally dropping into my lap lately. 4. I am grateful for learning how to ask for help, and how to put myself into places where I can find exactly what I need. 5. I am grateful for abundance; resources, friendship, courage, companionship, progress, improvements, signs, commitment, love, joy, peace, harmony, health, philanthropy, and prosperity. Love and Light You can find the Facebook Live which inspired this post here. I invite you to visit my Facebook pages, Sheri Levenstein-Conaway Author and HLWT Accounting. Please also drop by my website, www.shericonaway.com and check out my Hire Me Page. I’ve created these pages as a means of positive affirmation and would be very grateful if you’d “like” them or leave a comment! Thank you! September 18, 2015 Gratitude: When What We Need is to be Needed The Universe Always Comes Through I’m a firm believer in the Laws of Attraction. The Universe will always bring exactly what is needed, though quite often it isn’t exactly how you might have envisioned it. Whether we realize it or not, we are putting our wants, desires, hopes and dreams out there every day and though we might not see all of the big ones manifesting, if we pay attention, we will see a multitude of small ones. I couldn’t tell you which of the many requests I’d put out there was answered yesterday, nor how I’d asked. What I do know was that when yesterday’s writing session was interrupted by a friend in need, it wasn’t long before I realized that at some point, I’d expressed a need to be needed. I feel both honored and grateful that my schedule as a writer and freelancer allows me to be there in those rare but beautiful moments when a friend reaches out, seeking what small comfort I might offer, but I know I’m the one who’s truly blessed because I’m being allowed to be needed. So many of my friends and family members are much like me and rarely ask for help so when one of them does ask, it’s something really important and requires attention at the moment of the asking, otherwise, the asker will just pull back into themselves and try to muddle through alone. As I worked on this post, Pandora chose to play this song and as it was so appropriate to what I’m writing, I am sharing it with you.James Taylor – You’ve Got a Friend Don’t think it gives me joy when someone I care about is suffering. Of course, I’d rather see them not have to go through a painful experience. But if it is necessary for their growth to struggle a bit and they can reach out to me to help them weather the storm, I can only feel grateful that time and circumstance aligned so that I could. Sure, we all have our own share of struggles and those struggles not only make us stronger but give us new tools with which to face future obstacles. Just as we crawl before we walk, we face bigger and bigger obstacles in our lives so we can receive or even create the tools we’ll need to make the next challenge that much easier. Imagine trying to fight a forest fire with a garden hose because you hadn’t gone through the experiences necessary to acquire a fire hose. Life is like that too. Anything we do gets better and stronger with practice. I look back on how I wrote when I was a kid, then as a teenager and, more recently, when I started this blog 6 1/2 years ago. So much has changed, not only for me personally, but for the way I put words together. The only way I got here was to put hundreds of thousands of words together in an infinite number of ways until I learned what worked and what didn’t. That’s not to say that I’ve got it all down, but the practice I’ve already had makes what I do going forward maybe just a little less like drek and more like literature. It has certainly encouraged me to keep trying, even when I’m taking my first novel apart and reassembling it, losing some of the old pieces and inserting quite a few new ones. Maybe I’m not quite achieving the aggressive goals I set for myself, but the four chapters my friend Candy challenged me to complete has now grown to 11 completed and a twelfth in progress. (what that means is, I figured out which of the original fifty-odd chapters I wanted to go next and cut and pasted it under the heading “chapter 12”). Admittedly, the initial challenge to get my butt back in gear came at the end of July, and that, in fact, is when I got the first four chapters done, so seven more in a month and a half isn’t exactly breaking any records, but forward progress is forward progress, and now I’m setting my own goals even if I have to revise them because I was too aggressive for right now. That doesn’t mean that four chapters a week won’t be realistic the further along I get. If I get frustrated, I look at page count instead and see that I’m almost 80 pages into a 342 page book right now. Again, not bad as long as I don’t dwell too long on how long it’s taken me to get this far. What I’ve gained over the last few weeks may not be earth-shaking, volume-wise. But I’ve gained consistency in sitting down to work on the project. The time I spend in a sitting has grown from about an hour to well over 2 lately (when I’m not interrupted, of course). Better still, I no longer have to argue with myself about sitting down to write, be it a blog post for me or a client or editing Sasha’s Journey. I just allocate time every day to write something, anything, even if it’s pure garbage. (I actually revised Chapter 11 3 times over the last few days until I got it somewhere close to acceptable so I could move on). In fact, I’ve been getting so focused lately that I often forget to turn on the background music. That may or may not be a good thing as I tend to be significantly more self-critical when my internal editor is not otherwise occupied. Once again, I’ve wandered off the track a bit, but interwoven between all of the words I’ve put on the screen tonight is a single theme: Gratitude. The Universe really does hear our requests. It may not bring them to us in the form we imagined, but it brings us what suits us best and helps move us forward. My gratitudes tonight are: 1. I am grateful for the opportunity to give of myself. 2. I am grateful for the friends who teach me by their own beautiful ways to be more giving, kind and compassionate. 3. I am grateful for the progress I’m making and though it will never be easy, I’m no longer having to fight with myself to move forward. 4. I am grateful to one, special friend who flat out told me to stop allowing my fears to get in my way. Even if I can’t identify them, I know they’re there and anxious to get between me and my dreams. Only I can thwart them. 5. I am grateful for abundance: love, friendship, progress, tenacity, determination, joy, health, happiness, harmony, peace, philanthropy and prosperity. Blessed Be I invite you to visit my Facebook pages at https://www.facebook.com/SheriLevensteinConawayAuthor?ref=aymt_homepage_panel and https://www.facebook.com/HLWTAccounting . Please also drop by my website, http://www.shericonaway.com and check out my Hire Me Page. I’ve created these pages as a means of positive affirmation and would be very grateful if you’d “like” them or leave a comment! Thank you! January 16, 2015 Keeping it real: Leaps of Faith come in all sizes and colors. Find yours! When you buy a new car, you suddenly notice every one like yours on the road. Taking a leap of faith is no different. I find that my eyes have been opened to the miracles others perform every day. Some may think it’s nothing, but the rest of us know they’re pretty amazing. Take, for example, a friend of mine who is about to move herself, bag and baggage, four states away. She just decided it was what she needed to do for herself, and put the plan in action, allowing herself the chance to let things fall into place just because she believed in herself. Now, as she’s ready to leave town, she has 3 jobs, including the one in her current state, and she’ll be able to work them all from her home office, with regular trips to and fro, allowing her to stay in touch with friends she’s made all over the place. How terrific is that? And none of it would have happened had she not just believed. Or take another friend who, despite a cranky knee, runs marathons what seems like every weekend, AND she dances AND keeps up a very active life besides. She truly is a rock star! Then there’s my daughter who encouraged her husband to follow his own dream. He decided to take whatever route he needed to in order to get into the medical program with the Navy. At the moment, he’s a chef, but he goes above and beyond whatever he does. He’s already ranked up and is getting very positive feedback from some of the officers. But it meant that my daughter had to move far away from home for the first time in her life. What did she do? She went back to school…and she took up karate…and she’s getting involved with the family support group for her husband’s ship…and who knows what she’ll take up next. Best of all, she’s following her own dream as the colleges where she moved have exactly the programs she wants and needs! In my quest to write and publish, I’m stepping further out of my own comfort zone and looking for a writer’s group which will suit me. I love reading everyone’s stories. Even letting someone read our scribbles can be a huge leap of faith, much less putting in the time and effort to actually publish something so it’s available to the masses. How better to perpetuate leaps of faith than by surrounding yourself with other leapers? As I follow my own personal reinvention, sometimes leaping, but more often crawling, I find myself inspired by people who have made drastic changes in their lives, and I want to surround myself with people who are willing to get past their fears and just follow their hearts. I was going to say that they squelched their fears, but at least those like me don’t do that. We simply recognize the fear but don’t let it paralyze us. If nothing else, you don’t write things publicly or toss your literary baby out into the world if you give in to your fears. You slap a lid on them, glue it down as best you can, move forward while they’re being quiet, and stop when necessary to slap them down again. Otherwise, you’d be a quivering mass of protoplasm curled into the fetal position in some dark corner, never to be heard from again. Writers must write. It’s as important to us as breathing; maybe more so. That doesn’t mean we have to share, but authors need to share, and share, and share. Although, after I read the rules for the writer’s group I’ll be visiting tomorrow, I don’t think I’ll be sharing for awhile yet. They only want edited work, and frankly, mine has a long way to go. But there will come a point when I’ll know that it’s do or die, and one of my babies will be launched from the womb to bear the scrutiny of a world I hope will, at least initially, be kind in its criticisms. There will be plenty of time after it’s been fine-tuned for the world to take pot shots. Hopefully, by the time that happens, both my writing and I will have thickened our skins so most of what is chucked our way will roll off of us like water off an oil slick. All I can say is: “Keep on Leapin’!” My biggest desire right now is to keep meeting people who took their own leap, and who will share their stories with me so I can add them to the growing list of people who’ve changed their lives for the better. If you would like to share your own leap of faith, I invite you to be a guest blogger. You can message me on Facebook through the page I’ll reference below, or leave a message here on the blog. I look forward to being able to share your story! My gratitudes tonight are: 1. I am grateful for small successes in the Tarot Spells I’ve cast. 2. I am grateful for people who inspire me to continue to push my envelope. 3. I am grateful for quiet evenings alone with my cats to fiddle and play, but also to be inspired and to write. 4. I am grateful for the variety which has come into my life lately. Maybe soon I’ll be able to keep track of what day it is again! 5. I am grateful for abundance: leaps of faith, energy, inspiration, motivation, consistency, love, joy, happiness, friendship, lessons, health, prosperity and the constant companionship of my cats. Blessed Be And now for some shameless self-promotion: I’d love it if you’d visit my Facebook page at https://www.facebook.com/SheriLevensteinConawayAuthor?ref=aymt_homepage_panel. I’ve created this page as a means of positive affirmation and would be very grateful if you’d “like” it or leave a comment! Thank you! Tag Cloud %d bloggers like this:	# Extended Definition Essay Outline ## Introduction - Clearly state the term you will define. - Provide brief context or background. - Present a concise thesis that conveys your unique perspective. ## Body Paragraphs 1. History and Origin - Explore the word’s origin and evolution. - Include historical examples or anecdotes (e.g., Shakespeare coined “majestic”). 2. Denotative Definition - Cite the formal, dictionary definition. - Break down key components of that definition. 3. Connotative Definition - Share your personal understanding or interpretation. - Illustrate with examples from your own experience. 4. Additional Modes of Definition (choose as needed) - Description: Sensory details or vivid imagery - Process: Step-by-step analysis of how something works - Classification: Grouping the term within broader categories - Cause and Effect: How the term affects or is affected by other factors - Comparison and Contrast: How it differs from or resembles related terms ## Conclusion - Restate your thesis in new words. - Summarize the main points from each body paragraph. - Reflect briefly on how defining this term has personal significance or broader implications. --- # Tips for Writing a Definition Essay - Select a Multi-Dimensional Term: Choose words with several meanings or rich histories (e.g., “freedom,” “heritage,” “innovation”). - Research Thoroughly: Trace the term’s etymology and usage over time. - Use Active Voice: Keep sentences clear and direct; minimize passive constructions. - Limit Personal Pronouns: Avoid excessive “I” or “we” unless illustrating a personal example. - Organize Logically: Employ transition words (however, moreover, consequently) to connect ideas. - Provide Concrete Examples: Ground abstract ideas in real-world scenarios. - Consider Dynamic Definitions: Show how meanings change in different contexts or eras. - Proofread and Revise: Check for grammar, clarity, and cohesion before submission. Use this outline and these tips to develop a well-structured, insightful extended definition essay. --- # Rip off the mask, tear down the walls. Show the world my beautiful, vulnerable self! ## Posts tagged ‘fears’ --- ### Upgrading My Marketing Mindset Marketing Makes Me Ill I admit it. I’m a hater, at least when it comes to marketing for myself. The idea of trying to sell my own services is the stuff of nightmares. But as a solopreneur, I’m learning you simply have to suck it up and find a way to do it. That’s not to say we have to sound like those annoying car salesmen who used to frequent the limited TV channels when I was a kid. We just have to learn to put ourselves out there and give people an opportunity to ask us about the services or products we offer. As a writer, the most common of these is pitching. Unfortunately, my brain has twisted that word into a rather unappetizing pretzel as palatable as the afore-mentioned car salesman. Though I can’t get completely away from pitching, I have been able to soften the word so it doesn’t stick in my craw. #### Proposing vs. Pitching Lately, I’ve had the opportunity to write proposals and that’s where I start to hit my stride. I spent far too many hours working with a proposal team in my last job, and have taken much of what I learned in those hours to heart. There are plenty of do’s and even more don’ts about proposal writing. My favorite of all of them is the “so what?” approach to evaluating a proposal. The “so what?” approach essentially looks at all you’re offering the client or customer from their standpoint. If you can’t show the benefits of something you’re offering, or demonstrate how it will make their life easier, they’ll likely read it and wonder why you even included it. Many things fall into this category including lengthy descriptions of your assets and attributes. Believe me, a potential client doesn’t give a horse’s patoot how many years you’ve been in business or how many awards you’ve won. They want to know what you can do for them. They want to feel comfortable handing over not only their hard-earned cash, but tasks they want done on time, within budget, and above all, done right. Testimonials from previous customers are great, but in this day and age, they’ve probably already looked at your website and seen the testimonials. #### The Key is in the Customization Remember all those resumes and cover letters you’ve sent out over the years? And remember when you finally learned that sending generic ones would most likely get you passed over no matter how good your qualifications were? A decent proposal (or pitch or query or whatever word you choose to use) is much the same. Sure, I use a template. I suspect most freelancers do. We don’t have time to reinvent the wheel every time we propose a job. But you have to take the time to learn something about the client and their company. Sometimes, they’re not very forthcoming about their business, so you have to read between the lines. Sometimes, you’ll get a little bit of information from your direct questions, but the real gold comes from doing a little research, and from conversations and emails. In short, from less formal communications. Lately, I’ve found that asking an innocent question in the context of the conversation will yield gems you weren’t expecting, but which will give you insight into what the client is really trying to accomplish with the service or product you offer. (From here on out, I’m just going to talk about services since that’s what I do. Product marketing is an entirely different ballgame anyway). #### Understanding the Do’s and Don’ts In the last couple of months I’ve learned a few useful things about potential clients and proposals which are making me look at the whole process from a much less revolted point of view. - Rarely is the service you’re proposing your contact’s priority. They’ve been given the task of coordinating with potential candidates, but they have a lot of other responsibilities which are more important than what you’re proposing. - Patience is rewarded. Because of the first point, you may experience long lags between your responses and theirs. Get used to it. Check in once a week or so, but don’t be a pest. You’ll often learn where things stand priority-wise if you ask for a little time to respond to their latest request. - Always believe that no news is good news once you’re communicating with the potential client. I’ve sent out my share of queries which never even get opened, so I know what it feels like to send my best efforts into a black hole—every freelancer and solopreneur I know has files full of rejections by silence. So when you do get someone to respond, take it as a yes until such time as, god forbid, they tell you no. - Spend time on the company website getting to know who you want to be working with. This is where strong investigative skills come in handy. But you can certainly take note of the obvious things like pages on their site (for me, one of the first things I look for is evidence of a blog. If it exists, I look at how active it is, and when they last posted). From there, look for the services or products they offer, the people they serve, and the problems they solve. - Leave room in your proposal for services above and beyond what you’re proposing. Make sure you have a clause which covers you for “scope creep”. I see many freelance service providers complaining about clients who take advantage of them. Putting the “scope creep” clause in the proposal and contract tells the client exactly what they’re signing up for and when additional work will require a new or modified contract. - Whether you’re dealing with the company President or someone 20 steps down the ladder, respect and consideration go a long way. Those gatekeepers have the power to lock you out. Never lose sight of that. I’m reminded of the years I worked in Corporate America. Until computers rendered a lot of secretarial tasks obsolete, every director and upper-level manager had a secretary or admin and woe be to the person who got on that admin’s bad side. When all else fails, put yourself in their shoes. How would you want to be treated by someone whether you’re just recommending them or you’re the decision-maker? #### Learning to Wait, Revise, and Rethink Patience has never been my strong suit. I’ll be the first to admit it. But I’m gaining a newfound level of respect for a friend who is a commercial realtor. Many times, I’ve seen her comment on the latest iteration of a contract, often in double digits. As I propose and re-propose myself, I’m learning it’s just part of the process. People re-evaluate. When they see something in black and white, it makes them think about what they truly want. They’re not trying to be difficult. They simply want to be clear on how the problem they’re facing should be solved. I’m also gaining an appreciation for marketing, and despite the many voices telling me it’s just a numbers game and I have to send out a million pitches, I believe we have to find what works for us. When I hear someone say they get sick to their stomach whenever they pitch, yet they spend a significant part of their day doing it, I have to ask Why would you want to do something that feels like a bad case of morning sickness? Be creative. Find something that works without the physical discomfort. I’m one who gets physically ill just thinking about selling myself. But I’m also not willing to give up on myself, so I’m taking my own advice and looking for a better way. Part of that is talking to people who know more about putting yourself out there to gain recognition and trust rather than playing the numbers game. I spent enough of my life playing with numbers. I’m learning I prefer words, hands down. #### Gratitude Always Works My gratitudes tonight are: 1. I’m grateful there is more than one way to reach my goals. 2. I’m grateful for the examples I see before me. Some, I’ll incorporate into my strategy, others I won’t. It doesn’t mean any of them are bad. Some are just a better fit for me. 3. I’m grateful for dance nights, even when the DJ plays the same old boring dances instead of the many new ones we’ve learned. I get my exercise, my social engagement, and my hugs. 4. I’m grateful for the upgrades I’ve made in my house in the last week or two. They’re neither expensive nor earth shaking. But they make me feel better, clearer, and more confident of my ability to attract the things I dream of. 5. I’m grateful for abundance; love, joy, manifestations, inspiration, motivation, companionship, friendship, peace, harmony, philanthropy, and prosperity. --- ### Are You Committed or Merely Interested? A Time for Reassessing. Am I Truly Committed? The last 3 1/2 years have been quite a ride for me. I’ve dabbled in a lot of things, written a few drafts of novels, and several hundred blog posts, but I’ve yet to figure out quite what I want to be when I grow up. No, I take that back. I’ve figured out what I want to be, I just haven’t fully committed to what’s required to get there. We go through life trying many different things. Some simply interest us, but every so often, one comes along that grabs us by the throat and we have no choice but to commit to it, heart, soul, mind, and body. I thought the writing was it for me, but with each setback, each rejection, each failure to launch, I become less certain. #### Step 1: Having a Plan of Action I know I need a plan, and have come up with several, but have yet to truly stick to anything long-term. Even the plan I typed up and put on my wall hasn’t really come to fruition. I’m not spending 2–3 hours a day writing. I’m not spending 2–3 hours a day reading motivational literature. And worst of all, I’m not spending 2–3 hours a day working on queries or researching companies to send queries to. Sure, I’m writing a blog post here and there. Yes, I’m doing at least 2 Facebook Lives a week. Yes, I’m still going to the gym most weeks, though the last couple have been challenging, to say the least. Having a plan is certainly a good place to start. But if you don’t follow the plan, it’s just words on paper, and may as well be in Swahili for all the meaning they bring into our lives. Yet, if you’re truly committed to something, won’t you stick to any plan at all just to be heading in the right direction? #### Acknowledging Our Fears and Frustrations I question myself every day. I ask what I’m afraid of. At first, it was fear of not following through. But if I’m completely honest with myself, I’ve followed through on writing commitments for others again and again. It’s myself I have trouble committing to. But at least that eliminates the excuse that I don’t send out queries because I’m afraid I won’t be able to fulfill the obligation. I’ve added a number of chapters to Forgotten Victims though I’m far from done. I did pay close attention to a book I’m currently reading in which the writer said that if your purpose in writing is to help other people, you might as well hang it up. If your purpose is to help yourself, you’re more likely to succeed, at least by finishing what you set out to write. If it helps someone else, great. But the primary goal has to be self-healing. I needed to hear that as I’d gotten off track in writing my memoir. I’d started posting chapters of Sasha’s Journey to a site of writers who critique each others’ work. But I wasn’t really committed there either. I read and commented on a couple of pieces, then slacked off. And now that they’re changing the rules and want us to post on our own blog sites and link to theirs, I’m not going to waste my time. If I wanted to post it on my site, I’d have already done so. So the frustration, the backpedaling and the discouragement continues. And again I ask myself “Am I committed or merely interested?” #### Giving My Life Blood for Someone Else’s Dreams The reality is, I’ve just about used up the time I had to dabble here, and fritter there. I need to get focused on what I truly want to do, what I’m truly passionate about; and throw myself into it wholeheartedly. Because if I don’t, I deserve no more than to work the rest of my life to pad someone else’s retirement fund. At least there, I know what I do not want. #### Being Clear on What You Do Want Figuring out what you truly do want is another story entirely. I want to write, yet I go for days without writing a word. I want to be independent. But I go for days without doing a thing to move myself forward. I want to do good for others, but here I sit, devoting time and energy to just worry about myself. That’s energy I won’t get back and it benefits no one. I want to be an inspirational speaker, but until recently, was doing little or nothing towards that end. At least now I’ve signed up to volunteer at a summit for speakers in October. I’ve also been reading books like Talk Like Ted to help me understand what makes a truly great speaker. I’ve been incorporating what I’m learning into both my Facebook Lives and my writing. I’m also watching how other people speak, paying close attention to what does and does not work. As a result, my more recent Facebook Lives have been under 15 minutes. (18 minutes is optimum for a TED talk. I figure a live broadcast should be shorter). #### The Big “Why” Everyone talks about the big “why”. Mine is becoming so clear that I inadvertently picked out a paint color to go with the life I want to live. It was brought home to me yesterday when my daughter and I took a couple of wrong turns and ended up driving along the beach. The water was the exact color I’d chosen for my dining room wall! Thanks to my daughter, it is now a beautiful dark teal, the same color as the ocean yesterday. The rest of the walls are in process of becoming a lighter version of the same color. Every time I walk out into my living room, despite the furniture sitting in the middle of the floor and the fine layer of dust coating everything, I feel both energized and soothed just by looking at that beautiful ocean-colored wall. I also broke down and bought the resin Adirondack chairs I’d fallen in love with a week or so ago. They, too fit the life and setting I envision for myself. My big “why” is alive and well. It’s now a matter of committing everything I have, everything I am to making it happen. Writing has always been my best therapist, and tonight is no different. I began this piece feeling like an utter failure with no real possibility of achieving my dreams. But as I think of the changes I’ve made even in the last couple of weeks, I realize I’m more committed than I give myself credit for. I’m simply moving towards my goals in my usual convoluted fashion. It may seem like I’m aimless and uncommitted, but somehow, in my own weird way, I’m getting where I’m going. #### Remembering Always to be Grateful My gratitudes tonight are: 1. I’m grateful for the supportive people who continue to find their way into my life. My blessings grow daily. 2. I am grateful for my personal therapist who has a way of turning my frown into a smile no matter how bad I think things are looking. 3. I am grateful for the opportunities that are literally dropping into my lap lately. 4. I am grateful for learning how to ask for help, and how to put myself into places where I can find exactly what I need. 5. I am grateful for abundance; resources, friendship, courage, companionship, progress, improvements, signs, commitment, love, joy, peace, harmony, health, philanthropy, and prosperity. --- ### September 18, 2015 Gratitude: When What We Need is to be Needed I’m a firm believer in the Laws of Attraction. The Universe will always bring exactly what is needed, though quite often it isn’t exactly how you might have envisioned it. Whether we realize it or not, we are putting our wants, desires, hopes and dreams out there every day and though we might not see all of the big ones manifesting, if we pay attention, we will see a multitude of small ones. I couldn’t tell you which of the many requests I’d put out there was answered yesterday, nor how I’d asked. What I do know was that when yesterday’s writing session was interrupted by a friend in need, it wasn’t long before I realized that at some point, I’d expressed a need to be needed. I feel both honored and grateful that my schedule as a writer and freelancer allows me to be there in those rare but beautiful moments when a friend reaches out, seeking what small comfort I might offer, but I know I’m the one who’s truly blessed because I’m being allowed to be needed. So many of my friends and family members are much like me and rarely ask for help so when one of them does ask, it’s something really important and requires attention at the moment of the asking, otherwise, the asker will just pull back into themselves and try to muddle through alone. As I worked on this post, Pandora chose to play this song and as it was so appropriate to what I’m writing, I am sharing it with you. Don’t think it gives me joy when someone I care about is suffering. Of course, I’d rather see them not have to go through a painful experience. But if it is necessary for their growth to struggle a bit and they can reach out to me to help them weather the storm, I can only feel grateful that time and circumstance aligned so that I could. Sure, we all have our own share of struggles and those struggles not only make us stronger but give us new tools with which to face future obstacles. Just as we crawl before we walk, we face bigger and bigger obstacles in our lives so we can receive or even create the tools we’ll need to make the next challenge that much easier. Imagine trying to fight a forest fire with a garden hose because you hadn’t gone through the experiences necessary to acquire a fire hose. Life is like that too. Anything we do gets better and stronger with practice. I look back on how I wrote when I was a kid, then as a teenager and, more recently, when I started this blog 6 1/2 years ago. So much has changed, not only for me personally, but for the way I put words together. The only way I got here was to put hundreds of thousands of words together in an infinite number of ways until I learned what worked and what didn’t. That’s not to say that I’ve got it all down, but the practice I’ve already had makes what I do going forward maybe just a little less like drek and more like literature. It has certainly encouraged me to keep trying, even when I’m taking my first novel apart and reassembling it, losing some of the old pieces and inserting quite a few new ones. Maybe I’m not quite achieving the aggressive goals I set for myself, but the four chapters my friend Candy challenged me to complete has now grown to eleven completed and a twelfth in progress. (What that means is, I figured out which of the original fifty-odd chapters I wanted to go next and cut and pasted it under the heading “chapter 12”). Admittedly, the initial challenge to get my butt back in gear came at the end of July, and that, in fact, is when I got the first four chapters done, so seven more in a month and a half isn’t exactly breaking any records, but forward progress is forward progress, and now I’m setting my own goals even if I have to revise them because I was too aggressive for right now. That doesn’t mean that four chapters a week won’t be realistic the further along I get. If I get frustrated, I look at page count instead and see that I’m almost 80 pages into a 342-page book right now. Again, not bad as long as I don’t dwell too long on how long it’s taken me to get this far. What I’ve gained over the last few weeks may not be earth-shaking, volume-wise. But I’ve gained consistency in sitting down to work on the project. The time I spend in a sitting has grown from about an hour to well over two lately (when I’m not interrupted, of course). Better still, I no longer have to argue with myself about sitting down to write, be it a blog post for me or a client or editing Sasha’s Journey. I just allocate time every day to write something, anything, even if it’s pure garbage. (I actually revised Chapter 11 three times over the last few days until I got it somewhere close to acceptable so I could move on). In fact, I’ve been getting so focused lately that I often forget to turn on the background music. That may or may not be a good thing as I tend to be significantly more self-critical when my internal editor is not otherwise occupied. Once again, I’ve wandered off the track a bit, but interwoven between all of the words I’ve put on the screen tonight is a single theme: gratitude. The Universe really does hear our requests. It may not bring them to us in the form we imagined, but it brings us what suits us best and helps move us forward. My gratitudes tonight are: 1. I am grateful for the opportunity to give of myself. 2. I am grateful for the friends who teach me by their own beautiful ways to be more giving, kind and compassionate. 3. I am grateful for the progress I’m making and though it will never be easy, I’m no longer having to fight with myself to move forward. 4. I am grateful to one, special friend who flat out told me to stop allowing my fears to get in my way. Even if I can’t identify them, I know they’re there and anxious to get between me and my dreams. Only I can thwart them. 5. I am grateful for abundance: love, friendship, progress, tenacity, determination, joy, health, happiness, harmony, peace, philanthropy and prosperity. --- ### January 16, 2015 Keeping it real: Leaps of Faith come in all sizes and colors. Find yours! When you buy a new car, you suddenly notice every one like yours on the road. Taking a leap of faith is no different. I find that my eyes have been opened to the miracles others perform every day. Some may think it’s nothing, but the rest of us know they’re pretty amazing. Take, for example, a friend of mine who is about to move herself, bag and baggage, four states away. She just decided it was what she needed to do for herself, and put the plan in action, allowing herself the chance to let things fall into place just because she believed in herself. Now, as she’s ready to leave town, she has three jobs, including the one in her current state, and she’ll be able to work them all from her home office, with regular trips to and fro, allowing her to stay in touch with friends she’s made all over the place. How terrific is that? And none of it would have happened had she not just believed. Or take another friend who, despite a cranky knee, runs marathons what seems like every weekend, AND she dances AND keeps up a very active life besides. She truly is a rock star! Then there’s my daughter who encouraged her husband to follow his own dream. He decided to take whatever route he needed to in order to get into the medical program with the Navy. At the moment, he’s a chef, but he goes above and beyond whatever he does. He’s already ranked up and is getting very positive feedback from some of the officers. But it meant that my daughter had to move far away from home for the first time in her life. What did she do? She went back to school…and she took up karate…and she’s getting involved with the family support group for her husband’s ship…and who knows what she’ll take up next. Best of all, she’s following her own dream as the colleges where she moved have exactly the programs she wants and needs! In my quest to write and publish, I’m stepping further out of my own comfort zone and looking for a writer’s group which will suit me. I love reading everyone’s stories. Even letting someone read our scribbles can be a huge leap of faith, much less putting in the time and effort to actually publish something so it’s available to the masses. How better to perpetuate leaps of faith than by surrounding yourself with other leapers? As I follow my own personal reinvention, sometimes leaping, but more often crawling, I find myself inspired by people who have made drastic changes in their lives, and I want to surround myself with people who are willing to get past their fears and just follow their hearts. I was going to say that they squelched their fears, but at least those like me don’t do that. We simply recognize the fear but don’t let it paralyze us. If nothing else, you don’t write things publicly or toss your literary baby out into the world if you give in to your fears. You slap a lid on them, glue it down as best you can, move forward while they’re being quiet, and stop when necessary to slap them down again. Otherwise, you’d be a quivering mass of protoplasm curled into the fetal position in some dark corner, never to be heard from again. Writers must write. It’s as important to us as breathing; maybe more so. That doesn’t mean we have to share, but authors need to share, and share, and share. Although, after I read the rules for the writer’s group I’ll be visiting tomorrow, I don’t think I’ll be sharing for awhile yet. They only want edited work, and frankly, mine has a long way to go. But there will come a point when I’ll know that it’s do or die, and one of my babies will be launched from the womb to bear the scrutiny of a world I hope will, at least initially, be kind in its criticisms. There will be plenty of time after it’s been fine-tuned for the world to take pot shots. Hopefully, by the time that happens, both my writing and I will have thickened our skins so most of what is chucked our way will roll off of us like water off an oil slick. All I can say is: Keep on Leapin’! If you would like to share your own leap of faith, I invite you to be a guest blogger. You can message me on Facebook or leave a message here on the blog. I look forward to being able to share your story! My gratitudes tonight are: 1. I am grateful for small successes in the Tarot Spells I’ve cast. 2. I am grateful for people who inspire me to continue to push my envelope. 3. I am grateful for quiet evenings alone with my cats to fiddle and play, but also to be inspired and to write. 4. I am grateful for the variety which has come into my life lately. Maybe soon I’ll be able to keep track of what day it is again! 5. I am grateful for abundance: leaps of faith, energy, inspiration, motivation, consistency, love, joy, happiness, friendship, lessons, health, prosperity and the constant companionship of my cats.	9,874	6,299	1,700,959,707,392,225,000	concat	[ "concat_full" ]	0.75	true	null
1,136,860,057,770,905,500	Are you a legal professional? Visit our professional site Chris Brown's Probation Revoked, so Why Is He Not in Jail? Article Placeholder Image By Brett Snider, Esq. on July 16, 2013 1:25 PM R&B legend and occasional court attendee Chris Brown appeared Monday before a Los Angeles judge who revoked the singer's probation. After reviewing the details of Brown's alleged hit-and-run in May, the judge revoked his felony probation, which he received for beating off-and-on girlfriend Rihanna in 2009. But Brown was not ordered to jail, reports The Associated Press. So why isn't Chris Brown behind bars for violating his probation, and what's next for the misbehaving singer? Probation Revoked The "Don't Wake Me Up" singer appeared in court on a prosecutor's motion to revoke his probation in light of his recent hit-and-run, which the judge granted, reports TMZ Often probation isn't revoked until after a probation revocation hearing, but a judge may pre-emptively revoke probation in anticipation of the hearing. Brown's next hearing date is set for August 16, which may give the pop star and his lawyer time to "informally" resolve the issue without a formal probation hearing, reports the AP. Yet He Walks Free While Brown is awaiting his hearing in August, he isn't counting the days inside a jail cell. That's because probationers can often be released on their own recognizance while awaiting either sentencing or a revocation hearing. If or when Brown manages to find himself in this situation again, a judge viewing a probation violation may impose bail on the "F.A.M.E." singer, which he could likely afford. Release on one's "own recognizance" isn't without certain strings, and if Brown says "Deuces!" to his next court appearance, the judge may issue a bench warrant for his arrest. Possible Punishments When August rolls around, Brown may be facing an extended grant of probation or even four years in prison, reports TMZ. Whether Chris Brown gets jail time or not for his latest car mischief is largely left to the judge, who has wide discretion to consider Brown's criminal history and the nature of his probation violation in formulating a sentence. But for now, the "Run It!" singer can walk free. Related Resources: THE CERAMIC ART THE CERAMIC ART The word “ceramics” originates from the Greek word Keramikos (the potters ’ quarter of ancient Athens), which in turn comes from keramos (pottery’s clay). In art history, ceramics mean art objects, such as tableware, ceramics for everyday use and decorative purposes. The Greeks’ design creation in antiquity is depicted on the surface of pots, that the artisans began to create and decorate from the early times in ceramic workshops. It was there that the shapeless mass of the clay was initially formed on the lathe by the potter’s skilled hands. Sometimes, it was shaped into a large pot like a round jar on a pointed or flat base, called pithos (jar), used to store wine, oil, figs or salted food; other times, into an oblong pot with two handles (ears) and a long neck, called amphoreas (urn), which was used to store wine and oil. Its opening was sealed with a resin layer and its base was usually pointed to be partly embedded on the ground. Sometimes, the clay was shaped into a pot with a very large opening and two handles. It was kratiras (crater) and was used to mix wine and water on the table.	# Chris Brown’s Probation Revoked, so Why Is He Not in Jail? By Brett Snider, Esq. on July 16, 2013 R&B legend and occasional court attendee Chris Brown appeared Monday before a Los Angeles judge who revoked the singer’s probation. After reviewing the details of Brown’s alleged hit-and-run in May, the judge revoked his felony probation, which he received for beating off-and-on girlfriend Rihanna in 2009. But Brown was not ordered to jail, reports The Associated Press. So why isn’t Chris Brown behind bars for violating his probation, and what’s next for the misbehaving singer? ## Probation Revoked The “Don’t Wake Me Up” singer appeared in court on a prosecutor’s motion to revoke his probation in light of his recent hit-and-run, which the judge granted, reports TMZ. Often probation isn’t revoked until after a probation revocation hearing, but a judge may pre-emptively revoke probation in anticipation of the hearing. Brown’s next hearing date is set for August 16, which may give the pop star and his lawyer time to “informally” resolve the issue without a formal probation hearing, reports the AP. ## Yet He Walks Free While Brown is awaiting his hearing in August, he isn’t counting the days inside a jail cell. That’s because probationers can often be released on their own recognizance while awaiting either sentencing or a revocation hearing. If or when Brown manages to find himself in this situation again, a judge viewing a probation violation may impose bail on the “F.A.M.E.” singer, which he could likely afford. Release on one’s “own recognizance” isn’t without certain strings, and if Brown says “Deuces!” to his next court appearance, the judge may issue a bench warrant for his arrest. ## Possible Punishments When August rolls around, Brown may be facing an extended grant of probation or even four years in prison, reports TMZ. Whether Chris Brown gets jail time or not for his latest car mischief is largely left to the judge, who has wide discretion to consider Brown’s criminal history and the nature of his probation violation in formulating a sentence. But for now, the “Run It!” singer can walk free. --- # THE CERAMIC ART The word “ceramics” originates from the Greek word Keramikos (the potters’ quarter of ancient Athens), which in turn comes from keramos (pottery’s clay). In art history, ceramics mean art objects, such as tableware, ceramics for everyday use and decorative purposes. The Greeks’ design creation in antiquity is depicted on the surface of pots, that the artisans began to create and decorate from the early times in ceramic workshops. It was there that the shapeless mass of the clay was initially formed on the lathe by the potter’s skilled hands. Sometimes, it was shaped into a large pot like a round jar on a pointed or flat base, called pithos (jar), used to store wine, oil, figs or salted food; other times, into an oblong pot with two handles (ears) and a long neck, called amphoreas (urn), which was used to store wine and oil. Its opening was sealed with a resin layer and its base was usually pointed to be partly embedded on the ground. Sometimes, the clay was shaped into a pot with a very large opening and two handles. It was kratiras (crater) and was used to mix wine and water on the table.	735	726	1,136,860,057,770,905,500	concat	[ "concat_full" ]	0.75	true	null
-3,458,022,658,245,403,600	Pat Dowd Will Not Be Ignored As you know, Councilman Patrick Dowd (D-Lawrenceville, Highland Park and such) is spearheading legislation that would launch an effort to rename and re-number city streets, chiefly to improve services from our police, firefighters and paramedics. Can you imagine 911 calls blurting out “Help me!!! I’m at 200 East! Click!” Or, “Help me! I’m at 200 Adams, which comes right after 3900, but it’s on the odd side of the street, yet on the odd side the odds go in opposite order from evens, starting where the old Foodland used to be!” So Councilman Dowd is trying to save lives — but he tried to do so by allowing the mayor’s administration (including 911 staff and various public safety officials) to form their own commission and do it themselves. Boom! No political input from the Council. Last week, it passed preliminarily with just 5 votes. Yesterday morning it was up for final action. (Pittsburgh City Council operates like Who Wants to Be a Millionaire; it is required to lock in its Final Answer.) At that point, Darlene Harris (D-most of the North Side) was like, no. Turns out, she has a soft spot both for tradition, and for Council’s basic role in government. She wrecked Dowd’s bid to totally exclude the Council from its ordinary oversight role in street changes — but he came back to the table the next day with new legislation that would let a super-majority the Council (6 out of 9) alter the administrative commission’s recommendations. It walks that line, somehow. This time he got 8 votes. And Pittsburgh city streets, pending another try at final action next week (almost a formality), will undergo a reformation. Sure, Dowd carried a some water for the mayor while he was at it — but it’s likely he expected all along to be forced to drop most of that particular water. “I should also point out there was a lot of compromise on this bill,” Dowd tells the Comet. “I am proud of that work mostly because I believe we all better understand each other’s concerns and how to deal with almost all of them. 5 votes supported the bill from the beginning but I worked up to 8-0-1. If we hit 9-0 that would be great.” “In my mind this is also part of the pledges signed in February,” Dowd adds. “In short, the legislation goes to 1) Equity and efficiency of service, and 2) Increased confidence in the services of the city.” ## That’s just the kind of talk that irritates many of his colleagues. One of Dowd’s first acts as a member of council was to cajole all his fellow councillors, the controller and the mayor to sign these fruity “pledges” to work toward vague-sounding “common goals”. It was signed on Valentine’s Day, which to many was symbolic of the lovey-dovey inanity of the exercise. Envisioned as a nonbinding resolution, it was reduced even further to a proclamation — much like, say, Russian Dressing Awareness Day. Even still, and though mocked relentlessly, Dowd persistently frames his legislative preferences in terms of his “landmark” joint pledges of cooperation. Take for example an invitation circulated by Dowd to learn more about the City of Pittsburgh’s Management and Performance System, or PittMaps — an online data archive for certain crime, public works, and building inspection statistics among others. The Mayor’s Office was to host a series of small workshops among council members and their staff as to how to use the system — all the better to fulfill the pledges, notably the one “to develop transparent accountability with operational performance measurement targets”. Sources indicate the results of this offer were uneven to say the least — many invitees across the political spectrum regarded this as something like an invitation to attend Dowd’s candle party. Everybody somehow had something better to do that week than to sit on the floor and learn about “benchmarking.” However, sometimes there seems to be a method to Dowd’s inimitable madness. When he was last in the news (aside from his bike-and-pedestrian initiative), he had elected to fund the city’s long-delayed race and gender equity disparity study by using up old rollover funds available to the Council itself — instead of mandating that the relevant administrative departments pay for it like normal. Some accused Dowd of inventing bogus principals to suit his political machinations. Dowd defended his insistence on how to fund the program with reference to the pledges to make the city budget more efficient, and services more affordable. He told the Comet that though the Council had certain obscure funds to which it was clinging for a rainy day, many other city departments and offices are hoarding pockets of cash as well. By burning through the Council’s stash, he insisted, Council then gains the moral authority to start going after all this squirrelled away money — which inflates, or as we like to say, “carbonates” the city budget. The impression we received from Dowd was that we were talking serious money. We asked whether it was a good idea for these offices and departments to store away cash for a rainy day or what have you, and Dowd replied, “No! That’s where fiefdoms come from!” He then extended his point to accountability — and before you knew it we were sold. Provided that Dowd and the Council followed through on the deal and started pursuing these forgotten funds within administrative departments. When will that come? Later. Lots of things that may involve respectful confrontation with the Mayor, especially among the Council’s “middle” wing (to which Patrick Dowd is the most obvious party) seem to be scheduled for an ephemeral “later”, which will likely be sometime mid-next year. At one time, as another example, Dowd was tangling with the URA pretty heatedly over access to its budget and allocation of the vast amounts of grant money available to it. This is an explosive issue beneath the surface, with potentially far greater impact on city neighborhoods than reconnoitering street signs. This desire to hold off on the tough stuff until just a little bit “later” could be a reflection of new council members’ natural desire to defer poking bears with sticks until a time just over the horizon — just a little bit longer — after they grow more comfortable, after the politics improve, after it becomes safe. Such things could be infinitely deferred, we suppose. Then again, the political map may change once again this spring. Seats held by council members Deasy, Motznik, Payne and Peduto are up for re-election. This is a favorable spread for those who might wish to disrupt have a more pro-active impact upon the Mayor’s agenda. Councilman Dowd would have his own unique preferences in these contests — or not — but regardless of the outcome, we’re fairly certain he would canter right over to the “new” center and set up shop. If that new center turns out to be a less guerrilla position — one capable of garnering six votes and overriding vetoes as necessary — so much the more interesting. In the meanwhile, he’ll continue lording those pledges over everybody — and he’ll continue finding a way to rack up a vast record of prosaic accomplishments. And although he’ll choose his battles with excruciating care, when he does go to battle he’ll likely continue to be hard to deny. 2 thoughts on “Pat Dowd Will Not Be Ignored 1. Mark Rauterkus This effort to re-name and re-number for the sake of clarity is a worthy endeavor for the city, be it council or administration — with citizen input, of course.Where is the citizen input, by the way? Reply 2. Bram Reichbaum Mark –My understanding is that citizen input is to be mediated through council representatives, and perhaps through community meetings hosted by departmental units. That’s just an understanding, though — I don’t think there will be “hearings” unless there’s a public petition accepted, or a member of council requests one.BTW, I’m fine with that. Reply Leave a Reply to Mark Rauterkus Cancel reply Your email address will not be published. Time limit is exhausted. Please reload the CAPTCHA. birmingham.io ProductTank Brum: Birmingham Tech Week special - Wednesday 9th October 2019 2019-10-09T00:00:00Z Hi product people, We’re pleased to be taking part in Birmingham Tech Week and running our event a little bit earlier than usual. This month we are joined by Chirag Agarwal - Kainos’s Head of Product and Julia Bellis - Service manager at HMPO. They will be giving a talk titled: The joy of a deadline! How we transformed digital passport applications against the clock We’re looking forward to learning how to deliver products/services your users love with deadlines looming large. We hope you can join us, please RSVP here. Proudly sponsored by Bytemark	# Pat Dowd Will Not Be Ignored As you know, Councilman Patrick Dowd (D-Lawrenceville, Highland Park and such) is spearheading legislation that would launch an effort to rename and re-number city streets, chiefly to improve services from our police, firefighters and paramedics. Can you imagine 911 calls blurting out “Help me!!! I’m at 200 East! Click!” Or, “Help me! I’m at 200 Adams, which comes right after 3900, but it’s on the odd side of the street, yet on the odd side the odds go in opposite order from evens, starting where the old Foodland used to be!” So Councilman Dowd is trying to save lives — but he tried to do so by allowing the mayor’s administration (including 911 staff and various public safety officials) to form their own commission and do it themselves. Boom! No political input from the Council. Last week, it passed preliminarily with just 5 votes. Yesterday morning it was up for final action. (Pittsburgh City Council operates like Who Wants to Be a Millionaire; it is required to lock in its Final Answer.) At that point, Darlene Harris (D-most of the North Side) was like, no. Turns out, she has a soft spot both for tradition, and for Council’s basic role in government. She wrecked Dowd’s bid to totally exclude the Council from its ordinary oversight role in street changes — but he came back to the table the next day with new legislation that would let a super-majority the Council (6 out of 9) alter the administrative commission’s recommendations. It walks that line, somehow. This time he got 8 votes. And Pittsburgh city streets, pending another try at final action next week (almost a formality), will undergo a reformation. Sure, Dowd carried a some water for the mayor while he was at it — but it’s likely he expected all along to be forced to drop most of that particular water. > “I should also point out there was a lot of compromise on this bill,” Dowd tells the Comet. “I am proud of that work mostly because I believe we all better understand each other’s concerns and how to deal with almost all of them. 5 votes supported the bill from the beginning but I worked up to 8-0-1. If we hit 9-0 that would be great.” > “In my mind this is also part of the pledges signed in February,” Dowd adds. “In short, the legislation goes to 1) Equity and efficiency of service, and 2) Increased confidence in the services of the city.” --- That’s just the kind of talk that irritates many of his colleagues. One of Dowd’s first acts as a member of council was to cajole all his fellow councillors, the controller and the mayor to sign these fruity “pledges” to work toward vague-sounding “common goals”. It was signed on Valentine’s Day, which to many was symbolic of the lovey-dovey inanity of the exercise. Envisioned as a nonbinding resolution, it was reduced even further to a proclamation — much like, say, Russian Dressing Awareness Day. Even still, and though mocked relentlessly, Dowd persistently frames his legislative preferences in terms of his “landmark” joint pledges of cooperation. Take for example an invitation circulated by Dowd to learn more about the City of Pittsburgh’s Management and Performance System, or PittMaps — an online data archive for certain crime, public works, and building inspection statistics among others. The Mayor’s Office was to host a series of small workshops among council members and their staff as to how to use the system — all the better to fulfill the pledges, notably the one “to develop transparent accountability with operational performance measurement targets”. Sources indicate the results of this offer were uneven to say the least — many invitees across the political spectrum regarded this as something like an invitation to attend Dowd’s candle party. Everybody somehow had something better to do that week than to sit on the floor and learn about “benchmarking.” However, sometimes there seems to be a method to Dowd’s inimitable madness. When he was last in the news (aside from his bike-and-pedestrian initiative), he had elected to fund the city’s long-delayed race and gender equity disparity study by using up old rollover funds available to the Council itself — instead of mandating that the relevant administrative departments pay for it like normal. Some accused Dowd of inventing bogus principals to suit his political machinations. Dowd defended his insistence on how to fund the program with reference to the pledges to make the city budget more efficient, and services more affordable. He told the Comet that though the Council had certain obscure funds to which it was clinging for a rainy day, many other city departments and offices are hoarding pockets of cash as well. By burning through the Council’s stash, he insisted, Council then gains the moral authority to start going after all this squirrelled away money — which inflates, or as we like to say, “carbonates” the city budget. The impression we received from Dowd was that we were talking serious money. We asked whether it was a good idea for these offices and departments to store away cash for a rainy day or what have you, and Dowd replied, “No! That’s where fiefdoms come from!” He then extended his point to accountability — and before you knew it we were sold. Provided that Dowd and the Council followed through on the deal and started pursuing these forgotten funds within administrative departments. When will that come? Later. Lots of things that may involve respectful confrontation with the Mayor, especially among the Council’s “middle” wing (to which Patrick Dowd is the most obvious party) seem to be scheduled for an ephemeral “later”, which will likely be sometime mid-next year. At one time, as another example, Dowd was tangling with the URA pretty heatedly over access to its budget and allocation of the vast amounts of grant money available to it. This is an explosive issue beneath the surface, with potentially far greater impact on city neighborhoods than reconnoitering street signs. This desire to hold off on the tough stuff until just a little bit “later” could be a reflection of new council members’ natural desire to defer poking bears with sticks until a time just over the horizon — just a little bit longer — after they grow more comfortable, after the politics improve, after it becomes safe. Such things could be infinitely deferred, we suppose. Then again, the political map may change once again this spring. Seats held by council members Deasy, Motznik, Payne and Peduto are up for re-election. This is a favorable spread for those who might wish to disrupt have a more pro-active impact upon the Mayor’s agenda. Councilman Dowd would have his own unique preferences in these contests — or not — but regardless of the outcome, we’re fairly certain he would canter right over to the “new” center and set up shop. If that new center turns out to be a less guerrilla position — one capable of garnering six votes and overriding vetoes as necessary — so much the more interesting. In the meanwhile, he’ll continue lording those pledges over everybody — and he’ll continue finding a way to rack up a vast record of prosaic accomplishments. And although he’ll choose his battles with excruciating care, when he does go to battle he’ll likely continue to be hard to deny. --- # ProductTank Brum: Birmingham Tech Week special Wednesday 9th October 2019 Hi product people, We’re pleased to be taking part in Birmingham Tech Week and running our event a little bit earlier than usual. This month we are joined by Chirag Agarwal (Kainos’s Head of Product) and Julia Bellis (Service Manager at HMPO). They will be giving a talk titled: > The joy of a deadline! How we transformed digital passport applications against the clock We’re looking forward to learning how to deliver products/services your users love with deadlines looming large. Please RSVP here. Proudly sponsored by Bytemark	1,883	1,699	-3,458,022,658,245,403,600	concat	[ "concat_full" ]	0.75	true	null
-6,527,455,876,717,150,000	Home Advanced Search Current Auction Store Items Shipping Charges Guidelines Featured Items Grading Forum Back to item list Back to item list Hank Penny Locked Out / Penny Blows His Top Item Information Instant Purchase Price $4.00 Shipping Costs (Shipping details) Item Location Howell, MICHIGAN, UNITED STATES, 48843 Label King Item Number 621 Recording Date 1946/1947 Physical Grade A :: B VG+ Defects Scratch::Light Scratch Genre Country, Hillbilly & Bluegrass Format 10" 78 Quantity (for shipping calculations) 1 Meet The Seller Seller Pure Shellac (243) Feedback Score 100% Positive Member Since Oct 24, 2014 in United States Read feedback comments Ask seller a question View seller’s other items List View Store Image Gallery Find More Items From Same Seller Billy Murray Instant Purchase $4.00 Cal Stewart Instant Purchase $4.00 Jack Teagarden and His Orchestra Instant Purchase $4.00 Somethin' Smith and the Redheads $4.00 Time Left: 1 Day 0 hrs HomeAbout VM AuctionsContact Us Copyright © 2019 Venerable Music • 2.5.3.1 Close Sign in to Cleveland.com User Profile You are signed in as Find a local business Find Local Businesses in Cleveland Julianne's Bridal Address 10011 Mitchell Rd Columbia Station OH 44028 Phone (440) 236-3181 Average Rating 0 Total Reviews (0) Leave a review with: 1. 1 Star 2. 2 Stars 3. 3 Stars 4. 4 Stars 5. 5 Stars Get Directions Share on Share Contact Us Featured Businesses Mid-Ohio Forklifts Inc • 1336 Home Ave Akron, OH 44310 • (330) 633-1230 Mid-Ohio Forklifts, Inc. sells, services, and rents new and used forklift trucks in Akron, OH. View Profile Fairview Cycle & Lock • 22230 Lorain Rd Cleveland, OH 44126 • (440) 734-2266 View Profile St Paul Hellenic Center Catered By Brennan's • 4548 Wallings Rd North Royalton, OH 44133 • (440) 582-1083 View Profile Submit a correction Know more about this business than we do? Cool! Please submit any corrections or missing details you may have. Help us make it right Bridal Alteration Specialist 30 years experience in alterations for Wedding Gowns, Bridesmaids, Mothers, Prom and other Formal wear What the community has to say about Julianne's Bridal Add Photo or Video User Photos & Videos Reviews of this business Share a review Business description (2) Since 1996 the company has been providing Retail - Bridal Shops. Www.Juliannebridal.Com	# Hank Penny – Locked Out / Penny Blows His Top ## Item Information - Instant Purchase Price: $4.00 - Shipping Costs: (Shipping details) - Item Location: Howell, MICHIGAN, UNITED STATES, 48843 - Label: King - Item Number: 621 - Recording Date: 1946/1947 - Physical Grade: A :: B VG+ - Defects: Scratch :: Light Scratch - Genre: Country, Hillbilly & Bluegrass - Format: 10" 78 - Quantity: 1 --- ## Seller: Pure Shellac (243) - Feedback Score: 100% Positive - Member Since: Oct 24, 2014 - Location: United States --- ## Related Items from This Seller - Billy Murray – Instant Purchase $4.00 - Cal Stewart – Instant Purchase $4.00 - Jack Teagarden and His Orchestra – Instant Purchase $4.00 - Somethin' Smith and the Redheads – $4.00 (Time Left: 1 Day 0 hrs) --- # Julianne’s Bridal Address 10011 Mitchell Rd Columbia Station, OH 44028 Phone (440) 236-3181 Website [www.juliannebridal.com](http://www.juliannebridal.com) Average Rating 0 (based on 0 reviews) --- ## Business Description - Since 1996, providing retail bridal shop services - Bridal alteration specialist with 30 years of experience in wedding gowns, bridesmaids, mothers, prom and other formal wear --- ## Leave a Review 1. 1 Star 2. 2 Stars 3. 3 Stars 4. 4 Stars 5. 5 Stars --- ## Get Directions [View on Google Maps](https://www.google.com/maps/search/?api=1&query=10011+Mitchell+Rd+Columbia+Station+OH+44028)	657	449	-6,527,455,876,717,150,000	concat	[ "concat_full" ]	0.75	true	null
-6,905,298,769,847,443,000	GREEN Plus Size 40% Off Fall Faves Plus-size green Fall Favorites Fall in love with the season’s trendy favorites from cozy green sweaters, to prints of camo and plaid to jackets for layering-- these transitional plus-sizes pieces will complete your autumn wardrobe. Not to mention the season’s biggest statement shoe, over-the-knee wide-width boots. Help With Searches Active filters Click on a filter to remove it. Category Filters Tick the following box in order to only display profiles with M&M stats Power Level Role Category 0 - DC Comics What is now called DC Comics started out as National Allied Publications. It was founded by Malcolm Wheeler-Nicholson in 1934. The first “comic” published was New Fun: The Big Comic Magazine in 1935. The company was quickly known as DC Comics even though that... (Michelinie's aborted 1970s cosmology) 0 - Behold the realm of the fifteen worlds — seven of light and seven of darkness, and one world hanging precariously in the balance. The place where the real and the world of dream fuse and become the one — the world of Claw the Unconquered ! Context During the mid-1970s, DC... 0 - Context This is the planet Krypton pre-Crisis on Infinite Earths. It was published as the colour feature in the back of Amazing World of Superman Metropolis Edition (1973). I thought it would be useful to have it here, since not only is it difficult to locate – but people would need to... 0 - Context Before Geocities closed, there were two main DCH resources there : The Knight of Shadow site. Eric Padua’s JLA site. We have back-uped on writeups.org the Knight’s stuff first, since there was a lot of material in there. And here comes Eric’s stuff,... 0 - Context The Phantom Zone is a Superman story element that first appeared in 1961. Over the decades it became part of the mythology, particularly after it showed up in Superman movies. It is a sort of limbo where terrible criminals are exiled for, well, eternal torture. Advertisement ... 0 - Context This article provides speculative explanations about this famous piece of Silver Age rubber science. The Bizarro ray and its creations featured in many Superman stories back then. Wait, I can explain! The origins of Bizarro can best be described as “an unfortunate... 0 - Context These are vintage (late 1990s, I think) DC Heroes RPG notes about the technical aspects of joining the Justice League International. It’s primarily of interest for campaigns where the heroes are associating with an old-school version of the League. or as inspiration for... 0 - Advertisement (adsbygoogle = window.adsbygoogle \|\| []).push({}); Location Type : Transdimensional meta-concept. Situation : A plane of reality which intersects our own. Area : Potentially infinite. Land Boundaries : None. Climate : Mostly temperate if any. Terrain : Urban. Natural...	# GREEN Plus Size 40% Off Fall Faves Plus-size green Fall Favorites Fall in love with the season’s trendy favorites from cozy green sweaters, to prints of camo and plaid to jackets for layering—these transitional plus-sizes pieces will complete your autumn wardrobe. Not to mention the season’s biggest statement shoe, over-the-knee wide-width boots. --- # Search Results - DC Comics What is now called DC Comics started out as National Allied Publications. It was founded by Malcolm Wheeler-Nicholson in 1934. The first “comic” published was New Fun: The Big Comic Magazine in 1935. The company was quickly known as DC Comics even though that... - (Michelinie’s aborted 1970s cosmology) Behold the realm of the fifteen worlds — seven of light and seven of darkness, and one world hanging precariously in the balance. The place where the real and the world of dream fuse and become the one — the world of Claw the Unconquered! Context During the mid-1970s, DC... - Context: This is the planet Krypton pre-Crisis on Infinite Earths. It was published as the colour feature in the back of Amazing World of Superman Metropolis Edition (1973). I thought it would be useful to have it here, since not only is it difficult to locate – but people would need to... - Context: Before Geocities closed, there were two main DCH resources there: The Knight of Shadow site. Eric Padua’s JLA site. We have back-uped on writeups.org the Knight’s stuff first, since there was a lot of material in there. And here comes Eric’s stuff,... - Context: The Phantom Zone is a Superman story element that first appeared in 1961. Over the decades it became part of the mythology, particularly after it showed up in Superman movies. It is a sort of limbo where terrible criminals are exiled for, well, eternal torture. - Context: This article provides speculative explanations about this famous piece of Silver Age rubber science. The Bizarro ray and its creations featured in many Superman stories back then. Wait, I can explain! The origins of Bizarro can best be described as “an unfortunate... - *Context: These are vintage (late 1990s, I think) DC Heroes RPG notes about the technical aspects of joining the Justice League International.* It’s primarily of interest for campaigns where the heroes are associating with an old-school version of the League. or as inspiration for... - Location Type: Transdimensional meta-concept Situation: A plane of reality which intersects our own. Area: Potentially infinite. Land Boundaries: None. Climate: Mostly temperate if any. Terrain: Urban. Natural...	681	591	-6,905,298,769,847,443,000	concat	[ "concat_full" ]	0.75	true	null
3,984,965,459,787,931,000	Register Login • Osteoporotic Fracture Care Osteoporotic Fracture Care Medical and Surgical Management Author : Blauth , Kates , Nicholas Binding : Hardback Date : April 2019 Edition : 1 Year : 2019 Illustrations : 1000 Pages : 610 ISBN : 9783132427518 16,200 Share this title Download this Page in PDF 0 reviews Description With an increase in the longevity of the global population, care of the functional, cognitive, and physical health of older adults is essential. There has been a dramatic demographic shift toward a growing aging population and an increase in osteoporotic fractures that has occurred over the last few decades especially in Western countries. This clearly demonstrates the need for a comprehensive approach to treating fragility fractures by surgeons, geriatricians, and care staff. Osteoporotic Fracture Care is the first book of its kind to offer a well-rounded and comprehensive resource on fragility fractures and orthogeriatric care designed to help new and experienced surgeons, geriatricians, physicians, and care personnel to better work together and develop interprofessional and interdisciplinary systems so as to treat patients more effectively. The book contains 44 chapters and is divided into three sections: "Principles", "Improving the system of care", and "Fracture management". The book's key features are: • In-depth insight into the needs of older adults and how to best improve patient care, patient outcome, and reduce system costs • Twenty detailed and illustrative case-based chapters giving the reader a wide array of options to improve patient care and outcomes • More than 1,000 high-quality x-rays, clinical images, and illustrations Write a review Rate this product: Quick Contact Sign up and be the first to get exclusive offers, sales, events, and more! Get 5% discount on any purchase! WHITESTONE 718.747.7747 WHITESTONE FLUSHING 718.224.3083 FLUSHING GLENDALE 718.366.6636 GLENDALE to Search Search • Search 157 properties match your search; Selected Area(s): Jackson Heights (157) Save Search Showing 1 - 10 of 157 results\| view: results per page« 1\|2\|3\|4\|5\|...\|last » • 33-24 91st Unit 5V Jackson Heights, NY 11372 $399,000 2 Bedrooms 1 Full Bath Sq. Ft. 1000.00:# Coop For Sale NEWOPEN HOUSE ML# 3173384 Must see this Stunning Updating Corner Two Bedroom Apartment In The Legendary Southridge Development in Jackson Heights. There are Four Private Parks, An Event Room, New Private Laundry Facilities, New Storage Room, & Bike Rooms. The Subway Into Manhattan Is A Short Distance & The Bus Stop Is Across The Street. The Apartment Gives Way To An Open Living/Dining Room Floor Plan With Crown Molding Throughout &The Kitchen & Bathrooms are Renovated. Maintenance of $675 Includes Electricity!!! Call Today: 718-747-7747, or Email: Carollo Real Estate Inc Upcoming Open House 10/19/2019 - 10/19/2019 11:00am-12:00pm View Location • 37-27 86th Street Unit 6E Jackson Heights, NY 11372 $429,000 $419,000 1 Bedroom 1 Full Bath Sq. Ft. 750.00:# Coop For Sale OPEN HOUSEPRICE REDUCED ML# 3145267 The dream one bedroom apartment: top floor, corner unit, beautifully renovated and ready to move right in! This co-op unit has been tastefully updated throughout and meticulously maintained. The kitchen has granite countertops, stainless appliances and full cabinets to the ceiling for optimal storage, in a warm palette. The open foyer offers dining space that flows right into the generous living room. Hardwood floors throughout and into the large bedroom. Renovated tile bath. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc Upcoming Open House 10/19/2019 - 10/19/2019 1:00pm-2:00pm View Location • 76-15 35 Ave Unit 5M Jackson Heights, NY 11372 $495,000 1 Bedroom 1 Full Bath Condo For Sale NEW ML# 3173168 Beautiful one Bedroom Condominium Conveniently Located at the Prime Area of Jackson Heights!! Call Today: 718-747-7747, or Email: Carollo Real Estate Inc • 91-10 34th Ave Unit 6C Jackson Heights, NY 11372 $560,000 1 Bedroom 1 Full Bath Condo For Sale NEW ML# 3173259 Call Today: 718-747-7747, or Email: Carollo Real Estate Inc • 35-55 76 St Unit 51 Jackson Heights, NY 11372 $815,000 2 Bedrooms 2 Full Baths Sq. Ft. 1100.00:# Coop For Sale NEWOPEN HOUSE ML# 3173159 Top floor, sun-filled, five-room garden apartment at Hawthorne Ct. Elevator opens directly into the living room (with fireplace) which is open to a formal dining room. Sunroom/second bedroom with renovated full bath and storage extends beyond dining room and has six windows facing fabulous internal garden. Master bedroom adjacent to renovated full bath and nicely updated kitchen. Windows face east, west & north. Tasteful renovation complements prewar details. Cat OK. 33% Down. No subletting. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc Upcoming Open House 10/20/2019 - 10/20/2019 12:30pm-2:00pm View Location • 35-21 79th St Unit 1J Jackson Heights, NY 11372 $612,000 $599,000 2 Bedrooms 1 Full Bath Coop For Sale OPEN HOUSEPRICE REDUCED ML# 3148465 Gut renovated large 2 bed 1 bath unit. Raised first floor. Oak Wood floors throughout. Large eat in kitchen with stainless steel appliances and granite countertops. King size bedroom with double exposure window allowing for plenty of light. Large Second bedroom with closet and window facing greenery. Windowed Spa like bathroom. Living room with large enough foyer to use as dining room if needed. Pet friendly building. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc Upcoming Open House 10/19/2019 - 10/19/2019 2:00pm-3:00pm 10/20/2019 - 10/20/2019 12:30pm-1:30pm View Location • 37-21 80th St Unit 2E Jackson Heights, NY 11372 $283,999 1 Bedroom 1 Full Bath Coop For Sale ML# 3162742 One bedroom, quiet, corner apartment. Fully renovated kitchen, quartz countertops, stainless steel appliances, including dishwasher. Kitchen has an eat in space. Large rooms as well as high ceilings. There are 3 closets, all with original doors, over 7 feet tall. There is no closet in the bedroom, however sellers will add one for serious buyer. Bedroom can fit a king size bed. Building has laundry room, as well as storage space. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc • 30-38 74th St Jackson Heights, NY 11370 $1,500,000 7 Bedrooms 3 Full Baths Multi Family For Sale NEW ML# 3172490 Mint condition property in the hard of Jackson Heights. Location, location, Location, One parking garage and privated parking for two cars. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc • 33-46 92nd St Unit 2S Jackson Heights, NY 11372 $439,000 3 Bedrooms 1 Full Bath 1 Half Bath Coop For Sale NEW ML# 3172419 Spacious, sun-kissed 3 Br/1.5 bath Coop. There is a LR, separate dining area, kitchen, 5 closets, three exposures and more. The sun-kissed apartment receives natural light all day long. It faces south, north, and west. The maintenance of $1004 is inclusive of electric, gas, heat, and taxes. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc • 34-10 94th St Unit 4C Jackson Heights, NY 11372 $439,000 3 Bedrooms 1 Full Bath Sq. Ft. 1100.00:# Coop For Sale NEW ML# 3172418 A Stunning renovation of a true Three bedroom/one bathroom residence. The bright, airy, and tastefully appointed unit features a spacious living room, a defined dining area, a kitchen with granite counter tops, stainless steel appliances, and walnut cabinetry. The bathroom has floor to ceiling tiles, a pedestal sink, and a new bathtub. No detail was spared during the renovation which included the opening of a wall which separates the bedrooms from the living area. Call Today: 718-747-7747, or Email: Carollo Real Estate Inc Showing 1 - 10 of 157 results\| view: results per page« 1\|2\|3\|4\|5\|...\|last » Multiple Listing Service of Long Island, Inc. The data relating to real estate for sale on this web site comes in part from the Broker Reciprocity Program of the Multiple Listing Service of Long Island, Inc. Real Estate listings held by brokerage firms other than Carollo Real Estate are marked with the Broker Reciprocity logo and detailed information about them includes the name of the listing brokers. Questions? Just Ask! Submit	# Osteoporotic Fracture Care ## Medical and Surgical Management Author: Blauth, Kates, Nicholas Binding: Hardback Date: April 2019 Edition: 1 Year: 2019 Illustrations: 1,000 Pages: 610 ISBN: 9783132427518 Price: 16,200 --- ## Description With an increase in the longevity of the global population, care of the functional, cognitive, and physical health of older adults is essential. There has been a dramatic demographic shift toward a growing aging population and an increase in osteoporotic fractures that has occurred over the last few decades especially in Western countries. This clearly demonstrates the need for a comprehensive approach to treating fragility fractures by surgeons, geriatricians, and care staff. Osteoporotic Fracture Care is the first book of its kind to offer a well-rounded and comprehensive resource on fragility fractures and orthogeriatric care designed to help new and experienced surgeons, geriatricians, physicians, and care personnel to better work together and develop interprofessional and interdisciplinary systems so as to treat patients more effectively. The book contains 44 chapters and is divided into three sections: 1. Principles 2. Improving the system of care 3. Fracture management --- ## Key Features - In-depth insight into the needs of older adults and how to best improve patient care, patient outcome, and reduce system costs - Twenty detailed and illustrative case-based chapters giving the reader a wide array of options to improve patient care and outcomes - More than 1,000 high-quality x-rays, clinical images, and illustrations --- # Jackson Heights Listings (Showing 1–10 of 157) ## 33-24 91st Unit 5V, Jackson Heights, NY 11372 - Price: $399,000 - Bedrooms/Baths: 2 Beds, 1 Bath - Sq. Ft.: 1,000 - Type: Coop For Sale · NEW · OPEN HOUSE - ML#: 3173384 - Description: Must see this Stunning Updating Corner Two Bedroom Apartment In The Legendary Southridge Development in Jackson Heights. There are Four Private Parks, An Event Room, New Private Laundry Facilities, New Storage Room, & Bike Rooms. The Subway Into Manhattan Is A Short Distance & The Bus Stop Is Across The Street. The Apartment Gives Way To An Open Living/Dining Room Floor Plan With Crown Molding Throughout & The Kitchen & Bathrooms are Renovated. Maintenance of $675 Includes Electricity!!! - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc - Upcoming Open House: 10/19/2019 · 11:00 am–12:00 pm --- ## 37-27 86th Street Unit 6E, Jackson Heights, NY 11372 - Price: Was $429,000 → Now $419,000 - Bedrooms/Baths: 1 Bed, 1 Bath - Sq. Ft.: 750 - Type: Coop For Sale · OPEN HOUSE · PRICE REDUCED - ML#: 3145267 - Description: The dream one bedroom apartment: top floor, corner unit, beautifully renovated and ready to move right in! This co-op unit has been tastefully updated throughout and meticulously maintained. The kitchen has granite countertops, stainless appliances and full cabinets to the ceiling for optimal storage, in a warm palette. The open foyer offers dining space that flows right into the generous living room. Hardwood floors throughout and into the large bedroom. Renovated tile bath. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc - Upcoming Open House: 10/19/2019 · 1:00 pm–2:00 pm --- ## 76-15 35 Ave Unit 5M, Jackson Heights, NY 11372 - Price: $495,000 - Bedrooms/Baths: 1 Bed, 1 Bath - Type: Condo For Sale · NEW - ML#: 3173168 - Description: Beautiful one Bedroom Condominium Conveniently Located at the Prime Area of Jackson Heights!! - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc --- ## 91-10 34th Ave Unit 6C, Jackson Heights, NY 11372 - Price: $560,000 - Bedrooms/Baths: 1 Bed, 1 Bath - Type: Condo For Sale · NEW - ML#: 3173259 - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc --- ## 35-55 76 St Unit 51, Jackson Heights, NY 11372 - Price: $815,000 - Bedrooms/Baths: 2 Beds, 2 Baths - Sq. Ft.: 1,100 - Type: Coop For Sale · NEW · OPEN HOUSE - ML#: 3173159 - Description: Top floor, sun-filled, five-room garden apartment at Hawthorne Ct. Elevator opens directly into the living room (with fireplace) which is open to a formal dining room. Sunroom/second bedroom with renovated full bath and storage extends beyond dining room and has six windows facing fabulous internal garden. Master bedroom adjacent to renovated full bath and nicely updated kitchen. Windows face east, west & north. Tasteful renovation complements prewar details. Cat OK. 33% Down. No subletting. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc - Upcoming Open House: 10/20/2019 · 12:30 pm–2:00 pm --- ## 35-21 79th St Unit 1J, Jackson Heights, NY 11372 - Price: Was $612,000 → Now $599,000 - Bedrooms/Baths: 2 Beds, 1 Bath - Type: Coop For Sale · OPEN HOUSE · PRICE REDUCED - ML#: 3148465 - Description: Gut renovated large 2 bed 1 bath unit. Raised first floor. Oak Wood floors throughout. Large eat in kitchen with stainless steel appliances and granite countertops. King size bedroom with double exposure window allowing for plenty of light. Large Second bedroom with closet and window facing greenery. Windowed Spa like bathroom. Living room with large enough foyer to use as dining room if needed. Pet friendly building. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc - Upcoming Open House: - 10/19/2019 · 2:00 pm–3:00 pm - 10/20/2019 · 12:30 pm–1:30 pm --- ## 37-21 80th St Unit 2E, Jackson Heights, NY 11372 - Price: $283,999 - Bedrooms/Baths: 1 Bed, 1 Bath - Type: Coop For Sale - ML#: 3162742 - Description: One bedroom, quiet, corner apartment. Fully renovated kitchen, quartz countertops, stainless steel appliances, including dishwasher. Kitchen has an eat in space. Large rooms as well as high ceilings. There are 3 closets, all with original doors, over 7 feet tall. There is no closet in the bedroom, however sellers will add one for serious buyer. Bedroom can fit a king size bed. Building has laundry room, as well as storage space. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc --- ## 30-38 74th St, Jackson Heights, NY 11370 - Price: $1,500,000 - Bedrooms/Baths: 7 Beds, 3 Baths - Type: Multi Family For Sale · NEW - ML#: 3172490 - Description: Mint condition property in the hard of Jackson Heights. Location, location, Location, One parking garage and privated parking for two cars. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc --- ## 33-46 92nd St Unit 2S, Jackson Heights, NY 11372 - Price: $439,000 - Bedrooms/Baths: 3 Beds, 1.5 Baths - Type: Coop For Sale · NEW - ML#: 3172419 - Description: Spacious, sun-kissed 3 Br/1.5 bath Coop. There is a LR, separate dining area, kitchen, 5 closets, three exposures and more. The sun-kissed apartment receives natural light all day long. It faces south, north, and west. The maintenance of $1004 is inclusive of electric, gas, heat, and taxes. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc --- ## 34-10 94th St Unit 4C, Jackson Heights, NY 11372 - Price: $439,000 - Bedrooms/Baths: 3 Beds, 1 Bath - Sq. Ft.: 1,100 - Type: Coop For Sale · NEW - ML#: 3172418 - Description: A Stunning renovation of a true Three bedroom/one bathroom residence. The bright, airy, and tastefully appointed unit features a spacious living room, a defined dining area, a kitchen with granite counter tops, stainless steel appliances, and walnut cabinetry. The bathroom has floor to ceiling tiles, a pedestal sink, and a new bathtub. No detail was spared during the renovation which included the opening of a wall which separates the bedrooms from the living area. - Contact: Call Today: 718-747-7747, or Email: Carollo Real Estate Inc	2,169	2,170	3,984,965,459,787,931,000	concat	[ "concat_full" ]	0.75	true	null
2,860,689,020,687,590,400	air-condition [ air-kuh n-dish-uh n ] / ˈɛər kənˌdɪʃ ən / verb (used with object) to furnish with an air-conditioning system. to treat (air) with such a system. Origin of air-condition First recorded in 1930–35 Dictionary.com Unabridged Based on the Random House Unabridged Dictionary, © Random House, Inc. 2019 British Dictionary definitions for air-condition air-condition verb (tr) to apply air conditioning to Collins English Dictionary - Complete & Unabridged 2012 Digital Edition © William Collins Sons & Co. Ltd. 1979, 1986 © HarperCollins Publishers 1998, 2000, 2003, 2005, 2006, 2007, 2009, 2012 All Product keywords Please enter the email address account ITTAR RC16BW Wireless Vacuum Cleaner Share to: ITTAR RC16BW Wireless Vacuum Cleaner - Plum Velvet 431746101 Suction / Sweeping / Moping 0 Customer Reviews \| Please refer to English description 215.22 Save an extra for using the App Scan the QR code to buy: • 1.Download our FREE app on Google play or App Store. • 2.Launch the app and scan the QR code to buy directly. Follow the below steps: • 1.Sign in to Gearbest.com • 2.Add product(s) marked with to your Cart. • 3.Open our app, and go to your Cart. • 4.Pay for your order for an immediate discount! • FREE SHIPPING COD This product supports COD on delivery. Suggestions: Do not place orders with non-COD products, otherwise you will not be able to choose COD payment method. Ship between: Oct 28 - Oct 30, Estimated Shipping Time: business days Order Processing Time may require a few days. Once dispatched from warehouse, Shipping (or Delivery) Time depends on the Shipping Method. • + • interest-free You can enjoy a maximum of 0 interest-free installments, and may not enjoy this offer when placing orders with other products ; Tax Info Price Protection Price Disclaimer One Year Repair Warranty Report item Clearance Recommended Products for You Customers Who Bought This Item Also Bought The portable removable vacuum cleaner is a very good household cleaner, the machine can stick to the ground about 170 degrees, about 20CM from the ground, the bed under the sofa can be easily swept. About 180 degrees up and down 90 degrees flexible mobile design, cleaning more flexible. Main features: Suction / Sweeping / Moping Mop the floor while sucking / sweeping it, save times High / Low Adjustment Suction For different dust can adjust the size of the suction. Double Motor Dual motor - ( ground brush and handheld machine ), lift suction size Brush LED Lights Dust is easy to see when you mop the floor. ● Adapt to a variety of ground, also can drag carpet ● Ergonomically designed handle for easy grip ● Putter design, children can also easily use Specification General Brand: ITTAR Cleaner Types: Vacuum Cleaner Type: Handheld Function: Dry Dust Box Capacity: 0.4L Noise (dB): 75dB and less Power (W): 150W Input Voltage (V): 100 - 240V ( 50 / 60HZ ) Charging Time: 4 hours Working Time: about 17 minutes ( upscale ), about 40 minutes ( low ) Battery Information Battery Capacity: 2500mAh Battery Voltage: 21.6V Dimensions and Weight Product weight: 2.8000 kg Package weight: 4.9000 kg Product size (L x W x H): 58.00 x 29.67 x 20.50 cm / 22.83 x 11.68 x 8.07 inches Package size (L x W x H): 59.50 x 31.00 x 22.70 cm / 23.43 x 12.2 x 8.94 inches Package Contents Package Contents: 1 x Wireless Vacuum Cleaner, 2 x Rag, 1 x Water Tank, 1 x Hose, 1 x Flat Suction, 1 x Charging Base, 1 x EU Adapter, 2 x Sponge, 2 x HEPA, 1 x Brush ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet ITTAR RC16BW Handheld Wireless Vacuum Cleaner Suction / Sweeping / Moping - Plum Velvet Guess you like Customer Reviews 0 • 0 • 0 • 0 • 0 • 0 See all 0 reviews Write a Review Get GB Points! Be the FIRST to Write a Review! Customer Qusetions & Answers • All • Product Information • Stock Status • Payment • About Shipping • Others Be the FIRST to Ask a Question. Want GB Points? Just Write a Review! Be the FIRST to Ask a Question. Want GB Points? Just Write a Review! Be the FIRST to Ask a Question. Want GB Points? Just Write a Review! Be the FIRST to Ask a Question. Want GB Points? Just Write a Review! Be the FIRST to Ask a Question. Want GB Points? Just Write a Review! Be the FIRST to Ask a Question. Want GB Points? Just Write a Review! 0 Questions & Answers View All> Sponsored Products Related to This Item Your Recently Viewed Items See personalized recommendations New customer? Start here Pre-sale Service	# air-condition Pronunciation [ air-kuh n-dish-uh n ] / ˈɛər kənˌdɪʃ ən / Verb (used with object) - to furnish with an air-conditioning system. - to treat (air) with such a system. Origin First recorded in 1930–35 British Definition Verb (tr) - to apply air conditioning to --- # ITTAR RC16BW Wireless Vacuum Cleaner Color: Plum Velvet SKU: 431746101 Function: Suction / Sweeping / Moping Price: 215.22 Customer Reviews: 0 --- ## How to Buy Scan the QR code to buy: 1. Download our FREE app on Google Play or App Store. 2. Launch the app and scan the QR code to buy directly. Or via Gearbest.com: 1. Sign in to Gearbest.com 2. Add product(s) to your Cart. 3. Open our app and go to your Cart. 4. Pay for your order for an immediate discount! - FREE SHIPPING - COD supported on delivery (exclude non-COD items). - Shipping window: Oct 28 – Oct 30 (processing may take a few days). - Interest-free installments available. --- ## Description The portable removable vacuum cleaner is ideal for household cleaning. - Can reach under furniture: tilts ~170° and hovers ~20 cm above the ground. - Flexible design: 180° up/down, 90° side-to-side articulation for easy maneuvering. --- ## Main Features - 3-in-1 Cleaning: Suction, sweeping, and mopping simultaneously. - Adjustable Suction: High/low modes for different debris types. - Double Motor: Separate motors for floor brush and handheld unit. - LED Brush Lights: Illuminates dust and debris. - Multi-Surface Use: Suitable for hard floors and carpets. - Ergonomic Handle: Comfortable grip; child-friendly design. --- ## Specifications General - Brand: ITTAR - Type: Handheld dry vacuum cleaner - Dust Box Capacity: 0.4 L - Noise Level: ≤ 75 dB - Power: 150 W - Input Voltage: 100–240 V, 50/60 Hz - Charging Time: 4 hours - Runtime: ~17 min (high), ~40 min (low) Battery - Capacity: 2500 mAh - Voltage: 21.6 V Dimensions & Weight - Product: 58.0 × 29.67 × 20.5 cm / 2.8 kg - Package: 59.5 × 31.0 × 22.7 cm / 4.9 kg --- ## Package Contents - 1 × Wireless Vacuum Cleaner - 2 × Rags - 1 × Water Tank - 1 × Hose - 1 × Flat Suction Nozzle - 1 × Charging Base - 1 × EU Adapter - 2 × Sponges - 2 × HEPA Filters - 1 × Brush --- ## Customer Reviews _No reviews yet._ Be the first to write a review and earn GB Points! --- ## Questions & Answers _No questions yet._ Want GB Points? Ask a question or write a review!	1,383	747	2,860,689,020,687,590,400	concat	[ "concat_full" ]	0.75	true	null
8,853,749,500,518,495,000	FREE DOWNLOAD via Stones Throw: Inspired by reggae, sound system culture and the myriad of musical styles influenced by Jamaican music old and new, The Lions’ sound is firmly placed in soul music. “All the guys in The Lions grew up on classic Jamaican records so since we began we have wanted to give our records that same edge and roughness that we grew up hearing on LPs by The Upsetters, Soul Syndicate, The Rockers Band and Roots Radics. The rhythm section was all recorded to tape, the Hammond buzzed a little, fuses blew and good mistakes were left in. We basically made the dusty reggae soul LP WE have been wanting to hear for years.” – Dan Ubick (producer) The band draws together a dozen or so of LA’s elite reggae and soul forerunners who loosely coalesced as The Lions in 2007. Members of the legendary ska band Hepcat, Deston Berry and Alex Désert, form half of the vocal team, and the latter also has a successful career on screen, including roles in the films Swingers and High Fidelity. The other half is the sweet falsetto of Malik Moore and DJ stylings of Black Shakespeare, the charismatic cousin of Robbie Shakespeare (of Sly & Robbie fame) and co-runner of the i&i Sound System, a customised ice cream van bringing bass to the streets of the west coast and featured on the cover of both Saul Williams’ self-titled album and an issue of XLR8R Magazine. Other members include guitarist Dan Ubick, formerly of Breakestra, Macy Gray co-writer and collaborator Dave Wilder on bass, plus musicians who have played with the likes of De La Soul, Barrington Levy, Beck, Raphael Saadiq, Big Daddy Kane and Black Eyed Peas. Skip to navigation Skip to content ; River Cruise Icon River Cruise A Royal Voyage on the Douro 8 days from £2,999 per person Feel like royalty as you sail along the beautiful Douro Valley aboard the Spirit of Chartwell, the ship that carried Her Majesty the Queen during the Diamond Jubilee. Sail between coastal Porto and the Spanish border, with visits to picturesque towns, monasteries and palaces. Your experience aboard this intimate ship is enhanced with wine tastings, folk shows, cooking demonstrations and informative talks. And on selected autumn departures, we celebrate the famed grape harvest together. 6 included excursions and visits • City tour of Porto with port wine tasting • Lamego excursion including Lamego Museum and tasting • Tour of Castelo Rodrigo with almond tasting • Tour to Salamanca with flamenco show • Mateus Palace and Gardens • Visit Quinta da Aveleda with lunch Including... • 7 nights cruise on the Spirit of Chartwell • Well-appointed and elegantly furnished riverview cabins & robes/slippers • All meals on board, freshly prepared by the onboard chefs using local produce • Complimentary local wine and beer with lunch and dinner • Tea/coffee available 24 hours a day • Titan onboard cocktail party • Excellent service levels and a high ratio of staff members per guest • All entertainment plus a Fado and folk music show • Shore excursions with knowledgeable local guides Plus all these benefits • Titan’s VIP door-to-door travel service • Services of a Titan tour manager • International flights (prices are based on return flights with TAP Portugal from London Gatwick. Supplements may apply from other airports) • Porterage • All airport/port taxes and duties 0 Days 0 Hours 0 Minutes 0 Seconds JF5_map VIP Outbound4 Day 1 - UK - Porto Titan’s VIP door-to-door travel service collects you from home for your flight to Porto. On arrival, we embark Spirit of Chartwell (4T) for a welcome cocktail and captain’s gala dinner. Spirit of Chartwell (4T) Day 2 - Porto - Entre-os-Rios On a city tour, take in the delights of Porto, exploring the UNESCO listed Ribeira district, with its cobbled streets and embellished buildings, and the iconic river scenes of the port cellars and traditional wooden barges used to transport the famous wine. Partake in a tasting of port before we return to the Spirit of Chartwell, for a relaxed afternoon as we sail up the River Douro, taking in views of steep, terraced vineyards. We dock overnight in Entre-os-Rios, and this evening we celebrate vintage port wine. Spirit of Chartwell (4T) Day 3 - Entre-os-Rios - Régua An excursion to the quaint town of Lamego and the grand rococo sanctuary of Nossa Senhora dos Remédios is included this morning. If you choose to walk down the steps of this town’s elaborate shrine, don’t forget to look back to appreciate the tiled artwork. We visit the episcopal palace which now houses Museu de Lamego, a great display of art and Flemish tapestries. We also have the opportunity to sample some local specialities, which complements today’s culinary demonstration on board our vessel. We disembark this evening for dinner at a wine-producing Quinta. Spirit of Chartwell (4T) Day 4 - Régua - Barca d’Alva This afternoon we arrive in Barca d’Alva, close to the Spanish border, where we will be staying for the next two nights. A visit to the medieval hilltop town of Castelo Rodrigo, a peaceful village that still bears the scars of old battles, is included, as well as an almond tasting experience. This evening we’ll enjoy the captain’s dinner and a Fado and folk music show. Spirit of Chartwell (4T) Day 5 - Barca d’Alva - Salamanca - Barca d’Alva We cross the border into Spain for our full-day tour today, visiting the UNESCO-listed city of Salamanca, home to one of Europe’s oldest universities, outstanding examples of Romanesque, Gothic, Moorish and Baroque architecture, two cathedrals, and an impressive main square, the arcade-lined Plaza Mayor. We experience a traditional flamenco show before returning to our ship for a Portuguese barbecue dinner. Spirit of Chartwell (4T) Day 6 - Barca d’Alva - Régua Early this morning we sail down the River Douro, back towards Régua, where we will stay overnight. Relax, enjoy the beautiful scenes of green, vineyard-clad hills and listen as our knowledgeable guest lecturer gives a talk about life in Portugal today. This afternoon there is an included excursion to the 18th century Mateus Palace, a Baroque masterpiece that offers a glimpse of Portuguese aristocracy and is renowned for its delightful gardens, as well as the rosé wine which was first produced here. Spirit of Chartwell (4T) VIP Inbound Day 7 - Régua - Entre-os-Rios - Porto After a relaxing morning on the Douro, we disembark in Entre-os-Rios for a leisurely lunch at the Quinta da Aveleda. Aveleda has been managed by the same family since 1870, and had already started winning international awards by 1888. The historic estate has been in the family even longer, and is the perfect place to enjoy lunch, in a delightful setting of exotic flora and endless vineyards, with an unusual addition of a goat tower. We return to Spirit of Chartwell to continue navigating the twists of the river. Tonight, we bid a fond farewell to Portugal with a sunset cruise in Porto harbour. Spirit of Chartwell (4T) Day 8 Porto - UK Transfer to the airport for your return flight to the UK. Upon arrival your Titan vehicle will be waiting for the journey home. Arrive Home View Full Itinerary Important information about your destination Please note: • This tour is not suitable for anyone with walking difficulties. Customers are advised that there are challenging steps on the Spirit of Chartwell. • The order of onboard activities is subject to change. • 11 September 2020 departure celebrates the grape harvest - inclusions and the order of overnight ports may vary - please call for details. A Royal Voyage on the Douro 8 days from £2,999) per person	Inspired by reggae, sound system culture and the myriad of musical styles influenced by Jamaican music old and new, The Lions’ sound is firmly placed in soul music. > “All the guys in The Lions grew up on classic Jamaican records so since we began we have wanted to give our records that same edge and roughness that we grew up hearing on LPs by The Upsetters, Soul Syndicate, The Rockers Band and Roots Radics. The rhythm section was all recorded to tape, the Hammond buzzed a little, fuses blew and good mistakes were left in. We basically made the dusty reggae soul LP WE have been wanting to hear for years.” > – Dan Ubick (producer) The band draws together a dozen or so of LA’s elite reggae and soul forerunners who loosely coalesced as The Lions in 2007. Members of the legendary ska band Hepcat, Deston Berry and Alex Désert, form half of the vocal team, and the latter also has a successful on-screen career, including roles in the films Swingers and High Fidelity. The other half is the sweet falsetto of Malik Moore and the DJ stylings of Black Shakespeare, the charismatic cousin of Robbie Shakespeare (of Sly & Robbie fame) and co-runner of the i&i Sound System, a customised ice cream van bringing bass to the streets of the West Coast and featured on the cover of both Saul Williams’ self-titled album and an issue of XLR8R Magazine. Other members include: - Dan Ubick (guitarist, formerly of Breakestra) - Dave Wilder (bass; Macy Gray co-writer and collaborator) - Musicians who have played with De La Soul, Barrington Levy, Beck, Raphael Saadiq, Big Daddy Kane, and Black Eyed Peas. --- # River Cruise: A Royal Voyage on the Douro 8 days from £2,999 per person Feel like royalty as you sail along the beautiful Douro Valley aboard the Spirit of Chartwell, the ship that carried Her Majesty the Queen during the Diamond Jubilee. Sail between coastal Porto and the Spanish border, with visits to picturesque towns, monasteries and palaces. Your experience aboard this intimate ship is enhanced with wine tastings, folk shows, cooking demonstrations and informative talks. And on selected autumn departures, we celebrate the famed grape harvest together. --- ## 6 included excursions and visits • City tour of Porto with port wine tasting • Lamego excursion including Lamego Museum and tasting • Tour of Castelo Rodrigo with almond tasting • Tour to Salamanca with flamenco show • Mateus Palace and Gardens • Visit Quinta da Aveleda with lunch --- ## Including... • 7 nights cruise on the Spirit of Chartwell • Well-appointed and elegantly furnished riverview cabins & robes/slippers • All meals on board, freshly prepared by the onboard chefs using local produce • Complimentary local wine and beer with lunch and dinner • Tea/coffee available 24 hours a day • Titan onboard cocktail party • Excellent service levels and a high ratio of staff members per guest • All entertainment plus a Fado and folk music show • Shore excursions with knowledgeable local guides --- ## Plus all these benefits • Titan’s VIP door-to-door travel service • Services of a Titan tour manager • International flights (prices are based on return flights with TAP Portugal from London Gatwick. Supplements may apply from other airports) • Porterage • All airport/port taxes and duties --- ## Itinerary ### Day 1 – UK → Porto Titan’s VIP door-to-door travel service collects you from home for your flight to Porto. On arrival, we embark Spirit of Chartwell (4T) for a welcome cocktail and captain’s gala dinner. ### Day 2 – Porto → Entre-os-Rios On a city tour, take in the delights of Porto, exploring the UNESCO listed Ribeira district, with its cobbled streets and embellished buildings, and the iconic river scenes of the port cellars and traditional wooden barges used to transport the famous wine. Partake in a tasting of port before we return to the Spirit of Chartwell, for a relaxed afternoon as we sail up the River Douro, taking in views of steep, terraced vineyards. We dock overnight in Entre-os-Rios, and this evening we celebrate vintage port wine. ### Day 3 – Entre-os-Rios → Régua An excursion to the quaint town of Lamego and the grand rococo sanctuary of Nossa Senhora dos Remédios is included this morning. If you choose to walk down the steps of this town’s elaborate shrine, don’t forget to look back to appreciate the tiled artwork. We visit the episcopal palace which now houses Museu de Lamego, a great display of art and Flemish tapestries. We also have the opportunity to sample some local specialities, which complements today’s culinary demonstration on board our vessel. We disembark this evening for dinner at a wine-producing Quinta. ### Day 4 – Régua → Barca d’Alva This afternoon we arrive in Barca d’Alva, close to the Spanish border, where we will be staying for the next two nights. A visit to the medieval hilltop town of Castelo Rodrigo, a peaceful village that still bears the scars of old battles, is included, as well as an almond tasting experience. This evening we’ll enjoy the captain’s dinner and a Fado and folk music show. ### Day 5 – Barca d’Alva → Salamanca → Barca d’Alva We cross the border into Spain for our full-day tour today, visiting the UNESCO-listed city of Salamanca, home to one of Europe’s oldest universities, outstanding examples of Romanesque, Gothic, Moorish and Baroque architecture, two cathedrals, and an impressive main square, the arcade-lined Plaza Mayor. We experience a traditional flamenco show before returning to our ship for a Portuguese barbecue dinner. ### Day 6 – Barca d’Alva → Régua Early this morning we sail down the River Douro, back towards Régua, where we will stay overnight. Relax, enjoy the beautiful scenes of green, vineyard-clad hills and listen as our knowledgeable guest lecturer gives a talk about life in Portugal today. This afternoon there is an included excursion to the 18th century Mateus Palace, a Baroque masterpiece that offers a glimpse of Portuguese aristocracy and is renowned for its delightful gardens, as well as the rosé wine which was first produced here. ### Day 7 – Régua → Entre-os-Rios → Porto After a relaxing morning on the Douro, we disembark in Entre-os-Rios for a leisurely lunch at the Quinta da Aveleda. Aveleda has been managed by the same family since 1870, and had already started winning international awards by 1888. The historic estate has been in the family even longer, and is the perfect place to enjoy lunch, in a delightful setting of exotic flora and endless vineyards, with an unusual addition of a goat tower. We return to Spirit of Chartwell to continue navigating the twists of the river. Tonight, we bid a fond farewell to Portugal with a sunset cruise in Porto harbour. ### Day 8 – Porto → UK Transfer to the airport for your return flight to the UK. Upon arrival your Titan vehicle will be waiting for the journey home. _Arrive Home_ --- ## Important information about your destination • This tour is not suitable for anyone with walking difficulties. Customers are advised that there are challenging steps on the Spirit of Chartwell. • The order of onboard activities is subject to change. • 11 September 2020 departure celebrates the grape harvest – inclusions and the order of overnight ports may vary – please call for details.	1,682	1,610	8,853,749,500,518,495,000	concat	[ "concat_full" ]	0.75	true	null
6,182,571,900,575,973,000	Preview Image Qty: 1 loading... Kerli Cashmere Sweater $395.00 Color: Skyrim Skyrim Product Code: FWKW01048_Skyrim Related Products • Reviews • No Reviews for "Kerli Cashmere Sweater" You must be logged in to write a product review. Log In J Lindeberg Kerli Cashmere Sweater Product image Luxurious cashmere crew neck sweater. It has a straight fit and a slightly dropped shoulder for a modern and relaxed look. The fine cashmere is softer than wool and only gets softer with time if you exclusively hand wash it with a delicate detergent. - Mid-weight cashmere - Crew neck - Slightly dropped shoulder seam - Straight fit - The model is 174cm/5'7 and wears a size S FWKW01048_Skyrim 395.00 J. Lindeberg New http://schema.org/InStock © 2019 J. Lindeberg USA, LLC https://cdn.kwi.com jlindeberg Follow Us Menu Log in Log in Warning: browser cookies disabled. Please enable them to use this website. Event Summer Camp: Outdoor Art Adventures 08/05/2019 9:00 AM - 08/09/2019 3:00 PM Location: Flag Ponds Nature Park Event registration disabled Event registration is currently unavailable. Please contact site administrator. Powered by Wild Apricot Membership Software	# Kerli Cashmere Sweater ![Product Image](https://cdn.kwi.com) Price: $395.00 Color: Skyrim Product Code: FWKW01048_Skyrim Availability: In Stock Luxurious cashmere crew neck sweater. It has a straight fit and a slightly dropped shoulder for a modern and relaxed look. The fine cashmere is softer than wool and only gets softer with time if you exclusively hand wash it with a delicate detergent. Features: - Mid-weight cashmere - Crew neck - Slightly dropped shoulder seam - Straight fit - Model is 174 cm (5'7") and wears a size S © 2019 J. Lindeberg USA, LLC --- ## Summer Camp: Outdoor Art Adventures 08/05/2019 9:00 AM – 08/09/2019 3:00 PM Location: Flag Ponds Nature Park Event registration disabled Event registration is currently unavailable. Please contact site administrator.	311	217	6,182,571,900,575,973,000	concat	[ "concat_full" ]	0.75	true	null
3,430,776,395,697,237,000	Meghan Markle’s on-screen dad shades her real father Meghan Markle‘s father, Thomas Markle, can’t seem to stop running his mouth to the media about the Duchess of Sussex, but the actor who played her father on “Suits” demonstrated quite a bit more discretion. “If you care about Meghan, the Duchess of Sussex, then that should be the first and foremost in your mind before you say anything,” “Suits” actor Wendell Pierce told the UK’s Telegraph. “If you love your daughter, just love your daughter. It’s not for public consumption.” Pierce was one of the few “Suits” stars who didn’t attend Meghan’s wedding to Prince Harry, but he reminisced about a sweet moment he shared with Meghan when they were filming her on-screen wedding for the series. “We had a moment I cherish,” said the 54-year-old, who played Robert Zane. “I was sitting with Meghan in her wedding dress, as we waited for a set-up. We were alone. I said to her, ‘Your life is going to change. It’s going to be amazing and I’m very happy for you, but I want you to know that I’m your friend, and no matter where you are or what’s going on — if the fishbowl that you’re in ever starts getting to you — you can call me.’ ” Thomas claims he hasn’t spoken to Meghan, 37, since he was busted for staging paparazzi photos ahead of her wedding in May — which he missed due to a reported heart attack. Last week, Thomas compared the secrecy of Kensington Palace to that of the Church of Scientology. He previously claimed that Meghan was “faking her smile” in public outings with the royal family and admitted to hanging up on Harry when the ginger prince reportedly warned him that the press would “eat him alive.” Thomas then lamented that he has no way of getting in touch with Meghan and that she changed her phone number. Filed under Most Popular This Week Get a free estimate for New Construction project. right arrow Get your free estimate now NEW JERSEY POOL DIGGING AND FILLING Are you considering creating the perfect backyard to have a staycation in? New Jersey General Contractors & Builders offers experienced pool digging and filling services at affordable rates. We’ve built a solid reputation as a team of excavation specialists in Moonachie who can provide the high quality pool services suited to each client’s needs. New Jersey General Contractors & Builders Pool Digging and Filling Little Ferry pool digging and filling Are you considering creating the perfect backyard to have a staycation in? New Jersey General Contractors & Builders offers experienced pool digging and filling services at affordable rates. We’ve built a solid reputation as a team of excavation specialists in Little Ferry who can provide the high quality pool services suited to each client’s needs. Expert installation or removal of inground and above ground pools Whether you’re planning to install an in-ground or above-ground pool, consult a New Jersey General Contractors & Builders professional before you start digging for a complete evaluation of your property and to prevent any hazards or unnecessary delays. Getting the ground ready for your pool installation is subject to specific codes and regulations in Little Ferry. New Jersey General Contractors & Builders professionally evaluates your property to avoid any potential problems down the road. Our licensed and insured team of excavators ensures you will soon be enjoying a swim in your own pool following our thorough planning. A complete range of services Whether you need excavation for a new pool or want to remove and old one and restore your property, contact a New Jersey General Contractors & Builders staff member for information about any of the following: • - Layout plans on your property for in ground, or above ground pools • - Ground levelling before installation, or after pool filling • - Pool removal and landscape restoration • - Property clearing and clean-up New Jersey General Contractors & Builders is recognized as a dependable and efficient Little Ferry excavator who can provide the pool digging and filing services for safe pool installation or pool removal. Call us at 732.731.9775 for information and a free estimate. New Jersey General Contractors & Builders provides consultation for: • - Appropriate pool sizing and location • - Professional assessment of underground and overhead utility lines • - Land surveying and ground levelling Our installation checklist includes every logistical concern and was created over years of successful pool digging and filling projects. Our staff can also discuss the most cost effective solutions and offer helpful advice for your pool in the Little Ferry area.	# Meghan Markle’s on-screen dad shades her real father Meghan Markle’s father, Thomas Markle, can’t seem to stop running his mouth to the media about the Duchess of Sussex, but the actor who played her father on Suits demonstrated quite a bit more discretion. > “If you care about Meghan, the Duchess of Sussex, then that should be the first and foremost in your mind before you say anything,” Suits actor Wendell Pierce told the UK’s Telegraph. > “If you love your daughter, just love your daughter. It’s not for public consumption.” Pierce was one of the few Suits stars who didn’t attend Meghan’s wedding to Prince Harry, but he reminisced about a sweet moment he shared with Meghan when they were filming her on-screen wedding for the series: > “We had a moment I cherish,” said the 54-year-old, who played Robert Zane. > “I was sitting with Meghan in her wedding dress, as we waited for a set-up. We were alone. I said to her, ‘Your life is going to change. It’s going to be amazing and I’m very happy for you, but I want you to know that I’m your friend, and no matter where you are or what’s going on — if the fishbowl that you’re in ever starts getting to you — you can call me.’” Thomas claims he hasn’t spoken to Meghan, 37, since he was busted for staging paparazzi photos ahead of her wedding in May — which he missed due to a reported heart attack. Last week, he compared the secrecy of Kensington Palace to that of the Church of Scientology. He previously claimed that Meghan was “faking her smile” in public outings with the royal family and admitted to hanging up on Harry when the prince warned him that the press would “eat him alive.” Thomas then lamented that he has no way of getting in touch with Meghan and that she changed her phone number. --- # New Jersey Pool Digging and Filling Are you considering creating the perfect backyard staycation? New Jersey General Contractors & Builders offers experienced pool digging and filling services at affordable rates. We’re a team of licensed and insured excavation specialists in Little Ferry who provide high-quality pool services tailored to your needs. --- ## Expert Installation or Removal Whether you’re planning to install an in-ground or above-ground pool, consult a New Jersey General Contractors & Builders professional before you start digging. We’ll: - Evaluate your property for hazards or delays - Ensure compliance with Little Ferry codes and regulations - Professionally plan every step so you can be swimming in no time --- ## Our Services - Layout plans for in-ground or above-ground pools - Ground leveling before installation or after pool filling - Pool removal and landscape restoration - Property clearing and clean-up --- ## Consultation We provide expert guidance on: - Appropriate pool sizing and location - Assessment of underground and overhead utility lines - Land surveying and ground leveling --- Call us at 732.731.9775 for information and a free estimate.	932	635	3,430,776,395,697,237,000	concat	[ "concat_full" ]	0.75	true	null
-4,159,200,089,715,534,300	Subversion Repositories nw_plus Rev Go to most recent revision \| Show changed files \| Directory listing \| RSS feed Filtering Options Rev Age Author Path Log message Diff 67 2637d 14h h266 /nwinter/ Split highres assets into "nw_hrp/" directory, allowing for easy detachment for those who do not want the HRP. 65 2670d 9h h266 /nwinter/ Add voxels of the gift boxes (3782, 3786) thanks to ReaperMan. 64 2765d 15h h266 /nwinter/ Fix inconsistencies noticed by LeoD using his script. 61 2779d 11h h266 /nwinter/ fix a warning: 3281.jpg --> 3281.png 54 3007d 15h h266 /nwinter/ Add Santa overhead frames by Captain Awesome. Currently unimplemented due to lack of capability. 53 3007d 15h h266 /nwinter/ newly remade edit of the Gremlins theme based on a lossless source rather than an MP3 source 44 3032d 6h h266 /nwinter/ add (currently unused) widescreen images for 2492, 3240/3245 35 3045d 8h h266 /nwinter/ The batch file will now try to update the SVN repository after EDuke32 is launched, if applicable. Remove 757 pal 24 def error. 30 3047d 13h h266 /nwinter/ add level summaries to NWINTRO.TXT add correct enemy name notation to data batch updates: utilize pushd/popd improve checksumming add support for demo GRP not causing an infinite loop 26 3052d 3h h266 /nwinter/ map patch update Polymer Police: 3726, 3739-3741 ("Polymer Police" means I have gone through the list of tiles which are variations on normal HRP tiles, and any tile numbers listed means I have found new work done on the upstream tile, which I have then replicated on the add-on tile.) 25 3131d 9h h266 /nwinter/ all references to default HRP audited and updated fix loading of XXX data Polymer "versions" of crates added slight tweak to NW1 20 3137d 6h h266 /nwinter/ map bugfix music improvements, mainly for ease of use of Shift+F5 18 3148d 10h h266 /nwinter/ wrapper .bat files now only set environment variable flags and do not pass any parameters themselves Mapster32 .bat code merged into main .bat (wrapper .bat still exists) all grunt work merged into main launcher massive improvements on the loading of hrp.duke4.net files in the root directory polymer_hrp\ subdirectory automatically included along with .zip files add STAYPUT elves to zoo re-add white 8-bit digitalnum, but don't undefine hightile 13 3150d 12h h266 /nwinter/ batch file improvements: Running the debug .bat now launches the debug EDuke32. Very smart detection of EDuke32, NW+, and NWHRP directories. Mapster32 launcher brought up to par with EDuke32 launcher's new features. 11 3151d 6h h266 /nwinter/ #3714 skybox fix attempt zoo improvements 10 3151d 7h h266 /nwinter/ Make it easier for users to disable and remove the HRP components. (Split nwinter_hrp.def into itself for HRP components (screen, skyboxes, sprites, and textures) and nw_plus.def for everything else.) 8 3154d 12h h266 /nwinter/ Appearance of final boss in NWL7 fixed. Snow Commander now shoots freezeblasts more rapidly. When the player is frozen, it will now approach and spin, which will now break the ice. The Santa skin now works on HoloDukes and the shrinking/steroids blur effect. Chandelier (#3778) now breakable. Old HRP redfont commented out. Santa shoots the player's RPGs now, not the Commander's. NWL7 map improvements 4 3191d 10h h266 /nwinter/ Added Mapster32+DP batch file. Edited docs. 3 3191d 16h h266 /nwinter/ Add NW beta art recovered from Deadly Kiss data dump to extra/, just for fun. Update docs. 2 3193d 10h h266 /nwinter/ Ignoring Thumbs.db. Show All Home> Wiley College Director Of Intercultural Affairs Salary Wiley College Director Of Intercultural Affairs Salary • 57 • 19 • 11 Wiley College Director Of Intercultural Affairs average salary is $28,000, median salary is $28,000 with a salary range from $28,000 to $28,000. Wiley College Director Of Intercultural Affairs salaries are collected from government agencies and companies. Each salary is associated with a real job position. Wiley College Director Of Intercultural Affairs salary statistics is not exclusive and is for reference only. They are presented "as is" and updated regularly. Total 2 Wiley College Salaries. Sorted by Salary, page 1 Ranked By: Jobtitle Company Salary City Year Director Of Intercultural Affairs Wiley College $ 28,000 Marshall, TX, 75670 03/01/2013 Director Of Intercultural Affairs Wiley College $ 28,000 Marshall, TX, 75670 05/13/2013 Calculate how much you could earn It's FREE. Based on your input and our analysis. How we do it? All fields are required for calculation accuracy. • We will send you an email to access your personalized report. • We won’t share your email address Wiley College Director Of Intercultural Affairs salary is full-time annual starting salary. Intern, contractor and hourly pay scale vary from regular exempt employee. Compensation depends on work experience, job location, bonus, benefits and other factors. Real Jobs Salary - Salary List Calculate Your Salary Ranking Wiley College Director Of I... Jobs Executive Director of Development, Shidler College of Business University of Hawaii Foundation - Honolulu, HI Associate Director of Alumni Programs and Annual Fund Reed College - Portland, OR Director of Accounting CHCP : The College of Health Care Professions - Houston, TX Assistant Director of Financial Aid Jarvis Christian College - Hawkins, TX See more Wiley College Director Of Intercultural Affairs Jobs» Search All Jobs JobCompare – Find open jobs faster	# Subversion Repositories: `nw_plus` ## Revisions - Rev 67 (2637d 14h) by h266 in `/nwinter/` Split highres assets into `nw_hrp/` directory, allowing for easy detachment for those who do not want the HRP. - Rev 65 (2670d 9h) by h266 in `/nwinter/` Add voxels of the gift boxes (3782, 3786) thanks to ReaperMan. - Rev 64 (2765d 15h) by h266 in `/nwinter/` Fix inconsistencies noticed by LeoD using his script. - Rev 61 (2779d 11h) by h266 in `/nwinter/` fix a warning: 3281.jpg → 3281.png - Rev 54 (3007d 15h) by h266 in `/nwinter/` Add Santa overhead frames by Captain Awesome. Currently unimplemented due to lack of capability. - Rev 53 (3007d 15h) by h266 in `/nwinter/` newly remade edit of the Gremlins theme based on a lossless source rather than an MP3 source - Rev 44 (3032d 6h) by h266 in `/nwinter/` add (currently unused) widescreen images for 2492, 3240/3245 - Rev 35 (3045d 8h) by h266 in `/nwinter/` - The batch file will now try to update the SVN repository after EDuke32 is launched, if applicable. - Remove 757 pal 24 def error. - Rev 30 (3047d 13h) by h266 in `/nwinter/` - add level summaries to `NWINTRO.TXT` - add correct enemy name notation to data - batch updates: - utilize pushd/popd - improve checksumming - add support for demo GRP not causing an infinite loop - Rev 26 (3052d 3h) by h266 in `/nwinter/` map patch update Polymer Police: 3726, 3739-3741 (“Polymer Police” means I have gone through the list of tiles which are variations on normal HRP tiles, and any tile numbers listed means I have found new work done on the upstream tile, which I have then replicated on the add-on tile.) - Rev 25 (3131d 9h) by h266 in `/nwinter/` - all references to default HRP audited and updated - fix loading of XXX data - Polymer “versions” of crates added - slight tweak to NW1 - Rev 20 (3137d 6h) by h266 in `/nwinter/` map bugfix music improvements, mainly for ease of use of Shift+F5 - Rev 18 (3148d 10h) by h266 in `/nwinter/` - wrapper `.bat` files now only set environment variable flags and do not pass any parameters themselves - Mapster32 `.bat` code merged into main `.bat` (wrapper `.bat` still exists) - all grunt work merged into main launcher - massive improvements on the loading of `hrp.duke4.net` files in the root directory - `polymer_hrp\` subdirectory automatically included along with `.zip` files - add STAYPUT elves to zoo - re-add white 8-bit digitalnum, but don’t undefine hightile - Rev 13 (3150d 12h) by h266 in `/nwinter/` batch file improvements: - Running the debug `.bat` now launches the debug EDuke32. - Very smart detection of EDuke32, NW+, and NWHRP directories. - Mapster32 launcher brought up to par with EDuke32 launcher’s new features. - Rev 11 (3151d 6h) by h266 in `/nwinter/` #3714 skybox fix attempt zoo improvements - Rev 10 (3151d 7h) by h266 in `/nwinter/` Make it easier for users to disable and remove the HRP components. (Split `nwinter_hrp.def` into itself for HRP components and `nw_plus.def` for everything else.) - Rev 8 (3154d 12h) by h266 in `/nwinter/` - Appearance of final boss in NWL7 fixed. - Snow Commander now shoots freezeblasts more rapidly. When the player is frozen, it will now approach and spin, which will now break the ice. - The Santa skin now works on HoloDukes and the shrinking/steroids blur effect. - Chandelier (#3778) now breakable. - Old HRP redfont commented out. - Santa shoots the player’s RPGs now, not the Commander’s. - NWL7 map improvements - Rev 4 (3191d 10h) by h266 in `/nwinter/` Added Mapster32+DP batch file. Edited docs. - Rev 3 (3191d 16h) by h266 in `/nwinter/` Add NW beta art recovered from Deadly Kiss data dump to `extra/`, just for fun. Update docs. - Rev 2 (3193d 10h) by h266 in `/nwinter/` Ignoring Thumbs.db. --- # Wiley College Director Of Intercultural Affairs Salary Average salary: $28,000 Median salary: $28,000 Range: $28,000 – $28,000 > Salaries are collected from government agencies and companies. Each entry reflects a real job position. Data are presented “as is” and updated regularly. ## Reported Salaries (Total: 2) \| Job Title \| Company \| Salary \| Location \| Date \| \|-----------------------------------\|---------------\|---------\|------------------------\|------------\| \| Director Of Intercultural Affairs \| Wiley College \| $28,000 \| Marshall, TX 75670 \| 03/01/2013 \| \| Director Of Intercultural Affairs \| Wiley College \| $28,000 \| Marshall, TX 75670 \| 05/13/2013 \| > Note: Reported salaries assume a full-time annual starting salary. Intern, contractor, and hourly rates may vary. Total compensation depends on experience, location, bonuses, benefits, and other factors.	1,439	1,467	-4,159,200,089,715,534,300	concat	[ "concat_full" ]	0.75	true	null
1,038,677,487,064,833,500	WATCH NOW Trailer Acapulco H.E.A.T. 28 September 1993 5.9 Action & Adventure Acapulco H.E.A.T. is a 1993 syndicated television series that followed the Hemisphere Emergency Action Team [H.E.A.T.], a group of top-secret agents based in Acapulco, Mexico and recruited by C-5, a secret government coalition, to fight terrorism and international crime. The team kept a low profile, by acting as models and photographers who represented a Beach Fashion enterprise. Actors: Alison Armitage \| Michael Worth \| Christa Sauls \| Directors: Producted By : Centre National de la Cinématographie, M6 Films, Centre National de la Cinématographie (CNC), Type: Free Trial: HD 4K AD Stream over 800,000 titles with Prime Video 30-day Free Trial, cancel anytime Start 30-day Free Trial Cast List Similar TV Shows Skip navigation CLN bookstore × You have 2 more free articles available this month. Subscribe today. Florida Cop Found Guilty of Killing Stranded Driver, a First in 30 Years in State In a history-making decision, jurors in West Palm Beach, Florida, found Nouman Raja guilty of manslaughter with a firearm and first-degree attempted murder—the first time in three decades a Florida cop has been convicted in a civilian’s death while on duty. The fired Palm Beach Gardens police officer faces a mandatory minimum sentence of 25 years and up to life in prison. With this conviction, Raja is in a unique category since police are rarely convicted and imprisoned in fatal slayings. “Each year, about 1,000 police shootings result in fatalities,” criminologist Philip Stinson of Bowling Green State University told governing.com. “But in the 12 years between 2005 and 2017, just 82 police officers were charged with murder or manslaughter for an on-duty shooting—and only 28 of them were convicted.” “The National Police Misconduct Reporting Project analyzed 3,238 criminal cases against police officers from April 2009 through December 2010,” vox.com reports in November 2018. “They found that only 33 percent were convicted, and 36 percent of officers who were convicted ended up serving prison sentences. Both of those are about half the rate at which members of the public are convicted or incarcerated.” A relative of Jones told a reporter that “the sweetest sound was the click of those handcuffs” after Raja was led away after the verdict on March 5, 2019. Raja, 41, who is of Pakistani descent, was found guilty of fatally shooting stranded motorist Corey Jones, 31, an African-American, on October 18, 2015. Jones was en route home after a performance with his reggae band when his SUV stalled, leaving him on the shoulder of an I-95 exit ramp after 3:15 a.m. and on the phone with a tow-truck dispatcher. Raja, a plainclothes officer investigating car burglaries, pulled his unmarked van up to Jones’ SUV after driving the wrong way up the ramp. He did not identify himself when he confronted Raja, the phone recording reveals. Raja’s attorneys, however, argued the cop did identify himself and shot in self-defense. Jones, who was carrying a new $10,000 drum set, might have feared he was being robbed. He grabbed his legally purchased handgun and ran down an embankment. Raja fired his weapon six times, striking Jones’ heart and each arm. When the officer called 911, “he acted as if he had not yet fired the shots that killed Corey Jones,” The Palm Beach Post reports. “He ‘lied,’” a State Attorney’s Office report reveals. The verdict capped a hearing highlighted by a “chilling animation” of the incident, video and audio recordings, testimony that the cop violated police procedure, and the defense arguing that Raja was protected under Florida’s Stand Your Ground Law. “This did something that our country usually doesn’t believe in doing: holding police officers accountable,” Tifanny Burks, an organizer with Black Lives Matter Alliance Broward, told the Post. “This verdict is a vindication of the good man that was Corey Jones, and an utter repudiation of a criminal who tried to hide behind a badge,” begins a statement from the Jones family legal team. --- Sources: palmbeachpost.com, miamiherald.com, vox.com, cbsnews.com As a digital subscriber to Criminal Legal News, you can access full text and downloads for this and other premium content. Subscribe today Already a subscriber? Login Advertise here Prisoner Education Guide side Federal Prison Handbook	# Acapulco H.E.A.T. 28 September 1993 • 5.9 • Action & Adventure Acapulco H.E.A.T. is a 1993 syndicated television series that followed the Hemisphere Emergency Action Team [H.E.A.T.], a group of top-secret agents based in Acapulco, Mexico and recruited by C-5, a secret government coalition, to fight terrorism and international crime. The team kept a low profile, by acting as models and photographers who represented a Beach Fashion enterprise. Actors - Alison Armitage - Michael Worth - Christa Sauls Producted By - Centre National de la Cinématographie - M6 Films - Centre National de la Cinématographie (CNC) --- # Florida Cop Found Guilty of Killing Stranded Driver, a First in 30 Years in State In a history-making decision, jurors in West Palm Beach, Florida, found Nouman Raja guilty of manslaughter with a firearm and first-degree attempted murder—the first time in three decades a Florida cop has been convicted in a civilian’s death while on duty. The fired Palm Beach Gardens police officer faces a mandatory minimum sentence of 25 years and up to life in prison. With this conviction, Raja is in a unique category since police are rarely convicted and imprisoned in fatal slayings. “Each year, about 1,000 police shootings result in fatalities,” criminologist Philip Stinson of Bowling Green State University told governing.com. “But in the 12 years between 2005 and 2017, just 82 police officers were charged with murder or manslaughter for an on-duty shooting—and only 28 of them were convicted.” “The National Police Misconduct Reporting Project analyzed 3,238 criminal cases against police officers from April 2009 through December 2010,” vox.com reports in November 2018. “They found that only 33 percent were convicted, and 36 percent of officers who were convicted ended up serving prison sentences. Both of those are about half the rate at which members of the public are convicted or incarcerated.” A relative of Jones told a reporter that “the sweetest sound was the click of those handcuffs” after Raja was led away after the verdict on March 5, 2019. Raja, 41, who is of Pakistani descent, was found guilty of fatally shooting stranded motorist Corey Jones, 31, an African-American, on October 18, 2015. Jones was en route home after a performance with his reggae band when his SUV stalled, leaving him on the shoulder of an I-95 exit ramp after 3:15 a.m. and on the phone with a tow-truck dispatcher. Raja, a plainclothes officer investigating car burglaries, pulled his unmarked van up to Jones’ SUV after driving the wrong way up the ramp. He did not identify himself when he confronted Raja, the phone recording reveals. Raja’s attorneys, however, argued the cop did identify himself and shot in self-defense. Jones, who was carrying a new $10,000 drum set, might have feared he was being robbed. He grabbed his legally purchased handgun and ran down an embankment. Raja fired his weapon six times, striking Jones’ heart and each arm. When the officer called 911, “he acted as if he had not yet fired the shots that killed Corey Jones,” The Palm Beach Post reports. “He ‘lied,’” a State Attorney’s Office report reveals. The verdict capped a hearing highlighted by a “chilling animation” of the incident, video and audio recordings, testimony that the cop violated police procedure, and the defense arguing that Raja was protected under Florida’s Stand Your Ground Law. “This did something that our country usually doesn’t believe in doing: holding police officers accountable,” Tifanny Burks, an organizer with Black Lives Matter Alliance Broward, told the Post. “This verdict is a vindication of the good man that was Corey Jones, and an utter repudiation of a criminal who tried to hide behind a badge,” begins a statement from the Jones family legal team. --- Sources: - palmbeachpost.com - miamiherald.com - vox.com - cbsnews.com	985	877	1,038,677,487,064,833,500	concat	[ "concat_full" ]	0.75	true	null
2,603,346,857,354,849,300	Diamond Halo Engagement Ring Setting • $2,250.00 Unit price per • Halo and diamond band engagement ring setting. • 18 Karat Gold. • Setting contains .70 carats of diamonds. • Available in white gold, rose gold, or yellow gold. • Sold as setting ONLY, does not include center diamond. • This item is sizable, please enter ring size when ordering. • This item is available for any size & shape stone. Please enter the following stone specifications if you are ordering this setting for a center stone you already have: Stone size and shape. • Products may take anywhere from 2-6 weeks for delivery. Jun 18, 2010 MERCK LTD- MNC hunters and Mumbai based Portfolio Managers to start pilling up MERCK LTD. Is an pharmaceutical MNC Giant. Our reliable sources gave a hint that some prominent Portfolio Managers and MNC hunters based in Mumbai are going to start piling up this counter. More than 20% upside is likely in near future. For detailed view of MEGHA INVESTMENTS AND RESEARCH team, please visit soon. Posted on Friday, June 18, 2010 \| Categories:	# Diamond Halo Engagement Ring Setting - Price: $2,250.00 - Halo and diamond band engagement ring setting - 18 Karat Gold - Setting contains .70 carats of diamonds - Available in white gold, rose gold, or yellow gold - Sold as setting ONLY; does not include center diamond - This item is sizable—please enter ring size when ordering - Available for any size & shape stone. Please enter the following stone specifications if you are ordering this setting for a center stone you already have: stone size and shape - Products may take anywhere from 2–6 weeks for delivery --- # MERCK LTD- MNC hunters and Mumbai based Portfolio Managers to start pilling up MERCK LTD. Is an pharmaceutical MNC Giant. Our reliable sources gave a hint that some prominent Portfolio Managers and MNC hunters based in Mumbai are going to start piling up this counter. More than 20% upside is likely in near future. For detailed view of MEGHA INVESTMENTS AND RESEARCH team, please visit soon.	245	221	2,603,346,857,354,849,300	concat	[ "concat_full" ]	0.75	true	null
1,520,643,862,974,312,200	Delta Air Lines is shutting down regional-airline subsidiary Comair, Inc. as of September 30, with Comair operating its last flights on September 29. Delta Air Lines is shutting down regional-airline subsidiary Comair, Inc. as of September 30, with Comair operating its last flights on September 29. Don Bornhorst, senior vice president of Delta Connection, broke the news to the managers and directors of Delta Air Lines in a July 27 memo. Delta Connection carriers such as Comair, ExpressJet and Pinnacle Airlines operate hundreds of 50-seat Bombardier CRJ100s and CRJ200s. Also in Delta Connection service are the CRJ440, a 44-seat version of the CRJ200. Delta wants to stop flying most of these smaller regional jets on its network as high fuel prices have made them uneconomical to operate “While regional flying has and will remain a key component of Delta’s network, customer expectations and the unit costs of regional flying have evolved,” Bornhorst wrote. Bornhorst continued: “In response, Delta recently announced its plans to reduce the total number of regional jets in its network while adding more mainline flying. This includes reducing the number of 50-seat regional jets from nearly 350 aircraft to 125 or fewer in the upcoming years. As a result of this reduction and changes to its customer-focused business strategy, Delta has made the difficult decision to cease Comair’s operations.” Ryan Gumm, president of Comair, wrote to to Comair’s employees telling them of Delta’s decision. In his memo to the employees, Gumm wrote: “Delta recently announced its intent to reduce the overall number of 50-seat regional jets in its network from nearly 350 to 125 or fewer in light of the significant changes in the economic and competitive conditions in the airline industry. “We believed this announcement would have a negative impact on Comair because we operate some of the oldest 50-seat aircraft in the Delta Connection fleet, which also have the highest unit cost per flight hour. In addition to operating 50-seat Bombardier CRJ100s and CRJ200s, Delta Air Lines subsidiary Comair has been flying 15 65-seat CRJ700s and 13 76-seat CRJ900s “And, in fact, Delta has decided to remove the remaining 16 Comair 50-seaters from the Delta network, leaving Comair with only 28 aircraft in scheduled service. “This further reduction of Comair’s active fleet will only create higher unit costs, which equates to a business model that is no longer sustainable in this competitive regional environment.” Gumm’s memo also said Delta would be making assistance available to Comair employees, but did not indicate how many would retain jobs within Delta or how many staff might be laid off. Delta Air Lines did not immediately indicate what would happen to Comair’s 50-seat Bombardier CRJ200 regional jets or if another Delta Connection airline would take over Comair’s 65-seat Bombardier CRJ 700s and 76-seat Bombardier CRJ900s. The latter two aircraft types appear likely to remain in Delta Connection service. Delta Connection carriers operate hundreds of regional jets with 50 seats, including Bombardier CRJs (100s and 200s) and Embraer ERJ-145s. This particular Comair CRJ200 was painted in a special livery in 2008 to commemorate the airline's 25th anniversary. Comair would only last four more years, with parent Delta deciding to close Comair down in late September 2012 According to Delta Air Lines, the discontinuation of Comair’s operations will not result in any significant changes to Delta’s network, which the airline says is flexible enough to accommodate the changes. Delta says Comair accounts for approximately 1 per cent of Delta’s network capacity. Delta hastened to say that Cincinnati/Northern Kentucky International Airport, where Comair is based, will continue to be an important market in Delta’s network. “Over the past several years, working with community leaders, Delta has right-sized capacity at Cincinnati to better match service to local passenger demand,” the carrier said in a July 27 statement. “Cincinnati is now a profitable market for Delta and the city continues to enjoy over 120 peak daily flights, with non-stop service to 49 destinations. No reductions in the number of Delta flights are planned at Cincinnati as a result of this decision.” No comments so far. Be first to leave comment below. Your email address will not be published. Required fields are marked * About the SSRS Opinion Panel The SSRS Opinion Panel is one of the leading opinion sharing platforms in the nation. It was established in 2015. It comprises of a nationally representative group of 10,000 people (and growing!) randomly selected throughout the United States who have agreed to share their opinions. SSRS is a leading public opinion research firm. Founded more than 30 years ago, we gather public opinions on various topics by having you complete surveys. Surveys are conducted for many private and public sector entities including media organizations, colleges and universities, foundations. For further information on SSRS, click here. How Does the SSRS Opinion Panel Work? • You receive a personalized invitation to join the panel via email; • Complete the registration survey by clicking the link in the email to join the panel, receive $5 for completing the registration survey; • Start receiving survey invitation and earn cash rewards for completing surveys; • You can complete surveys via Web using your desktop computer, laptop, tablet or smart phone. Still Have Questions? Read our FAQs or contact us if you need more information.	# Delta Air Lines to Shut Down Comair, Inc. Effective September 30 Comair will operate its last flights on September 29. Don Bornhorst, senior vice president of Delta Connection, announced the decision in a July 27 memo. > “While regional flying has and will remain a key component of Delta’s network, customer expectations and the unit costs of regional flying have evolved,” Bornhorst wrote. > “In response, Delta recently announced its plans to reduce the total number of regional jets in its network while adding more mainline flying. This includes reducing the number of 50-seat regional jets from nearly 350 aircraft to 125 or fewer in the upcoming years. As a result of this reduction and changes to its customer-focused business strategy, Delta has made the difficult decision to cease Comair’s operations.” --- ## Employee Memo Ryan Gumm, president of Comair, informed employees in a memo: > “Delta recently announced its intent to reduce the overall number of 50-seat regional jets in its network from nearly 350 to 125 or fewer in light of the significant changes in the economic and competitive conditions in the airline industry. > > “We believed this announcement would have a negative impact on Comair because we operate some of the oldest 50-seat aircraft in the Delta Connection fleet, which also have the highest unit cost per flight hour. > > “And, in fact, Delta has decided to remove the remaining 16 Comair 50-seaters from the Delta network, leaving Comair with only 28 aircraft in scheduled service. > > “This further reduction of Comair’s active fleet will only create higher unit costs, which equates to a business model that is no longer sustainable in this competitive regional environment.” Gumm’s memo also said Delta would make assistance available to Comair employees, but did not specify how many would retain jobs within Delta or how many might be laid off. --- ## Fleet and Network Impact - Comair’s fleet included: - 16 remaining 50-seat Bombardier CRJ100s/CRJ200s - 15 65-seat CRJ700s - 13 76-seat CRJ900s - Delta has not indicated the future of the 50-seat CRJs. The larger CRJ700s and CRJ900s appear likely to remain in Delta Connection service. - Comair accounts for approximately 1% of Delta’s network capacity. Delta says the network is flexible enough to absorb these changes with no significant alterations. > “Over the past several years, working with community leaders, Delta has right-sized capacity at Cincinnati to better match service to local passenger demand. Cincinnati is now a profitable market for Delta and the city continues to enjoy over 120 peak daily flights, with non-stop service to 49 destinations. No reductions in the number of Delta flights are planned at Cincinnati as a result of this decision.” --- ## Historical Note Comair operated regional jets such as the Bombardier CRJ100 and CRJ200, including a special 25th-anniversary livery in 2008. The airline ceased operations on September 29, 2012. --- # About the SSRS Opinion Panel The SSRS Opinion Panel is one of the leading opinion sharing platforms in the nation. It was established in 2015. It comprises a nationally representative group of 10,000 people (and growing!) randomly selected throughout the United States who have agreed to share their opinions. SSRS is a leading public opinion research firm. Founded more than 30 years ago, we gather public opinions on various topics by having you complete surveys. Surveys are conducted for many private and public sector entities including media organizations, colleges and universities, and foundations. ## How Does the SSRS Opinion Panel Work? - You receive a personalized invitation to join the panel via email - Complete the registration survey by clicking the link in the email to join the panel and receive \$5 for completing the registration survey - Start receiving survey invitations and earn cash rewards for completing surveys - You can complete surveys via the web using your desktop computer, laptop, tablet, or smartphone ## Still Have Questions? Read our FAQs or contact us if you need more information.	1,163	858	1,520,643,862,974,312,200	concat	[ "concat_full" ]	0.75	true	null
-2,337,448,608,303,995,000	Fitness Equipments, Fitness Calculators, Exercises by Body Part, Bodybuilding Exercises, Physical Exercise, Bodybuilding Equipments Catalog » Racquets » SHUTTLE RACQUETS » YONEX » Racquets-32 » Reviews My Account \| Cart Contents \| Checkout CAB 8000 Rs.1,670.00 There are currently no product reviews. Back Write Review Coming Soon Add to Cart Facebook youtube Twitter Google plus LinkedIn Login E-mail Address:Forgot Password? Password:New Customer? Categories Business Use Home Use Semi Commercial Use Health&Fitness Cricket Racquets SHUTTLE COCK SHUTTLE RACQUETS COSCO SILVER YONEX SQUASH RACQUETS TABLE TENNIS BAT TENNIS BALL TENNIS RACQUET InflatableBalls IndoorGames Sportswear Shoes Shop By Price Shop By Price Under Rs.500.00 From Rs.500.00 to Rs.1,000.00 From Rs.1,000.00 to Rs.1,500.00 From Rs.1,500.00 to Rs.2,500.00 Above Rs.2,500.00 Show all price ranges Quick Find Use keywords to find the product you are looking for. Advanced Search What's New? more Manual Incline AF 846 Manual Incline AF 846 Contact for Price Shopping Cart more 0 items Notifications more NotificationsNotify me of updates to CAB 8000 Reviews more Write ReviewWrite a review on this product! Copyright © 2019 Fitness equipments (On Bimal Roy’s 110thBirth Anniversary, Ratnottama Sengupta traces his enduring affair with books.) IMG_0536 Bimal Roy (12 th July,1909 – 8th January,1966) “Bimal Da and I – particularly I, being a writer – always looked to literature for story, the raw material of cinema. People can and do write original scripts for the silver screen, but we did not prefer that because it tends to be hurried writing. We preferred to source our films from books because a writer has already worked on an idea, on the character, on the logic of their action, and its final resolution…” –Nabendu Ghosh(1917-2007) in And They Made Classics… He was already a recognised name in Bengali literature when Nabendu Ghosh met Bimal Roy, his film guru. Bimal Roy was a voracious reader. The reasons for this were many. To begin with Bimal Roy, since school days, had been friends with Sudheesh Ghatak, brother of Manish Ghatak who is better known to Bengali readers as Jubanaswa, a radical writer of the Kallol era introducing modernism, who drew litterateurs like Tarashankar Bandopadhyay (1898-1971) to his house. The entire family had the gift of story-telling — and not only the eldest brother but also his daughter Mahasweta Devi (1926-2016) and his youngest brother Ritwik Ghatak (1925-1976). Even Sudheesh Ghatak has won accolades for this art. IMG_0537 Poster of Tagore’s Natir Puja from NT Eventually, Bimal Roy’s penchant for photography took him to New Theatres (NT) which had, since its inception, transcreated the major novels and stories of writers like Rabindranath Tagore, Bankim Chandra and Sarat Chandra. In fact NT produced not only Tagore’s own Natir Puja (The Dancer’s Prayer, 1932) but also the comedy, Chirakumar Sabha (Bachelor’s Conference, 1932) and Arghya (Offerings, 1937), besides Kapal Kundala (Bankim Chandra, 1933), Dena Paona (Give and Take, 1931), Palli Samaj (Rural Society, 1932), Grihadaaha (House on Fire, 1936), Devdas (1936), Bardidi (Elder Sister, 1939), Kashinath (1943), Biraj Bou (Biraj the Wife, 1946), and Ramer Sumati (The Redemption of Ram, 1947) — all from Sarat Chandra stories. Advertisements	# CAB 8000 Price: Rs. 1,670.00 Breadcrumbs: Catalog » Racquets » SHUTTLE RACQUETS » YONEX » Racquets-32 » Reviews --- ## Reviews There are currently no product reviews. [Back] \| [Write Review] (Coming Soon) --- [Add to Cart] --- # On Bimal Roy’s 110th Birth Anniversary By Ratnottama Sengupta Bimal Roy (12th July 1909 – 8th January 1966) > “Bimal Da and I – particularly I, being a writer – always looked to literature for story, the raw material of cinema. People can and do write original scripts for the silver screen, but we did not prefer that because it tends to be hurried writing. We preferred to source our films from books because a writer has already worked on an idea, on the character, on the logic of their action, and its final resolution…” > – Nabendu Ghosh (1917–2007) in And They Made Classics… He was already a recognised name in Bengali literature when Nabendu Ghosh met Bimal Roy, his film guru. Bimal Roy was a voracious reader. The reasons for this were many. To begin with, Bimal Roy, since school days, had been friends with Sudheesh Ghatak, brother of Manish Ghatak (better known to Bengali readers as Jubanaswa), a radical writer of the Kallol era introducing modernism. Their family drew litterateurs like Tarashankar Bandopadhyay (1898–1971) to their house. The entire family had the gift of story-telling—not only Manish but also his daughter Mahasweta Devi (1926–2016) and his youngest brother Ritwik Ghatak (1925–1976). Even Sudheesh Ghatak won accolades for this art. Eventually, Bimal Roy’s penchant for photography took him to New Theatres (NT), which had, since its inception, transcreated major novels and stories by Rabindranath Tagore, Bankim Chandra, and Sarat Chandra. In fact, NT produced not only Tagore’s own Natir Puja (The Dancer’s Prayer, 1932) but also the comedy Chirakumar Sabha (Bachelor’s Conference, 1932) and Arghya (Offerings, 1937), besides: - Kapal Kundala (Bankim Chandra, 1933) - Dena Paona (Give and Take, 1931) - Palli Samaj (Rural Society, 1932) - Grihadaaha (House on Fire, 1936) - Devdas (1936) - Bardidi (Elder Sister, 1939) - Kashinath (1943) - Biraj Bou (Biraj the Wife, 1946) - Ramer Sumati (The Redemption of Ram, 1947) —all from Sarat Chandra stories.	950	668	-2,337,448,608,303,995,000	concat	[ "concat_full" ]	0.75	true	null
7,023,905,327,840,854,000	Thread Tools This thread is privately moderated by davidterrell80, who may elect to delete unwanted replies. May 28, 2016, 02:32 PM AMA 986339 FCC KB5LAM/4 davidterrell80's Avatar Thread OP Discussion Ace Wing Cores Many older planes whose plans were featured in RCM Magazine used the commercially available "Ace Foam Wing". The articles never stated the wing span. Here is some information from a person who provides the wing cores on E-Bay I'm not sure if this fits, but a fellow on E-Bay makes "Ace Wing Cores" The span is 35-inches Quote: Tapered These Ace Mini Foam Wing Cores are our version of the original. These are not molded wings like the original, but hot wired out of virgin white bead foam. The wing span is 35" with a wing area of 166.25 sq. in. The root is 5.5 and tip is 4" The airfoil is the same as the original a 17% Semi - Symmetrical. These wings are a Taper with the taper at the T.E., L.E. is straight. They are designed for small r/c planes from .010 to .049. Weight of the cores is .8 oz. Constant Chord These Ace Mini Foam Wing Cores are our version of the original. These are not molded wings like the original, but hot wired out of virgin white bead foam. The wing span is 35" with a wing area of 192.5 sq. in. The cord is 5.5". The airfoil is the same as the original a 17% Semi - Symmetrical. These wings are a constant cord. They are designed for small r/c planes from .010 to .049. Weight of the cores is 1.2 oz. Plans in the RCM corpus that used Ace wings include: UPSTART pl-459 CASSUTT AND BONZO pl-469 SOPWITH TRIPLANE pl-478 LITTLE MULLIGAN pl-486 ALL STAR pl-499 WARBIRDS (P-51 B OR D, ME 109, HAWKER HURRICANE) pl-523 WHIZARD pl-547 HOT DAWG pl-561 HAFADUSSIN pl-588 RCM QUICKIE 200 pl-603 HALF-A-CHAOS pl-607a HALF-A-STICK pl-607b TD SPECIAL pl-627 ROLLIN' FOAM pl-632 SHRIKE COMMANDER pl-640 SCHOOLYARD SPECIAL pl-693 SHOCKWAVE pl-750 TU BEE pl-799 BLUEBOTTLE pl-892 SIMPLE CITABRIA pl-926 SIMPLE CUB pl-946 SIMPLE DUSTER pl-986 TALON pl-1000 CRICKET pl-1069 POCKET ROCKET pl-1130 SIMPLE CAP pl-1156 DOUGLAS AD-1 SKYRAIDER pl-1163 Many of the plans and articles are preserved in the RCM project some have bee working on. The index to the effort is located HERE. Sign up now to remove ads between posts May 28, 2016, 03:04 PM Registered User ACE Foam Wings Also see: https://www.rcgroups.com/forums/show....php?t=1126229 Aug 03, 2016, 07:24 PM Rudder Only Lover GallopingGhostlr's Avatar Ace constant chord wings are of the right proportion that by modifying the wing saddle, would also work on a Sterling Minnie Mambo. Quick Reply Message: Thread Tools West Washington County Emergency Medical Services; Emeryphillips, Appellants, v. Washington County; Central Emergency Medical Services, Appellees, 967 F.2d 1252 (8th Cir. 1992) Annotate this Case U.S. Court of Appeals for the Eighth Circuit - 967 F.2d 1252 (8th Cir. 1992) Submitted April 16, 1992. Decided June 30, 1992 Gregory Karber, Fort Smith, Ark., argued, for appellants. Michael R. Rainwater, Little Rock, Ark., argued (Don Taylor and Wm. Jackson Butt, II, Fayetteville, Ark., on the brief), for appellees. Before BOWMAN, WOLLMAN, and BEAM, Circuit Judges. BOWMAN, Circuit Judge. West Washington County Emergency Medical Services (WWCEMS) and Emery Phillips1 appeal from the order of the District Court2 granting summary judgment on their 42 U.S.C. § 1983 (1988) action3 in favor of Washington County and Central Emergency Medical Services (CEMS). We affirm. CEMS and WWCEMS provide emergency medical services (EMS) in Washington County, Arkansas. From 1982 until 1988, both had contracts with Washington County pursuant to which they provided EMS in different geographic areas of the county. Their compensation was based upon the size of the populations each served and was raised through a county sales tax. These contracts were terminable upon ninety days notice. In October 1988, after giving ninety days written notice, the county terminated its contract with WWCEMS. It then contracted with CEMS to provide EMS in the area formerly served by WWCEMS (hereinafter West Washington County) in addition to CEMS's original service area (hereinafter East Washington County). Accordingly it paid CEMS all the tax money earmarked for EMS in those areas. At about this same time the county began operation of a 911 emergency telephone system. Initially, all emergency calls were routed to CEMS. Currently, however, calls are routed to WWCEMS if the caller volunteers a preference for WWCEMS. WWCEMS initiated this action in March 1991, alleging that the appellees were depriving it of its Fourteenth Amendment due process and equal protection rights by denying it county funds and access to the 911 system, competing with it unlawfully, attempting to deprive it of its assets, and conspiring to do the above.4 It also alleged that the appellees were violating federal antitrust laws as well as several Arkansas statutes. The appellees filed motions for summary judgment. The District Court granted these motions on the federal issues and dismissed the pendent state claims. WWCEMS appeals. "We review a grant of summary judgment de novo," United States ex. rel. Glass v. Medtronic, Inc., 957 F.2d 605, 607 (8th Cir. 1992), and will affirm only if "the pleadings, depositions, answers to interrogatories, and admissions on file, together with the affidavits, if any, show that there is no genuine issue as to any material fact and that the moving party is entitled to a judgment as a matter of law." Fed. R. Civ. P. 56(c). This standard is satisfied here. WWCEMS's primary argument on appeal is that the appellees are denying it due process by providing EMS in West Washington County without first complying with certain procedures required by Arkansas statutes. According to WWCEMS, Arkansas law requires that the appellees clear certain procedural hurdles before they may provide EMS in West Washington County. WWCEMS contends that, unless and until the appellees comply with these requirements, WWCEMS is the only authorized EMS provider in West Washington County and it, therefore, is entitled under Arkansas law to all the 911 business originating in the area, all county funds allocated for the area's EMS, and all the EMS business in the area free of subsidized county competition. WWCEMS concludes that the appellees are impairing its interests in these benefits, and therefore denying it due process, by providing EMS in West Washington County in violation of Arkansas law. We disagree. Where liberty interests are not implicated, a procedural due process claim can survive summary judgment only if it is based upon a property interest encompassed by the Fourteenth Amendment. See Board of Regents v. Roth, 408 U.S. 564, 569-70, 92 S. Ct. 2701, 2705, 33 L. Ed. 2d 548 (1972). Moreover, whether a particular interest amounts to a Fourteenth Amendment property interest turns upon whether the claimant has "a legitimate claim of entitlement to it," id. at 577, 92 S. Ct. at 2709, under "existing rules or understandings that stem from [a] source such as state law." Id. In this case, the interests that WWCEMS claims the appellees are impairing arise not from statutory restrictions on the appellees' access to the West Washington County market, but rather from WWCEMS's lack of competition in that market. As WWCEMS does not maintain that it is entitled to this lack of competition, it follows that WWCEMS has no constitutionally protected property interest in the benefits arising therefrom. Accordingly, the District Court properly granted summary judgment on this claim. WWCEMS next contends that the appellees violated its due process rights by conspiring to force it into dissolution and thereby deprive it of its "physical assets." Appellant's Brief at 9. WWCEMS, however, has not dissolved, and the only alleged assets it has been denied are the benefits attributable to its lack of competition,5 the denial of which we already have held does not violate due process. Summary judgment, therefore, was appropriate on this point as well. WWCEMS also contends that the appellees denied it equal protection of the law by permitting initially only CEMS to respond to 911 calls in West Washington County despite the fact that certain Arkansas statutes allegedly restrict CEMS's authority to provide EMS there. However, " [a]bsent a suspect classification or the infringement of a fundamental right, neither of which is alleged to exist here, the equal protection clause is offended only if the [state's] different treatment of ... two classes ... bears no rational relationship to [any] legitimate governmental purpose." Bunyan v. Camacho, 770 F.2d 773, 774 (9th Cir. 1985), cert. denied, 477 U.S. 903, 106 S. Ct. 3271, 91 L. Ed. 2d 562 (1986). In this case, the initial decision to have CEMS, but not WWCEMS, respond to the 911 calls was or could have been based upon the fact that, at the inception of the 911 system, only CEMS was paramedic level certified. As the county had a legitimate interest in the quality of emergency medical care available to its citizens, see, e.g., Ark.Code Ann. § 12-10-302(e) (2)-(3) (Michie 1987) (authorizing and encouraging Arkansas's political subdivisions to implement the 911 system), this decision clearly did not violate the equal protection clause. WWCEMS also contends that after it was certified paramedic level the appellees denied it equal protection of the law by delaying its access to the 911 system and by denying it the same access granted to CEMS. These arguments are meritless. WWCEMS's subsequent acquisition of paramedic level certification could not render unconstitutional the county's initially constitutional decision to have CEMS respond to its 911 calls. Moreover, as there can be no equal protection violation without state action, see, e.g., Medical Inst. v. National Ass'n of Trade and Technical Sch., 817 F.2d 1310, 1312 (8th Cir. 1987), WWCEMS's equal protection rights could have been violated after it became certified paramedic level only if the county reconsidered or was required to reconsider its arrangements with CEMS. Assuming arguendo that such reconsideration was necessary, the county still could have decided to limit full 911 access to only one emergency medical care provider so that that provider would handle a maximum number of emergency cases and thereby develop the highest level of skill for responding to them. See, e.g., Joint Appendix at 309, 311 (proposed Criteria for Emergency Medical Services) (naming a single EMS provider would " [m]aximize the level of patient care by ensuring regular access to emergency patients"). Likewise, the county's decision to have CEMS, rather that WWCEMS, serve as its primary 911 EMS provider could have been based upon CEMS's greater actual experience providing paramedic level service. Thus, to the extent the county distinguished between CEMS and WWCEMS after WWCEMS was paramedic level certified, its bases for doing so were rationally related to its legitimate interest in the level of emergency health care available to its citizens. For the reasons set forth above, the District Court's grant of summary judgment is affirmed. 1 To simplify our discussion, we refer to the appellants jointly as WWCEMS. See West Washington County Emergency Medical Services v. Washington County, No. 90-5113, slip op. at 1 n. 1, 1991 WL 349617 (W.D. Ark. Aug. 6, 1991) (Memorandum Opinion), reprinted in Joint Appendix at 382 n. 1 2 The Honorable H. Franklin Waters, Chief United States District Judge for the Western District of Arkansas 3 The appellants also raised an antitrust claim in District Court but do not appeal from the grant of summary judgment with respect to that claim 4 It is by virtue of its conspiracy allegations that WWCEMS implicates CEMS in its due process and equal protection claims 5 WWCEMS specifically argues that the conspiracy to deprive it of its physical assets resulted in an injury to WWCEMS in the form of reduced market share. See Appellant's Reply Brief at 5. WWCEMS's original market share, however, clearly was the product of its lack of competition	# Ace Wing Cores Discussion by davidterrell80 (May 28, 2016) Many older planes whose plans were featured in RCM Magazine used the commercially available “Ace Foam Wing”. The articles never stated the wingspan. Below is information from a vendor on eBay who supplies these wing cores. --- ## Tapered > These Ace Mini Foam Wing Cores are our version of the original. > These are not molded wings like the original, but hot-wired out of virgin white bead foam. > The wingspan is 35" with a wing area of 166.25 sq. in. > Root chord: 5.5" > Tip chord: 4" > Airfoil: 17% semi-symmetrical (same as the original) > Tapered at the trailing edge; leading edge is straight. > Designed for small R/C planes (.010 to .049). > Core weight: 0.8 oz. ## Constant Chord > These Ace Mini Foam Wing Cores are our version of the original. > These are not molded wings like the original, but hot-wired out of virgin white bead foam. > The wingspan is 35" with a wing area of 192.5 sq. in. > Constant chord: 5.5" > Airfoil: 17% semi-symmetrical (same as the original) > Designed for small R/C planes (.010 to .049). > Core weight: 1.2 oz. --- ## RCM Plans That Used Ace Wings - UPSTART (pl-459) - CASSUTT AND BONZO (pl-469) - SOPWITH TRIPLANE (pl-478) - LITTLE MULLIGAN (pl-486) - ALL STAR (pl-499) - WARBIRDS: P-51 B or D, Me 109, Hawker Hurricane (pl-523) - WHIZARD (pl-547) - HOT DAWG (pl-561) - HAFADUSSIN (pl-588) - RCM QUICKIE 200 (pl-603) - HALF-A-CHAOS (pl-607a) - HALF-A-STICK (pl-607b) - TD SPECIAL (pl-627) - ROLLIN' FOAM (pl-632) - SHRIKE COMMANDER (pl-640) - SCHOOLYARD SPECIAL (pl-693) - SHOCKWAVE (pl-750) - TU BEE (pl-799) - BLUEBOTTLE (pl-892) - SIMPLE CITABRIA (pl-926) - SIMPLE CUB (pl-946) - SIMPLE DUSTER (pl-986) - TALON (pl-1000) - CRICKET (pl-1069) - POCKET ROCKET (pl-1130) - SIMPLE CAP (pl-1156) - DOUGLAS AD-1 SKYRAIDER (pl-1163) --- Also see: https://www.rcgroups.com/forums/showthread.php?t=1126229 --- # West Washington County Emergency Medical Services v. Washington County 967 F.2d 1252 (8th Cir. 1992) Court: U.S. Court of Appeals for the Eighth Circuit Submitted: April 16, 1992 Decided: June 30, 1992 Appellants: West Washington County Emergency Medical Services (“WWCEMS”); Emery Phillips Appellees: Washington County; Central Emergency Medical Services (“CEMS”) Counsel: - Gregory Karber for appellants - Michael R. Rainwater (with Don Taylor and Wm. Jackson Butt II) for appellees Judges: Bowman, Wollman, and Beam, Circuit Judges (opinion by Bowman) --- ## Facts - From 1982 to 1988, WWCEMS and CEMS each held county contracts to provide EMS in separate geographic areas of Washington County, Arkansas, funded by a county sales tax and terminable on 90 days’ notice. - In October 1988, the county gave WWCEMS 90 days’ notice of contract termination and awarded its former territory to CEMS. - The county also launched a 911 system that initially routed all calls to CEMS; later calls were routed to WWCEMS if callers requested it. ## Procedural History - WWCEMS sued in March 1991 under 42 U.S.C. § 1983, alleging: 1. Deprivation of due process and equal protection rights by withholding county funds and 911 access, unlawful competition, and a conspiracy to take its assets. 2. Violations of federal antitrust law and Arkansas statutes. - The District Court granted summary judgment for appellees on federal claims and dismissed state-law claims. WWCEMS appealed. ## Issues 1. Does WWCEMS have a Fourteenth Amendment property interest in continued county funding, exclusive 911 access, or lack of competition? 2. Did appellees violate due process by conspiring to force WWCEMS’s dissolution and seize its assets? 3. Did appellees violate equal protection by routing 911 calls initially only to CEMS? ## Holding The grant of summary judgment is affirmed. ## Reasoning 1. Due Process (Property Interest) - A protected property interest requires a legitimate entitlement under state law (Board of Regents v. Roth). - WWCEMS’s claimed interests—in exclusive funding, 911 access, and an uncontested market—derive only from its prior lack of competition, not from a statutory entitlement. - WWCEMS holds no Fourteenth Amendment property interest in those benefits. 2. Conspiracy to Seize Assets - WWCEMS was not dissolved nor deprived of tangible assets; its asserted injury is reduced market share, which is not a constitutionally protected interest. 3. Equal Protection - No suspect classification or fundamental right is implicated. - The county’s initial decision to route calls to CEMS was rationally related to the legitimate interest in higher-level (paramedic) care, since only CEMS was paramedic-certified at 911 inception. - Even after WWCEMS obtained certification, the county could rationally choose a single primary provider to maximize skill development and efficiency. ## Disposition Summary judgment for appellees affirmed.	2,949	1,373	7,023,905,327,840,854,000	concat	[ "concat_full" ]	0.75	true	null
3,288,921,280,389,721,000	First Name: Last Name: Required by COPPA (15 USC 6501-6506) Daniel Lewis • There are 1,617,137 people in the U.S. with the first name Daniel. • Statistically the 16th most popular first name. • 99.49 percent of people with the first name Daniel are male. • Names similar to Daniel: Daniel Lewis • There are 3,057 people in the U.S. named Daniel Lewis. Add the results to your web page: HowManyOfMe.com Logo There are 3,057 people with the name Daniel Lewis in the U.S.A. How many have your name? You can add the box above to your web page, blog, Livejournal, or MySpace page. Just copy and paste the html code below into the page to which you want to add it. Hide Name \| Show Name Share with your friends Let your friends know about HowManyOfMe. Find out who has the most common name among all your friends. Add to Facebook Facebook logo Use our new application to add your results to your Facebook profile. Click the Facebook logo to begin. All numbers estimated based upon statistical and demographic data from US Census Bureau. For entertainment purposes only. Accuracy Information Our therapeutic boarding school admissions staff will help you determine if our Christian therapeutic boarding school is right for your teenager. – affordable boarding schools and troubled girl schools. Tap To Call 866-318-7392 Your Teen Will See the World and Their Place in the World with New Eyes. Admissions Admissions Information Student Scholarships Are Available Before applying for Caribbean Mountain Academy (CMA), we’ll want to first have a phone discussion to make sure the program is the right fit. Feel free to call us at 866-318-7392 or fill in the inquiry form on this site. An admissions coordinator will answer any questions that come up about the therapeutic boarding school and set you mind at ease in regard to the foreign location. Once your questions are adequately answered, the next step for you to take is to fill out an application. What to do Before Enrolling Your Student boarding school programProspective parents are able to schedule a parent visit to Caribbean Mountain Academy. We want you to see the facility and meet our staff, before making the decision to enroll. You’ll get a tour of the campus, see student housing and you can even participate in service projects or adventure activities with the students. Online Application Our application is free to complete and there’s no cost or commitment to make at this stage. We will supply the link to you once we have initially talked. You can START AN APPLICATION or email it as a PDF. Once your application is received, we will let you know within 24 to 48 business hours if your teen is accepted. If we have follow up questions, we’ll ask those within the same amount of time. If your child is not accepted, we will give you our recommended course of treatment and other options. Schedule a Parent Immersion Trip Feel free to schedule a trip to visit the CMA campus before you make your final decision. Many parents have benefitted from seeing our campus firsthand as they weigh the decision to enroll their teen. We will give you a tour of our beautiful campus, introduce you to the staff who will be caring for your child, and you’ll see all the ways we ensure our students are well taken care of. You’ll also get the opportunity to go on an outing with the students, whether it’s a service project or an adventure activity. Enrollment Process If your teen is approved for CMA, you will receive a student enrollment packet. After filling out the enrollment packet, the next step is to plan your student’s arrival date. You will be connected with Caribbean Mountain Academy’s case manager, who will help with your travel plans. Many parents are unsure of how to get their rebellious child to come to our boarding school for troubled teens. If that’s you, feel free to reach out and we’ll help walk you through the process. We know it’s difficult to watch your child struggle, but deep down you know that they will be better off after receiving intervention. After all, it’s because as parents, we love our kids and want them to receive the help they need, even if they don’t want it at first. Safety Questions Prospective parents often come to us with safety concerns. This is understandable. You care deeply for your child and you want to make sure they’re being taken care of. Rest assured, we want that for your child as well. Many parents have benefited from visiting campus before their student arrives. When these parents have seen the campus and the staff involvement, their worries have vanished. 24/7 Supervision and Adult Presence with all Students Students are under 24/7 staff supervision. A staff member is always present with them both on and off campus, and there are night staff to provide supervision for students while they are asleep. Security cameras provide an extra layer of protection for the students. In addition, there is a local guard at the gate of the campus which helps CMA foster good relationships with the townspeople. This creates a sense of trust in the community and helps keep everyone safe We may be a little biased, but we think CMA is the best therapeutic boarding school in the entire world! Many of us on staff are parents ourselves and we are passionate about what we do at CMA. We promise to care for your child as if they were our own, and work together with your family to bring healing and hope to your home. If you haven’t yet, please contact us at 866-318-7392 or fill out an inquiry form to get started. We hope to hear from you! therapeutic boarding schools We can also help you in your search for other teen boarding schools, therapeutic homes, Christian boarding schools or reform schools, please let us know. We deal with defiance, depression, post traumatic stress, abuse, and general anxiety. If you have an out of control girl or boy, please think about Caribbean Mountain Academy, a school that offers counseling for troubled teens. Our therapeutic boarding school helps boys and girls who are at-risk and having behavioral and emotional issues such as reactive attachment disorder, depression, borderline personality disorder and bipolar disorder. If you are searching for residential treatment centers, you have found one. This program for troubled teens is among the best therapeutic schools. Our therapeutic boarding school provides counseling and therapy in a beautiful Caribbean setting. Therapeutic Boarding Schools — About CMA’s Admissions Our therapeutic boarding school admissions staff will help you determine if our Christian therapeutic boarding school is right for your teenager. MENU	# Daniel Lewis First Name Statistics - There are 1,617,137 people in the U.S. with the first name Daniel. - Statistically the 16th most popular first name. - 99.49 percent of people with the first name Daniel are male. - Names similar to Daniel: Full Name Statistics - There are 3,057 people in the U.S. named Daniel Lewis. --- ## Add the results to your web page HowManyOfMe.com There are 3,057 people with the name Daniel Lewis in the U.S.A. How many have your name? You can add the box above to your web page, blog, LiveJournal, or MySpace page. Just copy and paste the HTML code below into the page where you want it to appear: ```html <!-- Paste widget code here --> ``` _All numbers estimated based upon statistical and demographic data from US Census Bureau. For entertainment purposes only. Accuracy Information._ --- # Caribbean Mountain Academy Admissions Call us: [866-318-7392](tel:8663187392) Your teen will see the world—and their place in it—with new eyes. --- ## Admissions Information Student Scholarships Are Available Before applying for Caribbean Mountain Academy (CMA), we’ll first have a phone discussion to make sure the program is the right fit. Feel free to call us at 866-318-7392 or fill in the inquiry form on this site. An admissions coordinator will answer any questions about our Christian therapeutic boarding school and set your mind at ease regarding the foreign location. Once your questions are answered, the next step is to fill out an application. --- ## What to Do Before Enrolling Your Student Prospective parents can: - Schedule a Parent Visit Tour the facility, meet our staff, see student housing, and even participate in service projects or adventure activities with current students. - Complete the Online Application Our application is free and non-binding. We’ll supply the link once we’ve had our initial phone discussion. You can start an application online or email it as a PDF. - We’ll respond within 24–48 business hours with acceptance, follow-up questions, or alternative recommendations if your teen is not accepted. - Schedule a Parent Immersion Trip Visit the CMA campus before making your final decision. You’ll: - Tour the beautiful campus - Meet the staff who will care for your child - Join students on a service or adventure outing --- ## Enrollment Process 1. Acceptance & Enrollment Packet If approved, you’ll receive a student enrollment packet. 2. Plan Arrival Work with CMA’s case manager to arrange your teen’s travel plans. 3. Arrival Support We’ll guide you through getting your rebellious teen to our boarding school for troubled teens, ensuring a smooth transition. --- ## Safety & Supervision We understand safety is your top concern. Many parents find their worries vanish after visiting our campus. - 24/7 staff supervision on and off campus - Night staff present during sleeping hours - Security cameras for extra protection - Local guard at the campus gate to foster community trust --- ## Our Commitment We believe CMA is the best therapeutic boarding school in the world. Many staff members are parents themselves, and we promise to care for your child as if they were our own. We work together with families to bring healing and hope to every home. --- ## Additional Support & Programs We also assist families seeking other teen boarding schools, therapeutic homes, Christian boarding schools, or reform schools. We address: - Defiance & behavioral issues - Depression & general anxiety - Post-traumatic stress & abuse recovery - Reactive Attachment Disorder - Borderline Personality Disorder - Bipolar Disorder If you have an out-of-control teen, think about Caribbean Mountain Academy. Our program offers counseling and therapy in a beautiful Caribbean setting and ranks among the top residential treatment centers for troubled teens. --- Contact us today at [866-318-7392](tel:8663187392) or fill out an inquiry form to get started. We hope to hear from you!	1,366	860	3,288,921,280,389,721,000	concat	[ "concat_full" ]	0.75	true	null
7,022,207,874,902,261,000	Menu Quick Search Enter locomotive number in the box below and press 'Go'! Content is coming here as you probably can see. Content is coming here as you probably can see. ? Counter Ad Visitor Statistics » 1 Online » 151 Today » 1091 Yesterday » 151 Week » 18933 Month » 267226 Year » 1151607 Total Record: 1668 (12/02/2017) (Free MySQL Counter) Advertising In Touch Bookmark and Share Follow BRDatabase on Twitter prev prev Numbers Carried Company Number Date From BR 46494 m/e 12/1951 Locomotive Specifics Designer H. Ivatt Class 2MT Company History LMS Wheels 2-6-0 Builder Darlington Works Works Number 2186 To Service During 12/1951 to Burton (17B) Withdrawal Wed 12/09/1962 Scrapping During 10/1962 Service Life 10 yrs, 9 mths , 13 dys Allocations Code Name From Date 17B Burton (New) m/e 12/1951 22A Bristol Barrow Road 4w/e 27/02/1954 19B Sheffield Millhouses m/e 16/06/1956 31A Cambridge w/e 01/04/1961 31B March w/e 23/06/1962 Withdrawn 12/09/1962 SLS Allocations* Type Code Name From Date NEW 17B Burton w/e 29/12/1951 ALLOC 22A Bristol Barrow Road 4w/e 20/02/1954 ALLOC 19B Sheffield Millhouses w/e 16/06/1956 LOAN 41C Sheffield Millhouses 01/02/1958 ALLOC 41C Sheffield Millhouses 23/02/1958 ALLOC 31A Cambridge 5w/e 08/04/1961 ALLOC 31B March 2w/e 23/06/1962 WDN 12/09/1962 * Stephenson Locomotive Society data - raw and not yet cross-referenced Summary Date Event Details Source See Also 12/1951 To Service To service as BR Number 46494 Built at Darlington Works, Works Number 2186 Allocated to Burton (17B) 27/02/1954 Allocation Reallocated to Bristol Barrow Road (22A) 16/06/1956 Allocation Reallocated to Sheffield Millhouses (19B) 01/04/1961 Allocation Reallocated to Cambridge (31A) 25/03/1962 Sightings Darlington Works visit: Around the works - Waiting entry to works on Da SLS 5/1962 Link 23/06/1962 Allocation Reallocated to March (31B) 12/09/1962 Withdrawn Condemned as 46494 prev prev AIR’s Inducement Recapture Provision: When Free Rent Is No Longer Free Tenants love free rent. But they would hate to pay it back. Under the AIR lease, if Lessee commits a Breach, it is required to immediately pay Lessor the value of any free rent or other inducement (TI allowance, etc.) it received (Paragraph 13.3). This type of provision is included in many custom leases as well. This repayment obligation is triggered only after Lessee receives written notice from Lessor of its failure to perform a Lease obligation and fails to cure within the applicable cure period (assuming the failure can be cured). Importantly, Lessee may be required to pay the entire value of the free rent or other inducement even if Lessee commits the Breach at the very end of the Lease term. For example, assume a 60-month lease at $10,000 Base Rent per month, in which the parties agree that Base Rent is abated in months 2-4. If Lessee commits a Breach in month 58, it is immediately required to pay Lessor $30,000, even though Lessor received the benefit of a tenant that complied with all Lease terms, including the payment of rent, for nearly the entire term. Lessee may feel that this provision is unfair in this type of situation. When representing tenants, I often modify the Inducement Recapture provision so that the repayment obligation is reduced/prorated as the Lease term progresses. Therefore, if the Breach occurs when there are only 3 months remaining on the 60-month term, Lessee would pay only 3/60ths of the value of the Inducement Provisions. If you are representing a tenant, you may wish to prorate this repayment obligation. If you have a suggested topic for this blog, please click here to send Usman a message. By \| 2018-08-16T14:50:33+00:00 April 16th, 2015\|Landlord-Tenant, Leasing\|Comments Off on AIR’s Inducement Recapture Provision: When Free Rent Is No Longer Free	# Numbers Carried \| Company \| Number \| Date From \| \|---------\|--------\|--------------\| \| BR \| 46494 \| m/e 12/1951 \| # Locomotive Specifics - Designer: H. Ivatt - Class: 2MT - Company History: LMS - Wheels: 2-6-0 - Builder: Darlington Works - Works Number: 2186 - To Service: During 12/1951 to Burton (17B) - Withdrawal: Wed 12/09/1962 - Scrapping: During 10/1962 - Service Life: 10 yrs, 9 mths, 13 dys # Allocations \| Code \| Name \| From Date \| \|------\|-------------------------------\|----------------\| \| 17B \| Burton (New) \| m/e 12/1951 \| \| 22A \| Bristol Barrow Road \| 4 w/e 27/02/1954 \| \| 19B \| Sheffield Millhouses \| m/e 16/06/1956 \| \| 31A \| Cambridge \| w/e 01/04/1961 \| \| 31B \| March \| w/e 23/06/1962 \| Withdrawn: 12/09/1962 # SLS Allocations* \| Type \| Code \| Name \| From Date \| \|-------\|------\|----------------------\|------------------\| \| NEW \| 17B \| Burton \| w/e 29/12/1951 \| \| ALLOC \| 22A \| Bristol Barrow Road \| 4 w/e 20/02/1954 \| \| ALLOC \| 19B \| Sheffield Millhouses \| w/e 16/06/1956 \| \| LOAN \| 41C \| Sheffield Millhouses \| 01/02/1958 \| \| ALLOC \| 41C \| Sheffield Millhouses \| 23/02/1958 \| \| ALLOC \| 31A \| Cambridge \| 5 w/e 08/04/1961 \| \| ALLOC \| 31B \| March \| 2 w/e 23/06/1962 \| \| WDN \| \| \| 12/09/1962 \| \* Stephenson Locomotive Society data – raw and not yet cross-referenced # Summary \| Date \| Event \| Details \| Source \| See Also \| \|------------\|------------\|------------------------------------------------------------------------------------------\|------------\|----------\| \| 12/1951 \| To Service \| To service as BR Number 46494 Built at Darlington Works, Works Number 2186 Allocated to Burton (17B) \| \| \| \| 27/02/1954 \| Allocation \| Reallocated to Bristol Barrow Road (22A) \| \| \| \| 16/06/1956 \| Allocation \| Reallocated to Sheffield Millhouses (19B) \| \| \| \| 01/04/1961 \| Allocation \| Reallocated to Cambridge (31A) \| \| \| \| 25/03/1962 \| Sightings \| Darlington Works visit: Around the works – Waiting entry to works on Da \| SLS 5/1962 \| Link \| \| 23/06/1962 \| Allocation \| Reallocated to March (31B) \| \| \| \| 12/09/1962 \| Withdrawn \| Condemned as 46494 \| \| \| --- # AIR’s Inducement Recapture Provision: When Free Rent Is No Longer Free Tenants love free rent. But they would hate to pay it back. Under the AIR lease, if Lessee commits a Breach, it is required to immediately pay Lessor the value of any free rent or other inducement (TI allowance, etc.) it received (Paragraph 13.3). This type of provision is included in many custom leases as well. This repayment obligation is triggered only after Lessee receives written notice from Lessor of its failure to perform a Lease obligation and fails to cure within the applicable cure period (assuming the failure can be cured). Importantly, Lessee may be required to pay the entire value of the free rent or other inducement even if Lessee commits the Breach at the very end of the Lease term. For example, assume a 60-month lease at \$10,000 Base Rent per month, in which the parties agree that Base Rent is abated in months 2–4. If Lessee commits a Breach in month 58, it is immediately required to pay Lessor \$30,000, even though Lessor received the benefit of a tenant that complied with all Lease terms, including the payment of rent, for nearly the entire term. Lessee may feel that this provision is unfair in this type of situation. When representing tenants, I often modify the Inducement Recapture provision so that the repayment obligation is reduced/prorated as the Lease term progresses. Therefore, if the Breach occurs when there are only 3 months remaining on the 60-month term, Lessee would pay only 3/60ths of the value of the Inducement Provisions. If you are representing a tenant, you may wish to prorate this repayment obligation.	1,089	1,067	7,022,207,874,902,261,000	concat	[ "concat_full" ]	0.75	true	null
-3,354,078,483,625,423,000	Show simple item record dc.contributor.authorGhaffar, Farhan A. dc.contributor.authorShamim, Atif dc.contributor.authorRoy, Langis dc.date.accessioned2015-08-04T07:04:31Z dc.date.available2015-08-04T07:04:31Z dc.date.issued2012-07 dc.identifier.isbn9781467304627 dc.identifier.issn15223965 dc.identifier.doi10.1109/APS.2012.6348679 dc.identifier.urihttp://hdl.handle.net/10754/564584 dc.description.abstractWrapping of a two element LCP based patch antenna array is studied in this work. For the first time, the designed array is bent in both E and H planes to observe the effect on the radiation and impedance performance of the antenna. The 38 GHz simulation results reveal better performance for H plane bending as compared to E plane bending. A 100 um thick substrate is used for the design which is best suited for flexible antenna applications. Gain variations of 1.1 dB and 1.4 dB are observed for the two orientations while a significantly increased impedance bandwidth of 3 % is obtained with H plane wrapping. The design is highly suitable for broadband micro-cellular backhaul applications. © 2012 IEEE. dc.publisherInstitute of Electrical and Electronics Engineers (IEEE) dc.titleStudy of LCP based flexible patch antenna array dc.typeConference Paper dc.contributor.departmentApplied Mathematics and Computational Science Program dc.contributor.departmentComputer, Electrical and Mathematical Sciences and Engineering (CEMSE) Division dc.contributor.departmentElectrical Engineering Program dc.contributor.departmentIntegrated Microwave Packaging Antennas and Circuits Technology (IMPACT) Lab dc.contributor.departmentPhysical Sciences and Engineering (PSE) Division dc.identifier.journalProceedings of the 2012 IEEE International Symposium on Antennas and Propagation dc.conference.date8 July 2012 through 14 July 2012 dc.conference.nameJoint 2012 IEEE International Symposium on Antennas and Propagation and USNC-URSI National Radio Science Meeting, APSURSI 2012 dc.conference.locationChicago, IL dc.contributor.institutionDepartment of Electronics, Carleton University, Ottawa, Canada kaust.personGhaffar, Farhan A. kaust.personShamim, Atif This item appears in the following Collection(s) Show simple item record Register for your free account! \| Forgot your password? Liemae's TBM Profile - ID: #684-547-7 Username: Liemae elitegold: 0 Ratings: 0 Posts: 404 Thanks: 513 Positive 0 Neutral 0 Negative 0 Total 0 ID verified: Phone verified: Payments: Middleman: Mediations: 0/0 Send elitegold to Liemae Send a private message to Liemae TBM Spotlight Forum Categories News & More General General Gaming Popular Games The Black Market Shooter MMORPGs Other Online Games Coders Den Artists Den Hardware Off-Topics Support \| Contact \| FAQ \| Advertising \| Privacy Policy \| Terms of Service \| Abuse Copyright ©2019 elitepvpers All Rights Reserved.	# Study of LCP based flexible patch antenna array Authors - Farhan A. Ghaffar - Atif Shamim - Langis Roy Date Issued July 2012 Publication Proceedings of the 2012 IEEE International Symposium on Antennas and Propagation (APSURSI 2012) Conference Joint 2012 IEEE International Symposium on Antennas and Propagation and USNC-URSI National Radio Science Meeting 8–14 July 2012, Chicago, IL Identifiers - DOI: 10.1109/APS.2012.6348679 - ISBN: 978-1-4673-0462-7 - ISSN: 1522-3965 - URI: http://hdl.handle.net/10754/564584 Publisher Institute of Electrical and Electronics Engineers (IEEE) Abstract Wrapping of a two element LCP based patch antenna array is studied in this work. For the first time, the designed array is bent in both E and H planes to observe the effect on the radiation and impedance performance of the antenna. The 38 GHz simulation results reveal better performance for H plane bending as compared to E plane bending. A 100 µm thick substrate is used for the design which is best suited for flexible antenna applications. Gain variations of 1.1 dB and 1.4 dB are observed for the two orientations while a significantly increased impedance bandwidth of 3 % is obtained with H plane wrapping. The design is highly suitable for broadband micro-cellular backhaul applications. © 2012 IEEE. --- # Liemae's TBM Profile (ID: #684-547-7) - Username: Liemae - *elitegold: 0 - Ratings: 0 - Posts: 404 - Thanks: 513 - Positive: 0 - Neutral: 0 - Negative: 0 - Total: 0 - ID verified: - Phone verified: - Payments: - Middleman: - Mediations:** 0/0 ## Actions - Send elite*gold to Liemae - Send a private message to Liemae	708	486	-3,354,078,483,625,423,000	concat	[ "concat_full" ]	0.75	true	null
-8,788,235,025,564,359,000	53 days in Berlin & Eastern Europe Itinerary 53 days in Berlin & Eastern Europe Itinerary Created using Inspirock Europe trip planner This plan was created by another inspirock user. Make it your plan Route & dates 53 days in Berlin & Eastern Europe Itinerary Start: Toronto, Canada Fly: 10h 45min 1 Berlin, Germany — 2 nights 2 Tallinn, Estonia — 4 nights 3 Riga, Latvia — 2 nights 4 Vilnius, Lithuania — 2 nights 5 Gdansk, Poland — 2 nights train: 3h 6 Warsaw, Poland — 2 nights Fly: 4h 15min 7 Bratislava, Slovakia — 2 nights Drive: 4h 15min 8 Ljubljana, Slovenia — 6 nights 9 Budapest, Hungary — 2 nights Fly: 4h 10 Sarajevo, Bosnia and Herzegovina — 5 nights 11 Belgrade, Serbia — 2 nights Fly: 5h 15min 12 Bucharest, Romania — 2 nights 13 Sofia, Bulgaria — 2 nights 14 Ohrid, Republic of North Macedonia — 2 nights bus: 3h 15 Skopje, Republic of North Macedonia — 2 nights 16 Tirana, Albania — 2 nights Drive: 1h 45min 17 Shkoder, Albania — 2 nights bus: 4h 18 Kotor, Montenegro — 4 nights Fly: 4h 45min 19 Berlin, Germany — 3 nights Fly: 10h 45min End: Toronto, Canada 2 nights Berlin, Germany Berlin © The country's capital and largest city, Berlin is a diverse urban center boasting a lively nightlife and countless things to do. Berlin is known for museums, historic sites, nightlife, parks, and shopping. Your plan includes some of its best attractions: get up close and personal with brilliant marine life at Zoo Berlin, admire the landmark architecture of Berliner Dom, pause for some photo ops at Victory Column (Siegessaule), and enjoy breathtaking views from Berlin TV Tower (Fernsehturm). Quickly create a custom-made itinerary for Berlin using our trip planner. Toronto, Canada to Berlin is an approximately 11-hour flight. You can also do a combination of ferry and flight; or do a combination of flight and train. Due to the time zone difference, you'll lose 6 hours traveling from Toronto to Berlin. Wrap up your sightseeing on the 4th (Sun) to allow time to travel to Tallinn. Things to do in Berlin Historic Sites Parks Zoos & Aquariums Find places to stay Apr 2 — 4: Highlights from your plan Memorial of the Berlin Wall © Memorial of the Berlin Wall Zoo Berlin © Zoo Berlin Charlottenburg Palace © Charlottenburg Palace 4 nights Tallinn, Estonia Tallinn © A historic city with its eye firmly on the future, Tallinn blends medieval fortifications, gleaming skyscrapers, and charming boutiques with a spattering of Soviet relics. Tallinn is known for historic sites, museums, parks, fun & games, and nightlife. Your plan includes some of its best attractions: wander the streets of Tallinn Old Town, examine the collection at Lennusadam Seaplane Harbour, test your problem-solving skills at popular escape rooms, and stroll around Kadriorg Park. To see reviews, photos, traveler tips, and more tourist information, use the Tallinn vacation maker tool . Traveling by flight from Berlin to Tallinn takes 4.5 hours. Alternatively, you can drive; or do a combination of train and bus. Traveling from Berlin to Tallinn, you'll lose 1 hour due to the time zone difference. In April in Tallinn, expect temperatures between 9°C during the day and 0°C at night. Finish up your sightseeing early on the 8th (Thu) so you can travel to Riga. Things to do in Tallinn Historic Sites Museums Neighborhoods Find places to stay Apr 4 — 8: Highlights from your plan Toompea Hill © Toompea Hill Tallinn Old Town © Tallinn Old Town Room Escape Games 2 nights Riga, Latvia Riga © Often referred to as "The Paris of the North," Riga offers thriving nightlife and some of the best collections of Art Nouveau architecture in Europe. Riga is known for museums, historic sites, shopping, fun & games, and nightlife. Your plan includes some of its best attractions: make a trip to Old City Riga (Vecriga), admire the striking features of House of the Black Heads, browse the eclectic array of goods at Central Market (Centraltirgus), and get engrossed in the history at Latvijas Okupācijas muzejs. To see other places to visit, photos, where to stay, and more tourist information, read our Riga itinerary builder . Getting from Tallinn to Riga by flight takes about 3 hours. Other options: drive; or take a bus. April in Riga sees daily highs of 13°C and lows of 2°C at night. Wrap up your sightseeing on the 10th (Sat) to allow time to travel to Vilnius. Things to do in Riga Outdoors Parks Beaches Side Trip Jurmala Beach Find places to stay Apr 8 — 10: Highlights from your plan Jurmala Beach © Jurmala Beach Old City Riga (Vecriga) © Old City Riga (Vecriga) Freedom Monument © Freedom Monument 2 nights Vilnius, Lithuania Vilnius © The capital of Lithuania, Vilnius, boasts an impressive medieval quarter--one of the continent's largest and a World Heritage Site with almost 2,000 historical buildings. On the 11th (Sun), examine the collection at KGB Museum (Genocido Auku Muziejus), take a stroll through Vilnius Old Town, then get engrossed in the history at Gediminas Castle Tower, and finally take your sightseeing to a higher altitude at Hill of Three Crosses. Get ready for a full day of sightseeing on the next day: admire the striking features of Trakai Island Castle Museum. For reviews, ratings, more things to do, and more tourist information, use the Vilnius trip maker . Getting from Riga to Vilnius by flight takes about 3 hours. Other options: drive; or take a bus. April in Vilnius sees daily highs of 13°C and lows of 1°C at night. Finish your sightseeing early on the 12th (Mon) to allow enough time to travel to Gdansk. Things to do in Vilnius Museums Neighborhoods Nature Side Trip Trakai Island Castle Museum Find places to stay Apr 10 — 12: Highlights from your plan Trakai Island Castle Museum © Trakai Island Castle Museum Gediminas Castle Tower © Gediminas Castle Tower KGB Museum (Genocido Auku Muziejus) © 2 nights Gdansk, Poland Gdansk © Although its history goes back a thousand years, Gdansk represents one of Poland's most modern urban centers, its thriving economy boosted by a lively tourism sector. Kick off your visit on the 13th (Tue): get engrossed in the history at Europejskie Centrum SolidarnoSci, take in the spiritual surroundings of St. Mary's Church, then don't miss a visit to Dluga Street (ul. Dluga), and finally wander the streets of Old Town. Get ready for a full day of sightseeing on the 14th (Wed): explore the historical opulence of Muzeum Zamkowe w Malborku, take some stellar pictures from AmberSky Gdansk - Kolo Widokowe, and then brush up on your military savvy at Museum of the Second World War (Muzeum II Wojny Swiatowej). To find other places to visit, more things to do, and other tourist information, read Gdansk road trip planning site . Traveling by flight from Vilnius to Gdansk takes 4 hours. Alternatively, you can drive; or take a train. The time zone difference moving from Eastern European Time to Central European Time is minus 1 hour. In April, daytime highs in Gdansk are 13°C, while nighttime lows are 2°C. Finish up your sightseeing early on the 14th (Wed) so you can catch the train to Warsaw. Things to do in Gdansk Museums Historic Sites Neighborhoods Side Trip Muzeum Zamkowe w Malborku Find places to stay Apr 12 — 14: Highlights from your plan St. Mary's Church © St. Mary's Church Old Town © Old Town 2 nights Warsaw, Poland Warsaw © Warsaw draws big crowds with its seemingly unstoppable energy, exemplified by the city's explosive nightlife and thriving music scene. Start off your visit on the 15th (Thu): take in the local highlights with Walking tours, explore the historical opulence of Zamek Krolewski w Warszawie - Muzeum, then pause for some photo ops at Pomnik Bohaterów Getta, and finally get to know the fascinating history of Old Town. Get ready for a full day of sightseeing on the next day: explore the world behind art at Museum of King Jan III's Palace at Wilanow, admire the natural beauty at Lazienki Krolewskie w Warszawie, then appreciate the history behind Statue of John III Sobieski, then learn about all things military at Muzeum Powstania Warszawskiego, and finally don't miss a visit to Palace of Culture and Science. For where to stay, more things to do, traveler tips, and more tourist information, refer to the Warsaw trip itinerary planner . Getting from Gdansk to Warsaw by train takes about 3 hours. Other options: fly; or drive. April in Warsaw sees daily highs of 15°C and lows of 4°C at night. Wrap up your sightseeing on the 16th (Fri) to allow time to travel to Bratislava. Things to do in Warsaw Museums Historic Sites Tours Find places to stay Apr 14 — 16: Highlights from your plan Lazienki Krolewskie w Warszawie © Lazienki Krolewskie w Warszawie Old Town © Old Town Walking tours 2 nights Bratislava, Slovakia Bratislava © Slovakia's capital, Bratislava, attracts visitors for its natural beauty and rich culture, offering a plethora of landscapes, outdoor activities, historical monuments, and a stately old town. Kick off your visit on the 17th (Sat): get engrossed in the history at Devin Castle, take in the spiritual surroundings of Blue Church of St. Elizabeth, then appreciate the history behind Cumil, then enjoy breathtaking views from UFO Observation Deck, and finally contemplate the long history of Michalska Brana. On your second day here, get to know the fascinating history of Bratislava Old Town, then take in the spiritual surroundings of St. Martin's Cathedral (Dom svateho Martina), then explore the historical opulence of Bratislava Castle, and finally make a trip to Slavin War Memorial. Before you visit Bratislava, use our trip planner to discover what you can do and see there. You can fly from Warsaw to Bratislava in 4.5 hours. Other options are to do a combination of flight and bus; or drive. When traveling from Warsaw in April, plan for somewhat warmer days and about the same nights in Bratislava: temperatures range from 19°C by day to 6°C at night. Wrap up your sightseeing on the 18th (Sun) to allow time to travel to Ljubljana. Things to do in Bratislava Historic Sites Neighborhoods Museums Find places to stay Apr 16 — 18: Highlights from your plan Devin Castle © Devin Castle Bratislava Castle © Bratislava Castle Michalska Brana © Michalska Brana 6 nights Ljubljana, Slovenia The capital of Slovenia, Ljubljana melds German, Mediterranean, and Slovenian culture and history. Venture out of the city with trips to Postojna (Postojna Cave & Predjama Castle) and Bled (Lake Bled, Vintgar Gorge, & more). There's lots more to do: let your taste buds guide you at a local gastronomic tour, contemplate the waterfront views at River Ljubljanica Kanal, test your problem-solving skills at popular escape rooms, and take a stroll through Metelkova. For photos, traveler tips, maps, and tourist information, read our Ljubljana trip itinerary planning site . You can do a combination of bus and flight from Bratislava to Ljubljana in 3.5 hours. Alternatively, you can drive; or do a combination of bus, flight, and shuttle. In April, daily temperatures in Ljubljana can reach 19°C, while at night they dip to 5°C. Cap off your sightseeing on the 25th (Sun) early enough to go by car to Budapest. Things to do in Ljubljana Parks Nature Historic Sites Side Trips Bled, Postojna, Dr. France Preseren Memorial Museum Find places to stay Apr 18 — 25: Highlights from your plan Food Tours Lake Bled © Lake Bled Room Escape Games 2 nights Budapest, Hungary Budapest © You might consider the city of Budapest, divided by the Danube River into two distinctive cities--Buda and Pest--to be essentially one large World Heritage Site. Budapest is known for historic sites, spas, nightlife, museums, and nature. Your plan includes some of its best attractions: ponder the world of politics at Hungarian Parliament Building, contemplate the long history of Matthias Church, take in the views from Szechenyi Chain Bridge, and examine the collection at House of Terror Museum. To see where to stay, ratings, maps, and other tourist information, you can read our Budapest planner . You can drive from Ljubljana to Budapest in 4.5 hours. Alternatively, you can take a shuttle; or take a bus. In April in Budapest, expect temperatures between 20°C during the day and 5°C at night. Wrap up your sightseeing on the 27th (Tue) early enough to travel to Sarajevo. Things to do in Budapest Historic Sites Spas Museums Find places to stay Apr 25 — 27: Highlights from your plan Hungarian Parliament Building © Hungarian Parliament Building Halaszbastya © Halaszbastya Matthias Church © Matthias Church 5 nights Sarajevo, Bosnia and Herzegovina Nearly destroyed by war during the 1990s, the riverside city of Sarajevo now serves as one of the region's major educational, cultural, and commercial hubs. Change things up with a short trip to Jablanicas Lake in Mostar (about 1h 25 min away). And it doesn't end there: get the lay of the land with Walking tours, trek along Vrelo Bosne, take in the views from Latin Bridge, and explore the world behind art at Galerija 11/07/95. To plan Sarajevo vacation without wasting time, ask Inspirock to design an itinerary. Fly from Budapest to Sarajevo in 4 hours. Alternatively, you can do a combination of shuttle and flight; or drive. Finish your sightseeing early on the 2nd (Sun) to allow enough time to travel to Belgrade. Things to do in Sarajevo Parks Trails Historic Sites Side Trip Jablanicas Lake Find places to stay Apr 27 — May 2: Highlights from your plan Walking tours Vrelo Bosne © Vrelo Bosne Bascarsija © Bascarsija 2 nights Belgrade, Serbia The capital and largest city of Serbia, cosmopolitan Belgrade sits on the confluence of the Sava and the Danube rivers. On the 2nd (Sun), wander the streets of Skadarlija, then take a stroll through Knez Mihailova, then test your team's savvy at popular escape rooms, and finally contemplate in the serene atmosphere at St. Sava Temple (Hram Svetog Save). Keep things going the next day: get the lay of the land with Walking tours, contemplate the long history of Kalemegdan, and then take in the exciting artwork at Art for All. To see ratings, maps, reviews, and tourist information, refer to the Belgrade trip itinerary maker website . You can fly from Sarajevo to Belgrade in 2.5 hours. Alternatively, you can drive; or take a bus. In May, daily temperatures in Belgrade can reach 26°C, while at night they dip to 13°C. Finish your sightseeing early on the 4th (Tue) to allow enough time to travel to Bucharest. Things to do in Belgrade Tours Parks Outdoors Find places to stay May 2 — 4: Highlights from your plan Room Escape Games Kalemegdan © Kalemegdan Ada Ciganlija © Ada Ciganlija 2 nights Bucharest, Romania The booming city of Bucharest is a sophisticated metropolis with a high contrast of old- and new-world architecture. On the 5th (Wed), get a sense of history and politics at Palace of Parliament, don't miss a visit to Stavropoleos Monastery, then admire the landmark architecture of Muzeul National al Satului "Dimitrie Gusti", and finally stroll around Herăstrău Park. Keep things going the next day: take in the local highlights with Walking tours and then appreciate the extensive heritage of Old Town. You can plan Bucharest trip in no time by asking Inspirock to help create your itinerary. You can fly from Belgrade to Bucharest in 5.5 hours. Alternatively, you can drive; or do a combination of bus and train. The time zone changes from Central European Time (CET) to Eastern European Time (EET), which is usually a 1 hour difference. In May, plan for daily highs up to 27°C, and evening lows to 11°C. Finish your sightseeing early on the 6th (Thu) to allow enough time to travel to Sofia. Things to do in Bucharest Tours Parks Historic Sites Find places to stay May 4 — 6: Highlights from your plan Walking tours Palace of Parliament © Palace of Parliament 2 nights Sofia, Bulgaria Spend time in one of Europe's oldest cities, the vibrant Bulgarian capital of Sofia. On the 7th (Fri), get the lay of the land with Walking tours, then test your problem-solving skills at popular escape rooms, and then admire the striking features of Temple Sveti Nikolay. Here are some ideas for day two: look for gifts at Chilli Hills, then wander the streets of Vitosha Boulevard, then contemplate in the serene atmosphere at St. Alexander Nevski Cathedral, and finally appreciate the history behind Saint Sofia Monument. To see traveler tips, other places to visit, photos, and more tourist information, read our Sofia day trip planning site . Traveling by flight from Bucharest to Sofia takes 5 hours. Alternatively, you can drive; or take a bus. In May, plan for daily highs up to 26°C, and evening lows to 11°C. Cap off your sightseeing on the 8th (Sat) early enough to go by car to Ohrid. Things to do in Sofia Tours Historic Sites Shopping Find places to stay May 6 — 8: Highlights from your plan Walking tours Room Escape Games St. Alexander Nevski Cathedral © St. Alexander Nevski Cathedral 2 nights Ohrid, Republic of North Macedonia Ohrid © Located on Lake Ohrid, the town of Ohrid earned the nickname Jerusalem of the Balkans because it was once home to 365 churches. Start off your visit on the 9th (Sun): take in the spiritual surroundings of Saint Sophia, then steep yourself in history at St. Jovan Kaneo, and then contemplate the waterfront views at Lake Ohrid. Here are some ideas for day two: make a trip to Samoil's Fortress, pause for some serene contemplation at Holy Mary Perybleptos, and then contemplate the long history of Monastery Saint Naum. To find reviews, where to stay, maps, and more tourist information, read our Ohrid attractions tool . You can drive from Sofia to Ohrid in 6 hours. Other options are to take a bus; or do a combination of bus and train. Traveling from Sofia to Ohrid, you'll gain 1 hour due to the time zone difference. In May, daytime highs in Ohrid are 24°C, while nighttime lows are 11°C. Finish up your sightseeing early on the 10th (Mon) so you can go by car to Skopje. Things to do in Ohrid Historic Sites Nature Parks Find places to stay May 8 — 10: Highlights from your plan Monastery Saint Naum © Monastery Saint Naum Lake Ohrid © Lake Ohrid St. Jovan Kaneo © St. Jovan Kaneo 2 nights Skopje, Republic of North Macedonia Skopje © A melting pot of cultures from Roman, Byzantine, Ottoman, and Yugoslavian rule, Skopje serves as the nation's eclectic capital. Kick off your visit on the 11th (Tue): admire the architecture and history at Memorial House of Mother Teresa, explore the activities along Lake Matka, and then wander the streets of Old Bazaar, Skopje. Get ready for a full day of sightseeing on the 12th (Wed): take in the spiritual surroundings of Xhamia E Larme, then view the masterpieces at Acanthus Gallery, then appreciate the extensive heritage of Macedonia Square, and finally snap pictures at The Stone Bridge. To see traveler tips, photos, other places to visit, and tourist information, refer to the Skopje online travel planner . Getting from Ohrid to Skopje by car takes about 3 hours. Other options: take a bus; or do a combination of bus and train. When traveling from Ohrid in May, plan for a bit warmer days in Skopje, with highs around 28°C, while nights are about the same with lows around 11°C. Finish your sightseeing early on the 12th (Wed) to allow enough time to drive to Tirana. Things to do in Skopje Historic Sites Nature Parks Side Trip Xhamia E Larme Find places to stay May 10 — 12: Highlights from your plan Old Bazaar, Skopje © Old Bazaar, Skopje Lake Matka © Lake Matka The Stone Bridge © The Stone Bridge 2 nights Tirana, Albania Tirana © Tirana, the largest city in Albania, represents one a lively and fast-paced metropolis. Kick off your visit on the 13th (Thu): stroll around Grand Park (Parku i Madh), learn about all things military at BunkArt 1, admire the landmark architecture of Enver Hoxha Pyramid, then get engrossed in the history at Muzeu Historik Kombetar, and finally don't miss a visit to Skanderbeg Square. Here are some ideas for day two: contemplate in the serene atmosphere at Et`hem Bey Mosque and then take in the awesome beauty at Dajti. For other places to visit, traveler tips, maps, and tourist information, read Tirana attractions planner . Drive from Skopje to Tirana in 4 hours. Alternatively, you can take a bus; or do a combination of train and bus. May in Tirana sees daily highs of 28°C and lows of 14°C at night. Finish your sightseeing early on the 14th (Fri) to allow enough time to drive to Shkoder. Things to do in Tirana Parks Nature Museums Find places to stay May 12 — 14: Highlights from your plan Dajti © Dajti Muzeu Historik Kombetar © Muzeu Historik Kombetar Skanderbeg Square © Skanderbeg Square 2 nights Shkoder, Albania Shkoder © Its geographic location has made Shkoder, one of Europe's oldest cities, an important cultural and economic center of the Balkans over the years. Start off your visit on the 15th (Sat): see the interesting displays at Marubi National Museum of Photography, admire the striking features of Former Palace of King Nikola I, then step into the grandiose world of Rozafa Castle, and finally explore the activities along Shkodra Lake. Get ready for a full day of sightseeing on the 16th (Sun): take in the exciting artwork at Venice Art Mask Factory and then take in the views from Mesi Bridge. To see reviews, maps, other places to visit, and other tourist information, read Shkoder journey maker . You can drive from Tirana to Shkoder in 2 hours. Alternatively, you can take a bus. Expect a daytime high around 28°C in May, and nighttime lows around 16°C. On the 16th (Sun), wrap the sightseeing up by early afternoon so you can drive to Kotor. Things to do in Shkoder Museums Historic Sites Nature Find places to stay May 14 — 16: Highlights from your plan Marubi National Museum of Photography © Rozafa Castle © Rozafa Castle Venice Art Mask Factory © Venice Art Mask Factory 4 nights Kotor, Montenegro Kotor © Perched on the edge of a fjord-like bay rimmed by rugged mountains, Kotor grew around a medieval settlement purposely built like a maze. Kotor is known for historic sites, nature, adventure, museums, and shopping. Your plan includes some of its best attractions: explore the activities along Bay of Kotor, take some stellar pictures from Viewing Point at the Road Kotor-Lovcen, race across the water with a speed boat tour, and take in the pleasant sights at St John Fortress. To find more things to do and more tourist information, read our Kotor online trip builder . Traveling by car from Shkoder to Kotor takes 2.5 hours. Alternatively, you can take a bus. Traveling from Shkoder in May, plan for slightly colder nights in Kotor, with lows around 13°C. Wrap up your sightseeing on the 20th (Thu) early enough to travel to Berlin. Things to do in Kotor Historic Sites Outdoors Tours Side Trip R.K.C. Gospa od Škrpjela Find places to stay May 16 — 20: Highlights from your plan Stari Grad Kotor © Stari Grad Kotor Bay of Kotor © Bay of Kotor Fishing Charters & Tours 3 nights Berlin, Germany Berlin © Kick off your visit on the 21st (Fri): admire the masterpieces at Pergamonmuseum, ponder the world of politics at Reichstag Building, then pause for some photo ops at The Holocaust Memorial - Memorial to the Murdered Jews of Europe, and finally pause for some photo ops at Brandenburg Gate. On the 22nd (Sat), you'll have a packed day of sightseeing: see the interesting displays at Topography of Terror, then take in the local highlights with Walking tours, and then have some family-friendly fun at WINDOBONA Indoor Skydiving Berlin. To find traveler tips, ratings, maps, and more tourist information, you can read our Berlin trip planner . You can fly from Kotor to Berlin in 5 hours. Other options are to drive; or do a combination of car and train. On the 23rd (Sun), wrap the sightseeing up by early afternoon so you can travel back home. Things to do in Berlin Museums Tours Historic Sites Find places to stay May 20 — 23: Highlights from your plan Brandenburg Gate © Brandenburg Gate Reichstag Building © Reichstag Building Similar Plans 15 days in Eastern Europe BY A USER FROM SOUTH AFRICA August, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, slow & easy, popular sights PREFERENCES: August, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular sights PACE: Slow & easy 17 days in Berlin, Eastern Europe & Vienna BY A USER FROM UNITED STATES March, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, slow & easy, hidden gems PREFERENCES: March, culture, outdoors, relaxing, romantic, beaches, historic sites, museums ATTRACTION STYLE: Hidden gems PACE: Slow & easy 22 days in Eastern Europe BY A USER FROM SOUTH AFRICA August, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife, popular sights PREFERENCES: August, culture, outdoors, relaxing, romantic, beaches, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular sights PACE: Medium 30 days in Eastern Europe BY A USER FROM AUSTRALIA September, culture, outdoors, relaxing, romantic, historic sites, museums, shopping, wildlife, popular sights PREFERENCES: September, culture, outdoors, relaxing, romantic, historic sites, museums, shopping, wildlife ATTRACTION STYLE: Popular sights PACE: Medium 20 days in London, Marne-la-Vallee & Eastern Europe BY A USER FROM MALAYSIA December, culture, outdoors, relaxing, romantic, historic sites, museums, shopping, popular & hidden gems PREFERENCES: December, culture, outdoors, relaxing, romantic, historic sites, museums, shopping ATTRACTION STYLE: Popular & hidden gems PACE: Medium 11 days in Eastern Europe & Vienna BY A USER FROM CANADA November, culture, relaxing, romantic, historic sites, museums, shopping, popular & hidden gems PREFERENCES: November, culture, relaxing, romantic, historic sites, museums, shopping ATTRACTION STYLE: Popular & hidden gems PACE: Medium 21 days in Eastern Europe BY A USER FROM UNITED STATES June, culture, relaxing, beaches, historic sites, museums, shopping, popular & hidden gems PREFERENCES: June, culture, relaxing, beaches, historic sites, museums, shopping ATTRACTION STYLE: Popular & hidden gems PACE: Medium 17 days in Eastern Europe, London & Marne-la-Vallee BY A USER FROM MALAYSIA December, culture, romantic, historic sites, museums, shopping, popular & hidden gems PREFERENCES: December, culture, romantic, historic sites, museums, shopping ATTRACTION STYLE: Popular & hidden gems PACE: Medium 11 days in Eastern Europe BY A USER FROM CANADA October, culture, outdoors, beaches, historic sites, wildlife, hidden gems PREFERENCES: October, culture, outdoors, beaches, historic sites, wildlife ATTRACTION STYLE: Hidden gems PACE: Medium 35 days in Eastern Europe BY A USER FROM BRAZIL April, culture, outdoors, romantic, historic sites, museums, hidden gems PREFERENCES: April, culture, outdoors, romantic, historic sites, museums ATTRACTION STYLE: Hidden gems PACE: Medium 43 days in Western Europe & Central Europe BY A USER FROM AUSTRALIA October, teens, culture, outdoors, relaxing, beaches, historic sites, wildlife, popular sights PREFERENCES: October, teens, culture, outdoors, relaxing, beaches, historic sites, wildlife ATTRACTION STYLE: Popular sights PACE: Medium 11 days in Eastern Europe & Vienna BY A USER FROM UNITED STATES September, culture, relaxing, historic sites, museums, shopping, popular sights PREFERENCES: September, culture, relaxing, historic sites, museums, shopping ATTRACTION STYLE: Popular sights PACE: Medium View more plans SweetFX Settings DB Latest forum threads 2 days, 3 hours ago 9 months, 3 weeks ago 9 months, 4 weeks ago 9 months, 4 weeks ago Thief w/ Sweetfx 2.0 and Reshade 0.19.2 - Solution Posted 4 years ago Nowhere could I find out how to get Sweetfx working with thief, but alas, I figured it out. -Drop all sweetfx files including (but only one of) the Reshade Dll's (Reshade32.Dll and Reshade64.DLL) to: 64 bit users -username\steamapps\common\Thief\Binaries2\Win64. 32 Bit users - username\steamapps\common\Thief\Binaries2\Win32. -Now rename the Reshade .DLL to "dxgi.dll" if running DX10 or DX11. Rename it to "D3D9.dll" if running DX9. (The instructions are in the readme in the main Sweetfx folder) Now, right click .exe "shipping-thiefgame" and check "run as administrator" under compatibility tab. Boot up game. You should see a prompt in white acknowledging that Reshade is working and installed properly Here is the clutch move - For some reason in this game you need to enable in game SSAA. The graphical anomalies in the main menu should disappear when you enable SSAA. They did for me anyway... Remember: only use Reshade32.dll or Reshade64.dll depending on which version you are running, make sure to rename it after copied, and copy sweetfx files into Binaries 2 not Binaries. I hope this helps someone else out there Enjoy this Preset by Proudi- https://sfx.thelazy.net/games/preset/3846/ Enjoy! -Vermonster New post Please log in to post an answer	# 53 Days in Berlin & Eastern Europe Itinerary Created using Inspirock Europe trip planner Start: Toronto, Canada End: Toronto, Canada --- ## Route & Dates 1. Berlin, Germany — 2 nights 2. Tallinn, Estonia — 4 nights 3. Riga, Latvia — 2 nights 4. Vilnius, Lithuania — 2 nights 5. Gdańsk, Poland — 2 nights 6. Warsaw, Poland — 2 nights 7. Bratislava, Slovakia — 2 nights 8. Ljubljana, Slovenia — 6 nights 9. Budapest, Hungary — 2 nights 10. Sarajevo, Bosnia and Herzegovina — 5 nights 11. Belgrade, Serbia — 2 nights 12. Bucharest, Romania — 2 nights 13. Sofia, Bulgaria — 2 nights 14. Ohrid, North Macedonia — 2 nights 15. Skopje, North Macedonia — 2 nights 16. Tirana, Albania — 2 nights 17. Shkodër, Albania — 2 nights 18. Kotor, Montenegro — 4 nights 19. Berlin, Germany — 3 nights --- ## 1. Berlin, Germany (2 nights) - Zoo Berlin - Berliner Dom - Victory Column (Siegessäule) - Berlin TV Tower (Fernsehturm) ## 2. Tallinn, Estonia (4 nights) - Tallinn Old Town - Lennusadam Seaplane Harbour - Escape rooms - Kadriorg Park ## 3. Riga, Latvia (2 nights) - Old City Riga (Vecrīga) - House of the Black Heads - Central Market (Centrāltirgus) - Latvijas Okupācijas muzejs ## 4. Vilnius, Lithuania (2 nights) - KGB Museum (Genocido Aukų Muziejus) - Vilnius Old Town - Gediminas Castle Tower - Hill of Three Crosses - Trakai Island Castle Museum (side trip) ## 5. Gdańsk, Poland (2 nights) - Europejskie Centrum Solidarności - St. Mary’s Church - Długa Street (ul. Długa) - Old Town - Muzeum Zamkowe w Malborku (side trip) ## 6. Warsaw, Poland (2 nights) - Walking tours - Royal Castle (Zamek Królewski) - Ghetto Heroes Monument (Pomnik Bohaterów Getta) - Old Town - Łazienki Królewskie - Museum of the Warsaw Uprising - Palace of Culture and Science ## 7. Bratislava, Slovakia (2 nights) - Devin Castle - Blue Church of St. Elizabeth - Cumil (the “Man at Work” statue) - UFO Observation Deck - Michael’s Gate (Michalská brána) - Bratislava Old Town - St. Martin’s Cathedral - Bratislava Castle - Slavin War Memorial ## 8. Ljubljana, Slovenia (6 nights) - River Ljubljanica - Metelkova - Local food tour - Escape rooms - Postojna Cave & Predjama Castle (side trip) - Lake Bled & Vintgar Gorge (side trip) - Dr. France Prešeren Memorial Museum (side trip) ## 9. Budapest, Hungary (2 nights) - Hungarian Parliament Building - Matthias Church - Széchenyi Chain Bridge - House of Terror Museum ## 10. Sarajevo, Bosnia and Herzegovina (5 nights) - Walking tours - Vrelo Bosne - Latin Bridge - Galerija 11/07/95 - Jablanica Lake (side trip) ## 11. Belgrade, Serbia (2 nights) - Skadarlija (Bohemian Quarter) - Knez Mihailova Street - Escape rooms - St. Sava Temple - Kalemegdan Fortress & Park - Art for All ## 12. Bucharest, Romania (2 nights) - Palace of Parliament - Stavropoleos Monastery - Village Museum (“Muzeul Național al Satului”) - Herăstrău Park - Walking tours - Old Town ## 13. Sofia, Bulgaria (2 nights) - Walking tours - Escape rooms - Temple Sveti Nikolay - Chilli Hills shopping - Vitosha Boulevard - St. Alexander Nevsky Cathedral - Saint Sofia Monument ## 14. Ohrid, North Macedonia (2 nights) - Saint Sophia Church - Church of St. John at Kaneo - Lake Ohrid - Samoil’s Fortress - Holy Mary Perybleptos - Monastery of Saint Naum ## 15. Skopje, North Macedonia (2 nights) - Memorial House of Mother Teresa - Lake Matka - Old Bazaar - Xhamia e Larmë (“Painted Mosque”) - Acanthus Gallery - Macedonia Square - Stone Bridge ## 16. Tirana, Albania (2 nights) - Grand Park (Parku i Madh) - Bunk’Art 1 - Enver Hoxha Pyramid - National History Museum (Muzeu Historik Kombëtar) - Skanderbeg Square - Et`hem Bey Mosque - Dajti Mountain ## 17. Shkodër, Albania (2 nights) - Marubi National Museum of Photography - Former Palace of King Nikola I - Rozafa Castle - Shkodër Lake - Venice Art Mask Factory - Mesi Bridge ## 18. Kotor, Montenegro (4 nights) - Bay of Kotor - Viewing Point on the Kotor–Lovćen road - Speed boat tour - St. John Fortress - Our Lady of the Rocks (Gospa od Škrpjela) ## 19. Berlin, Germany (3 nights) - Pergamonmuseum - Reichstag Building - Holocaust Memorial (Memorial to the Murdered Jews of Europe) - Brandenburg Gate - Topography of Terror - Walking tours - WINDOBONA Indoor Skydiving Berlin --- Enjoy your trip! --- # Thief w/ Sweetfx 2.0 and Reshade 0.19.2 – Solution Posted 4 years ago by Vermonster Nowhere could I find out how to get SweetFX working with Thief, but alas, I figured it out. ## Installation Steps 1. Drop all SweetFX files including only one of the Reshade DLLs into the game folder: - 64-bit users: ``` %username%\steamapps\common\Thief\Binaries2\Win64 ``` - 32-bit users: ``` %username%\steamapps\common\Thief\Binaries2\Win32 ``` 2. Rename the Reshade DLL you placed there: - If running DX10 or DX11 → `dxgi.dll` - If running DX9 → `d3d9.dll` (Instructions are in the SweetFX readme.) 3. Right-click `shipping-thiefgame.exe`, go to the Compatibility tab, and enable Run as administrator. 4. Boot up the game. You should see a white prompt acknowledging that ReShade is installed and working. 5. Clutch move: In-game SSAA must be enabled to remove graphical anomalies in the main menu. > Remember: > - Use only Reshade32.dll or Reshade64.dll (matching your game version). > - Copy SweetFX files into Binaries2, not Binaries. Enjoy this preset by Proudi → https://sfx.thelazy.net/games/preset/3846/	7,228	1,667	-8,788,235,025,564,359,000	concat	[ "concat_full" ]	0.75	false	null
-3,511,436,853,077,284,400	[Date Prev][Date Next][Thread Prev][Thread Next][Date Index][Thread Index] [List Home] [tycho-dev] Tycho 0.13.0 Release Hi Igor, We would like to have a Tycho 0.13.0 release with the current state. There are still a few bugs scheduled for 0.13.0, but I don’t consider them urgent enough to postpone the release further. We have achieved quite a bit in 0.13.0 (see release notes/bug list), and we (at SAP) would like to be able to benefit from these achievements. Could you please do the version update and stage 0.13.0? I don’t mind if we use the merge or cherry-pick branching approach (we discussed last time ;-) I actually rather see the advantages of the cherry-pick approach we used the last time... Best regards Tobias Already registered? Login! No registered yet? • If your team is certified on 2019: register to access all the contents of the website • If your team isn’t certified on 2019: registrations are already full for the 2019 season. Register now to be on the calling list for the 2020 season! Inscription - Registration Veuillez compléter ce formulaire pour vous inscrire - Please fill in the form below to register. • Strength Indicator	# [tycho-dev] Tycho 0.13.0 Release Hi Igor, We would like to have a Tycho 0.13.0 release with the current state. There are still a few bugs scheduled for 0.13.0, but I don’t consider them urgent enough to postpone the release further. We have achieved quite a bit in 0.13.0 (see release notes/bug list), and we (at SAP) would like to be able to benefit from these achievements. Could you please do the version update and stage 0.13.0? I don’t mind if we use the merge or cherry-pick branching approach (we discussed last time ;-) I actually rather see the advantages of the cherry-pick approach we used the last time... Best regards, Tobias --- # Already registered? Login! ## Not registered yet? - If your team is certified on 2019: register to access all the contents of the website - If your team isn’t certified on 2019: registrations are already full for the 2019 season. Register now to be on the calling list for the 2020 season! # Inscription – Registration Veuillez compléter ce formulaire pour vous inscrire – Please fill in the form below to register.	286	263	-3,511,436,853,077,284,400	concat	[ "concat_full" ]	0.75	true	null
7,653,230,663,302,315,000	virtual-kubelet: github.com/virtual-kubelet/virtual-kubelet/node/api Index \| Files package api import "github.com/virtual-kubelet/virtual-kubelet/node/api" Package api implements HTTP handlers for handling requests that the kubelet would normally implement, such as pod logs, exec, etc. Index Package Files doc.go exec.go helpers.go logs.go pods.go server.go stats.go func AttachPodMetricsRoutes Uses func AttachPodMetricsRoutes(p PodMetricsConfig, mux ServeMux) AttachPodMetricsRoutes adds the http routes for pod/node metrics to the passed in serve mux. Callers should take care to namespace the serve mux as they see fit, however these routes get called by the Kubernetes API server. func AttachPodRoutes Uses func AttachPodRoutes(p PodHandlerConfig, mux ServeMux, debug bool) AttachPodRoutes adds the http routes for pod stuff to the passed in serve mux. Callers should take care to namespace the serve mux as they see fit, however these routes get called by the Kubernetes API server. func HandleContainerExec Uses func HandleContainerExec(h ContainerExecHandlerFunc) http.HandlerFunc HandleContainerExec makes an http handler func from a Provider which execs a command in a pod's container Note that this handler currently depends on gorrilla/mux to get url parts as variables. TODO(@cpuguy83): don't force gorilla/mux on consumers of this function func HandleContainerLogs Uses func HandleContainerLogs(h ContainerLogsHandlerFunc) http.HandlerFunc HandleContainerLogs creates an http handler function from a provider to serve logs from a pod func HandlePodStatsSummary Uses func HandlePodStatsSummary(h PodStatsSummaryHandlerFunc) http.HandlerFunc HandlePodStatsSummary makes an HTTP handler for implementing the kubelet summary stats endpoint func HandleRunningPods Uses func HandleRunningPods(getPods PodListerFunc) http.HandlerFunc func InstrumentHandler Uses func InstrumentHandler(h http.Handler) http.Handler InstrumentHandler wraps an http.Handler and injects instrumentation into the request context. func NotFound Uses func NotFound(w http.ResponseWriter, r http.Request) NotFound provides a handler for cases where the requested endpoint doesn't exist func NotImplemented Uses func NotImplemented(w http.ResponseWriter, r http.Request) NotImplemented provides a handler for cases where a provider does not implement a given API func PodHandler Uses func PodHandler(p PodHandlerConfig, debug bool) http.Handler PodHandler creates an http handler for interacting with pods/containers. func PodStatsSummaryHandler Uses func PodStatsSummaryHandler(f PodStatsSummaryHandlerFunc) http.Handler PodStatsSummaryHandler creates an http handler for serving pod metrics. If the passed in handler func is nil this will create handlers which only serves http.StatusNotImplemented type AttachIO Uses type AttachIO interface { Stdin() io.Reader Stdout() io.WriteCloser Stderr() io.WriteCloser TTY() bool Resize() <-chan TermSize } AttachIO is used to pass in streams to attach to a container process type ContainerExecHandlerFunc Uses type ContainerExecHandlerFunc func(ctx context.Context, namespace, podName, containerName string, cmd []string, attach AttachIO) error ContainerExecHandlerFunc defines the handler function used for "execing" into a container in a pod. type ContainerLogOpts Uses type ContainerLogOpts struct { Tail int Since time.Duration LimitBytes int Timestamps bool } ContainerLogOpts are used to pass along options to be set on the container log stream. type ContainerLogsHandlerFunc Uses type ContainerLogsHandlerFunc func(ctx context.Context, namespace, podName, containerName string, opts ContainerLogOpts) (io.ReadCloser, error) ContainerLogsHandlerFunc is used in place of backend implementations for getting container logs type PodHandlerConfig Uses type PodHandlerConfig struct { RunInContainer ContainerExecHandlerFunc GetContainerLogs ContainerLogsHandlerFunc GetPods PodListerFunc } type PodListerFunc Uses type PodListerFunc func(context.Context) ([]v1.Pod, error) type PodMetricsConfig Uses type PodMetricsConfig struct { GetStatsSummary PodStatsSummaryHandlerFunc } PodMetricsConfig stores the handlers for pod metrics routes It is used by AttachPodMetrics. The main reason for this struct is in case of expansion we do not need to break the package level API. type PodStatsSummaryHandlerFunc Uses type PodStatsSummaryHandlerFunc func(context.Context) (stats.Summary, error) PodStatsSummaryHandlerFunc defines the handler for getting pod stats summaries type ServeMux Uses type ServeMux interface { Handle(path string, h http.Handler) } ServeMux defines an interface used to attach routes to an existing http serve mux. It is used to enable callers creating a new server to completely manage their own HTTP server while allowing us to attach the required routes to satisfy the Kubelet HTTP interfaces. type TermSize Uses type TermSize struct { Width uint16 Height uint16 } TermSize is used to set the terminal size from attached clients. Package api imports 21 packages (graph) and is imported by 16 packages. Updated 2019-09-25. Refresh now. Tools for package owners. Connect with us Fashion Did you know? LGBTQ fans took fashion inspiration from Deepika Padukone for the pride parade in Vadodra – see pics Deepika Padukone’s LGBTQ fans celebrated the pride parade wearing outfits inspired by the actress’s Met Gala and Cannes attires Published at on Deepika at Cannes and Metgala Deepika Padukone's outfits at Met Gala and Cannes 2019; Picture Courtesy: Instagram Deepika Padukone has stolen many hearts since she stepped in Bollywood. Considering her flawless looks and amazing sartorial choices, the Chhappaak actress has been a favourite of many fashion connoisseurs. This year too Deepika made some remarkable fashion statements at international events like Cannes and Met Gala. And other than many of us, some LGBTQI fans also got inspired by the 33-year-old’s fashion choices. At the Vadodra pride parade, many were seen sporting outfits which were inspired by the ones the Padmaavat actress wore at Cannes and at Met gala. Deepika shared this one her Instagram stories, saying, “It was heartening to see them wear their vision of my Cannes and MET Gala outfits for the pride parade march in Vadodara. I came across some pictures of them and they looked absolutely stunning.” That was sweet, isn’t it? Let us know what you think about this? Comment in the section below and stay tuned to us for latest updates. Fashion Looking stylish and elegant! Sanya Malhotra steals the show in this ivory outfit Sanya Malhotra recently stunned everyone with her classy outfit and we surely can’t take our eyes off her. Published at on sanya-malhotra-stunning Sanya Malhotra Sanya Malhotra recently stunned everyone with her classy outfit and we surely can’t take our eyes off her. After looking at these pictures, you are all set to fall in love with her style statement. She is looking absolutely gorgeous! Sanya looks chic in this multicolored print blouse with balloon sleeves paired with flared palazzo’s. The actress completed her look with a pair of statement ring and sleek hair adding to it her peachy-pink makeup. sanya-malhotra-fashion sanya-malhotra-elegant Apart from acing it at work with flair over her artistry, Sanya Malhotra is gaining attention for all the right reasons. The actress is impressing everyone with her bodacious dance moves and lovable personality. sanya-malhotra-classy The Dangal girl is known to be the director’s actor and is always appreciated for the choice of her roles. Sanya made her debut with Bollywood’s highest-grossing movie. Since then, all the actors and directors have been praising her for her talent. The actress will now be next seen in Anurag Basu’s upcoming film. For more updates from Bollywood stay tuned to CineBlitz. Continue Reading Fashion Street Dancer 3 wrap up party: Shraddha Kapoor looks ethereal in a black outfit Shraddha Kapoor donned a sheath dress from Dolce and Gabbana Published at on Shraddha Kapoor in Dolce and Gabbana for Street Dancer 3 wrap-up party; Picture Credits- Instagram Shraddha Kapoor is one of the most in-demand actors this year and is a part of some massive films. One of them is Remo D’souza’s Street Dancer 3 with co-star Varun Dhawan. We’ve been seeing Shraddha’s overall journey for this movie on her Instagram handle, be it the hectic shoot schedules or the long practice sessions with the team. View this post on Instagram Little time pass is allowed @sushantkhatri148 #SD3 💖 A post shared by Shraddha (@shraddhakapoor) on Yesterday evening, the team of Street Dancer 3celebrated the wrap up party of the movie and the actress has left us stunned with her look! Kapoor wore a midi-sheath dress by Dolce and Gabbana. The dress was off-shouldered while it had sheer sleeves and a lace-up detail going on the middle of the dress. To complete the look, she did some subtle peachy make-up and left her curls open. And we must say she looks ethereal in this outfit. Apart from Street Dancer 3, we’ll see Shraddha in Saaho with the Bahubali actor Prabhaas. Saaho’s teaser is out and it has a great response. On the other hand, she is also a part of Chhichhore and Baaghi 3. Let us know in the comments section below, what are your thoughts on Shraddha’s black outfit and stay tuned to us for updates like these. Continue Reading Features Shah Rukh Khan, Salman Khan, Amitabh Bachchan- take a look into the dream abodes of these 5 celebs SRK, Salman Khan, John Abraham, here are five celebs whose homes boast royalty, elegance and magnificence Published at on shah-rukh-khan-salman-khan-amitabh-bachchan-homes Shah Rukh Khan- Salman Khan- Amitabh Bachchan. Picture Courtesy: Instagram It is often said that home is where our heart is and more so, homes are a reflection of our personality. The grandeur, the elegance, the quirks, each and every nook and corner of your home, speaks volumes about your character. Wealth, luxe and good taste, when mixed together, is often a treat to the eyes. And on our list today, we have top 5 Bollywood celebs, whose lavish homes we are in awe of. 1) Shah Rukh Khan (Mannat, Bandra)-The abode of King Khan is no less than a palace. With elegant interiors, it is truly a magnum opus with the perfect amalgamation of royalty and modernity. source: Instagram 2) Salman Khan (Galaxy Apartments, Bandra)- Just a few minutes away from SRK’s house, Salman Khan’s Galaxy Apartments flat too is a sight to see. Though not as extravagant as King Khan’s, Salman’s abode boasts simplicity and magnificence. Source: Instagram 3) John Abraham (Villa in the Sky, Juhu)- Only a few know that John is an architect as well. His penthouse was designed by him and his brother Alan Abraham. Overlooking the Arabian Sea, his house exudes a feeling of class and going by the pictures, John has kept the motto in mind that “Less is more.” Source: Instagram 4) Akshay Kumar (Jal Darshan- Juhu)-This one is one of our favourites above all. We all know that Khiladi Kumar’s wife and former actress Twinkle Khanna is the hand behind all the interiors in their abode. With clever use of grey and blue in each corner, to the paintings, and the quirks, Twinkle and Akshay’s home sweet home is no less than a dream. View this post on Instagram Early morning blues #coffeetime A post shared by Twinkle Khanna (@twinklerkhanna) on Source: Instagram 5) Amitabh Bachchan (Jalsa, Juhu)- While Big B has three bungalows in his name, Jalsa is where the family stays. Not many know that the actor got it as a gift from his Satte Pe Satta director Ramesh Sippy. The gorgeous bungalow has a living area of 10,125 square ft. The staircase in this twin storey house is full of family photos, which gives it a distinct and unique character. Source: Instagram Which one is your favourite? Let us know in the comment section below. Till then stay tuned to CineBlitz for latest updates. Continue Reading Trending >	# Package api Package api implements HTTP handlers for handling requests that the kubelet would normally implement, such as pod logs, exec, etc. ## Files - doc.go - exec.go - helpers.go - logs.go - pods.go - server.go - stats.go ## Functions ### func AttachPodMetricsRoutes ```go func AttachPodMetricsRoutes(p PodMetricsConfig, mux ServeMux) ``` AttachPodMetricsRoutes adds the HTTP routes for pod/node metrics to the passed-in serve mux. Callers should take care to namespace the serve mux as they see fit; these routes get called by the Kubernetes API server. --- ### func AttachPodRoutes ```go func AttachPodRoutes(p PodHandlerConfig, mux ServeMux, debug bool) ``` AttachPodRoutes adds the HTTP routes for pod operations to the passed-in serve mux. Callers should take care to namespace the serve mux as they see fit; these routes get called by the Kubernetes API server. --- ### func HandleContainerExec ```go func HandleContainerExec(h ContainerExecHandlerFunc) http.HandlerFunc ``` HandleContainerExec makes an HTTP handler func from a provider which execs a command in a pod's container. Note: this handler currently depends on gorilla/mux to get URL parts as variables. TODO: remove that dependency. --- ### func HandleContainerLogs ```go func HandleContainerLogs(h ContainerLogsHandlerFunc) http.HandlerFunc ``` HandleContainerLogs creates an HTTP handler function from a provider to serve logs from a pod. --- ### func HandlePodStatsSummary ```go func HandlePodStatsSummary(h PodStatsSummaryHandlerFunc) http.HandlerFunc ``` HandlePodStatsSummary makes an HTTP handler for implementing the kubelet summary stats endpoint. --- ### func HandleRunningPods ```go func HandleRunningPods(getPods PodListerFunc) http.HandlerFunc ``` --- ### func InstrumentHandler ```go func InstrumentHandler(h http.Handler) http.Handler ``` InstrumentHandler wraps an http.Handler and injects instrumentation into the request context. --- ### func NotFound ```go func NotFound(w http.ResponseWriter, r http.Request) ``` NotFound provides a handler for cases where the requested endpoint doesn't exist. --- ### func NotImplemented ```go func NotImplemented(w http.ResponseWriter, r http.Request) ``` NotImplemented provides a handler for cases where a provider does not implement a given API. --- ### func PodHandler ```go func PodHandler(p PodHandlerConfig, debug bool) http.Handler ``` PodHandler creates an HTTP handler for interacting with pods/containers. --- ### func PodStatsSummaryHandler ```go func PodStatsSummaryHandler(f PodStatsSummaryHandlerFunc) http.Handler ``` PodStatsSummaryHandler creates an HTTP handler for serving pod metrics. If the passed-in handler func is nil, this will create handlers which only serve http.StatusNotImplemented. ## Types ### interface AttachIO ```go type AttachIO interface { Stdin() io.Reader Stdout() io.WriteCloser Stderr() io.WriteCloser TTY() bool Resize() <-chan TermSize } ``` AttachIO is used to pass in streams to attach to a container process. --- ### type ContainerExecHandlerFunc ```go type ContainerExecHandlerFunc func( ctx context.Context, namespace, podName, containerName string, cmd []string, attach AttachIO, ) error ``` ContainerExecHandlerFunc defines the handler function used for "execing" into a container in a pod. --- ### type ContainerLogOpts ```go type ContainerLogOpts struct { Tail int Since time.Duration LimitBytes int Timestamps bool } ``` ContainerLogOpts are used to pass along options to be set on the container log stream. --- ### type ContainerLogsHandlerFunc ```go type ContainerLogsHandlerFunc func( ctx context.Context, namespace, podName, containerName string, opts ContainerLogOpts, ) (io.ReadCloser, error) ``` ContainerLogsHandlerFunc is used in place of backend implementations for getting container logs. --- ### type PodHandlerConfig ```go type PodHandlerConfig struct { RunInContainer ContainerExecHandlerFunc GetContainerLogs ContainerLogsHandlerFunc GetPods PodListerFunc } ``` --- ### type PodListerFunc ```go type PodListerFunc func(context.Context) ([]v1.Pod, error) ``` --- ### type PodMetricsConfig ```go type PodMetricsConfig struct { GetStatsSummary PodStatsSummaryHandlerFunc } ``` PodMetricsConfig stores the handlers for pod metrics routes. It is used by AttachPodMetricsRoutes. --- ### type PodStatsSummaryHandlerFunc ```go type PodStatsSummaryHandlerFunc func(context.Context) (stats.Summary, error) ``` PodStatsSummaryHandlerFunc defines the handler for getting pod stats summaries. --- ### interface ServeMux ```go type ServeMux interface { Handle(path string, h http.Handler) } ``` ServeMux defines an interface used to attach routes to an existing HTTP serve mux. --- ### struct TermSize ```go type TermSize struct { Width uint16 Height uint16 } ``` TermSize is used to set the terminal size from attached clients. --- ## Did you know? LGBTQ fans took fashion inspiration from Deepika Padukone for the pride parade in Vadodra – see pics ![Deepika at Cannes and Met Gala](#) Picture Courtesy: Instagram Deepika Padukone has stolen many hearts since she stepped in Bollywood. Considering her flawless looks and amazing sartorial choices, the Chhappaak actress has been a favourite of many fashion connoisseurs. This year too Deepika made some remarkable fashion statements at international events like Cannes and Met Gala. And other than many of us, some LGBTQI fans also got inspired by the 33-year-old’s fashion choices. At the Vadodra pride parade, many were seen sporting outfits which were inspired by the ones the Padmaavat actress wore at Cannes and at Met Gala. Deepika shared this on her Instagram stories, saying: > “It was heartening to see them wear their vision of my Cannes and MET Gala outfits for the pride parade march in Vadodara. I came across some pictures of them and they looked absolutely stunning.” --- ## Looking stylish and elegant! Sanya Malhotra steals the show in this ivory outfit ![Sanya Malhotra](#) Sanya Malhotra recently stunned everyone with her classy outfit and we surely can’t take our eyes off her. After looking at these pictures, you are all set to fall in love with her style statement. She is looking absolutely gorgeous! Sanya looks chic in this multicolored print blouse with balloon sleeves paired with flared palazzos. The actress completed her look with a pair of statement rings and sleek hair, adding to it her peachy-pink makeup. Apart from acing it at work with flair over her artistry, Sanya Malhotra is gaining attention for all the right reasons. The actress is impressing everyone with her bodacious dance moves and lovable personality. The Dangal girl is known to be the director’s actor and is always appreciated for the choice of her roles. Sanya made her debut with Bollywood’s highest-grossing movie. Since then, all the actors and directors have been praising her for her talent. The actress will now be next seen in Anurag Basu’s upcoming film. --- ## Street Dancer 3 wrap up party: Shraddha Kapoor looks ethereal in a black outfit ![Shraddha Kapoor in Dolce and Gabbana for Street Dancer 3 wrap-up party](#) Picture Credits: Instagram Shraddha Kapoor is one of the most in-demand actors this year and is a part of some massive films. One of them is Remo D’souza’s Street Dancer 3 with co-star Varun Dhawan. We’ve been seeing Shraddha’s overall journey for this movie on her Instagram handle, be it the hectic shoot schedules or the long practice sessions with the team. Yesterday evening, the team of Street Dancer 3 celebrated the wrap-up party of the movie and the actress stunned with her look! Kapoor wore a midi-sheath dress by Dolce and Gabbana. The dress was off-shouldered with sheer sleeves and a lace-up detail at the front. To complete the look, she did subtle peachy make-up and left her curls open—and she looked ethereal in this outfit. Apart from Street Dancer 3, we’ll see Shraddha in Saaho with the Bahubali actor Prabhaas. Saaho’s teaser is out and has received a great response. On the other hand, she is also a part of Chhichhore and Baaghi 3. --- ## Shah Rukh Khan, Salman Khan, Amitabh Bachchan – take a look into the dream abodes of these 5 celebs It is often said that home is where our heart is, and more so, homes are a reflection of our personality. The grandeur, the elegance, the quirks—each and every nook and corner of your home speaks volumes about your character. Wealth, luxe and good taste, when mixed together, is often a treat to the eyes. Here are five Bollywood celebs whose lavish homes we’re in awe of: 1. Shah Rukh Khan (Mannat, Bandra) The abode of King Khan is no less than a palace. With elegant interiors, it is truly a magnum opus with the perfect amalgamation of royalty and modernity. ![Shah Rukh Khan's home](#) 2. Salman Khan (Galaxy Apartments, Bandra) Just a few minutes away from SRK’s house, Salman Khan’s Galaxy Apartments flat too is a sight to see. Though not as extravagant as King Khan’s, Salman’s abode boasts simplicity and magnificence. ![Salman Khan's apartment](#) 3. John Abraham (Villa in the Sky, Juhu) Only a few know that John is an architect as well. His penthouse was designed by him and his brother Alan Abraham. Overlooking the Arabian Sea, his house exudes a feeling of class and stays true to the motto “Less is more.” ![John Abraham's villa](#) 4. Akshay Kumar (Jal Darshan, Juhu) Khiladi Kumar’s wife, Twinkle Khanna, is the hand behind all the interiors in their abode. With clever use of grey and blue in each corner, to the paintings and the quirks, Twinkle and Akshay’s home is no less than a dream. ![Akshay Kumar's home](#) 5. Amitabh Bachchan (Jalsa, Juhu) While Big B has three bungalows in his name, Jalsa is where the family stays. Not many know that the actor got it as a gift from his Satte Pe Satta director Ramesh Sippy. The gorgeous bungalow has a living area of 10,125 sq ft. The staircase in this twin-storey house is full of family photos, giving it a distinct and unique character. ![Amitabh Bachchan's Jalsa](#)	2,736	2,358	7,653,230,663,302,315,000	concat	[ "concat_full" ]	0.75	true	null
5,403,679,363,104,658,000	Skip to main content Eclipse Community Forums Forum Search: Search Help Register Login Home Home » Eclipse Projects » BPMN 2.0 Modeler » Exclusive Gateway Direction - 2/4 supported? Exclusive Gateway Direction - 2/4 supported? [message #1385436] Fri, 06 June 2014 12:37 Go to next message Krassimir Kondarev is currently offline Krassimir KondarevFriend Messages: 32 Registered: July 2009 Member Hi, is these a concrete reason for the limited Gateway Directions support for Exclusive Gateways? It seems that two from the four Directions are supported - Converging and Diverging. For the "Mixed" I get the message "Invalid Gateway direction for Exclusive Gateway. It should be "Converging" or "Diverging"". For "Unspecified" (which should be a supported value) I get: "Exclusive Gateway has missing or incomplete Gateway Direction". BPMN2 modeler version: 1.0.1 Best regards, Krassimir Re: Exclusive Gateway Direction - 2/4 supported? [message #1385471 is a reply to message #1385436] Fri, 06 June 2014 15:54 Go to previous messageGo to next message Robert Brodt is currently offline Robert BrodtFriend Messages: 811 Registered: August 2010 Location: Colorado Springs, CO Senior Member Hi Krassimir, Yes, you are correct - this validation constraint needs further investigation. Can you please file a bugzilla so we don't forget about this for a future release? Thanks! Bob P.S. After re-reading section 10.5.1 of the BPMN 2.0 spec, it occurred to me that the editor should probably set the Gateway Direction bit based on the number of incoming & outgoing connections. Can you please add that suggestion to the bugzilla? [Updated on: Fri, 06 June 2014 15:57] Report message to a moderator Re: Exclusive Gateway Direction - 2/4 supported? [message #1385663 is a reply to message #1385471] Tue, 10 June 2014 10:47 Go to previous message Krassimir Kondarev is currently offline Krassimir KondarevFriend Messages: 32 Registered: July 2009 Member Hi Bob, done: https://bugs.eclipse.org/bugs/show_bug.cgi?id=437038 Thanks and regards, Krassimir Previous Topic:Import for Call Activity with Relative Path Next Topic:NullPointerException when saving model with custom attribute Goto Forum: Current Time: Mon Oct 14 16:11:00 GMT 2019 Powered by FUDForum. Page generated in 0.02220 seconds .:: Contact :: Home ::. Powered by: FUDforum 3.0.2. Copyright ©2001-2010 FUDforum Bulletin Board Software Back to the top Events \| Where to Stay \| What to Do \| Where to Eat \| Town Directories \| Jobs \| Shop \| Search Select type of event: Click here to PRINT Add Event \| Show Complete Calendar \| Show Cape Cod Calendar \| Show Martha's Vineyard Calendar \| Show Nantucket Calendar Calendar for 10/14/2019 Events for Oct 13, 2019 · Alcoholics Anonymous (Eastham), 6:30 AM, Chapel in the Pines, 220 Samoset Rd, Eastham · Alcoholics Anonymous (Provincetown), 7:00 AM, Methodist Church, 20 Shank Painter Rd, Provincetown · Nantucket Arts Festival, 10:00 AM, Various locations around Nantucket · Martha's Vineyard Derby, 10:00 AM, Martha's Vineyard · Yarmouth Seaside Festival, 10:00 AM, Joshua Sears Memorial Field, 1175 Route 28 & Wood Rd, S. Yarmouth · Brewster Historical Society Farmers Market, 10:00 AM, Windmill Village, 51 Drummer Boy Road, Brewster · Taylor-Bray Farm Fall Festival, 10:00 AM, Taylor-Bray Farm, 108 Bray Farm Rd N., Yarmouth Port, · Autumn in Cotuit, 11:00 AM, Historical Society of Santuit & Cotuit, 1148 Main St., Cotuit · 16th Annual Cranberry Festival, 11:00 AM, Milestone Cranberry Bog, 220 Milestone Rd., Nantucket · Al-Anon Meeting, 11:00 AM, Drop in Center Gouin Village, 20 Vesper Lane · 18th Annual Art of Chocolate Festival, 11:59 AM, Featherstone Center for the Arts, 30 Featherstone Lane, Oak Bluffs · Tony Bailey, 11:59 AM, Ocean Hourse Restaurant, 425 Old Wharf Rd., Dennis Port · Sandwich Porch Fest, 1:00 PM, Various locations around Sandwich · Heroes & Villains Year End Party with The Grab Brothers, 1:00 PM, Sailing Cow Cafe, 170 Old Wharf Rd., Dennis Port · Sweeney Todd, 2:00 PM, Cotuit Center for the Arts, 4404 Falmouth Rd, Cotuit · Bruce Maclean, 3:00 PM, Wellfleet Pearl, Wellfeet Harbor · Cape Symphony - Mancini at the Movies, 3:00 PM, Barnstable High School PAC, 744 West Main St, Hyannis · Cape Cod Slackers, 3:00 PM, Chapin's Bayside, Dennis · Jack & Oriana , 4:00 PM, Ocean Hourse Restaurant, 425 Old Wharf Rd., Dennis Port · Tony Bailey, 4:00 PM, Shack Out Back, 159 Ocean St, Hyannis · D-Y Band Parents Bingo!, 4:30 PM, Nathaniel H. Wixon School, 901 Route 134, S. Dennis · 14th Annual Lennon Fest Outdoor Festival with Walrus Gumboot, 5:00 PM, British Beer Co, Falmouth · Americana: A New Voice for a New Nation - Depression, Escapism & The Dustbowl Blues, 5:00 PM, Yarmouth New Church, 266 Main St, YarmouthPort · Rose Clancy and Friends, 5:00 PM, Chatham Squire · Geno Sings Sinatra and more!, 5:00 PM, Jake Rooney's, 119 Brooks Rd., Harwich Port · Captain Lazarus Haunted Harbor, 6:00 PM, Cape Cod Community Media Center, 17 Shad Hole Rd., Dennis Port · Mike Dumas and the Satellite Band, 6:00 PM, The Loft at the Cove, West Yarmouth · Psychedelic Sunday with The Grab Brothers Band, 7:00 PM, South Street Depot, 605 Main St., DennisPort · Yarmouth Seaside Festival Fireworks, 8:00 PM, Seagull Beach, West Yarmouth · Shilelagh Law, 8:00 PM, Cape Cod Irish Village, South Yarmouth Alter the Event Data for the Calendar. You may add your event to our calendar for FREE. ADD a new event to the Calendar. Fill out the form below. All fields in RED are required. Event Name: Event Type: Location: Date: Other Dates: mm/dd/yyyy, mm/dd/yyyy Start Time: Times for other dates: hh:mm PM, hh:mm AM Cost: $ Contact Name: Contact Phone Number: Email: Web Site Address: http:// Event Description: Site Location: Please note: We reserve the right to edit and/or refuse submissions. Not responsible for typographical errors, omissions or the wrong date provided. When submitting an event, please add a contact phone number for more information. You may use HTML in your description. Contact Allcapecod.com © 1995-2019 maxm consulting. All Rights Reserved.	# Exclusive Gateway Direction – 2/4 supported? Krassimir Kondarev Fri, 06 June 2014 12:37 Messages: 32 \| Registered: July 2009 > Hi, > > is these a concrete reason for the limited Gateway Directions support for Exclusive Gateways? > > It seems that two from the four Directions are supported – Converging and Diverging. For the “Mixed” I get the message > “Invalid Gateway direction for Exclusive Gateway. It should be “Converging” or “Diverging””. > For “Unspecified” (which should be a supported value) I get: > “Exclusive Gateway has missing or incomplete Gateway Direction”. > > BPMN2 modeler version: 1.0.1 > > Best regards, > Krassimir --- Robert Brodt Fri, 06 June 2014 15:54 Messages: 811 \| Registered: August 2010 \| Location: Colorado Springs, CO > Hi Krassimir, > > Yes, you are correct – this validation constraint needs further investigation. Can you please file a bugzilla so we don’t forget about this for a future release? > > Thanks! > Bob > > P.S. After re-reading section 10.5.1 of the BPMN 2.0 spec, it occurred to me that the editor should probably set the Gateway Direction bit based on the number of incoming & outgoing connections. Can you please add that suggestion to the bugzilla? --- Krassimir Kondarev Tue, 10 June 2014 10:47 Messages: 32 \| Registered: July 2009 > Hi Bob, > > done: https://bugs.eclipse.org/bugs/show_bug.cgi?id=437038 > > Thanks and regards, > Krassimir --- ## Events for Oct 13, 2019 - Alcoholics Anonymous (Eastham), 6:30 AM, Chapel in the Pines, 220 Samoset Rd, Eastham - Alcoholics Anonymous (Provincetown), 7:00 AM, Methodist Church, 20 Shank Painter Rd, Provincetown - Nantucket Arts Festival, 10:00 AM, Various locations around Nantucket - Martha's Vineyard Derby, 10:00 AM, Martha's Vineyard - Yarmouth Seaside Festival, 10:00 AM, Joshua Sears Memorial Field, 1175 Route 28 & Wood Rd, S. Yarmouth - Brewster Historical Society Farmers Market, 10:00 AM, Windmill Village, 51 Drummer Boy Road, Brewster - Taylor-Bray Farm Fall Festival, 10:00 AM, Taylor-Bray Farm, 108 Bray Farm Rd N., Yarmouth Port - Autumn in Cotuit, 11:00 AM, Historical Society of Santuit & Cotuit, 1148 Main St., Cotuit - 16th Annual Cranberry Festival, 11:00 AM, Milestone Cranberry Bog, 220 Milestone Rd., Nantucket - Al-Anon Meeting, 11:00 AM, Drop in Center Gouin Village, 20 Vesper Lane - 18th Annual Art of Chocolate Festival, 11:59 AM, Featherstone Center for the Arts, 30 Featherstone Lane, Oak Bluffs - Tony Bailey, 11:59 AM, Ocean House Restaurant, 425 Old Wharf Rd., Dennis Port - Sandwich Porch Fest, 1:00 PM, Various locations around Sandwich - Heroes & Villains Year End Party with The Grab Brothers, 1:00 PM, Sailing Cow Café, 170 Old Wharf Rd., Dennis Port - Sweeney Todd, 2:00 PM, Cotuit Center for the Arts, 4404 Falmouth Rd., Cotuit - Bruce Maclean, 3:00 PM, Wellfleet Pearl, Wellfleet Harbor - Cape Symphony – Mancini at the Movies, 3:00 PM, Barnstable High School PAC, 744 West Main St, Hyannis - Cape Cod Slackers, 3:00 PM, Chapin’s Bayside, Dennis - Jack & Oriana, 4:00 PM, Ocean House Restaurant, 425 Old Wharf Rd., Dennis Port - Tony Bailey, 4:00 PM, Shack Out Back, 159 Ocean St, Hyannis - D-Y Band Parents Bingo!, 4:30 PM, Nathaniel H. Wixon School, 901 Route 134, S. Dennis - 14th Annual Lennon Fest Outdoor Festival with Walrus Gumboot, 5:00 PM, British Beer Co., Falmouth - Americana: A New Voice for a New Nation – Depression, Escapism & The Dustbowl Blues, 5:00 PM, Yarmouth New Church, 266 Main St, Yarmouth Port - Rose Clancy and Friends, 5:00 PM, Chatham Squire - Geno Sings Sinatra and more!, 5:00 PM, Jake Rooney’s, 119 Brooks Rd., Harwich Port - Captain Lazarus’ Haunted Harbor, 6:00 PM, Cape Cod Community Media Center, 17 Shad Hole Rd., Dennis Port - Mike Dumas and the Satellite Band, 6:00 PM, The Loft at the Cove, West Yarmouth - Psychedelic Sunday with The Grab Brothers Band, 7:00 PM, South Street Depot, 605 Main St., Dennis Port - Yarmouth Seaside Festival Fireworks, 8:00 PM, Seagull Beach, West Yarmouth - Shilelagh Law, 8:00 PM, Cape Cod Irish Village, South Yarmouth	1,741	1,255	5,403,679,363,104,658,000	concat	[ "concat_full" ]	0.75	true	null
-7,622,684,172,856,578,000	• espresso finish eastern king bedroom set home improvement stores madison wi • easy kitchen table centerpiece ideas decoration for dining room best decor top sink clogged deco • eagle style faucets kitchen delta utility home fixtures bathroom sink sinks modern splendid depot moen waterfall faucet hood fire suppression system • exciting red kitchen cabinet handles cabinets and white ceiling interior design ideas • elegant chef kitchen appliances new vintage stoves and modern ideas lovely appliance set retro packages • elegant centerpiece ideas dining table decorations for christmas ornaments • ejector pump cost basement bathroom system do i need one residential sewage prices toilet ejecto • executive chef sink rack strive large size of kitchen accessories sinks broad kohler • example of a kitchen designed by which is free design software good program best download online • eleven gables kitchen as featured in design magazine stainless steel farm house sink with apron farmhouse sinks 36 • exclusive kitchen design catalogue on home decoration planner with tiles d • eternal kitchen countertop picture gallery • elegant kitchen pantry cabinets freestanding standing cabinet free furniture for sale latest • elegant marble tile bathroom floor images about ideas on for pinterest home improvement neighbor face • eclectic living room meaning sets leather • elements international storage bedroom mirror with • electric with 5 elements and knob controls black kitchenaid stove knobs parts • estate 5 piece aluminum outdoor bar height dining set table patio furniture n • enclosed paper towel dispenser holder home ideas center business kitchen diy bathroom with shiplap ceiling ide • eastern mist design kohler bathroom idea tool ideas • edwardian dining chairs ebay furniture outlet chicago • electric patio heater water fire sense commercial home depot instant hot portable outdoor heaters costco cushions target • elongated toilet seat rugs lid covers bathroom toi • easy cheap closet organization basement bedroom organizers ideas organizer • encouraging outdoor rug ideas new or adorable geometric cheap rugs for patio with furniture decorating christmas cookies toddle • elegant home depot kitchen cabinets inspirational top contemporary gallery punt cabinet sets design • economic bathroom designs modern ideas on a budget original sink design shower area bathrooms india for bedroom office sm • excellent used mobile kitchens for sale kitchen trailer rental white large seattle amazing • eye level pantry organization kitchen cabinet storage ikea organize cabinets drawers • extraordinary vinyl tile for bathroom how to clean luxury with contemporary and tiles in wall bunnings ext • entertainment unit living room 7 cool contemporary wall designs for your • edge led illuminated bathroom mirror with lights demister pad and motion sensor hollywood mirrors uk • elite review cheap gel mats kitchen nightmares full episodes • entryway decor how to dress up your for the holidays seasons easy winter holiday bathroom decorating ideas small living room seasonal • explore our stunning range of porcelain and ceramic kitchen floor wall tiles enter your details below to get a copy catalogues for best w • echelon mocha kitchen cabinets paint color cabinet photos buy furniture hardware faucets costco • enameled kitchen sink real porcelain enamel coating to re your drainboard tub ceramic porcelin sinks kohler double kit • expandable glass dining table set ikea metal and • elegant modern purple master bedroom color interior design ideas picture colors home improvement companies near me • easy extra kitchen cabinet shelf bookshelves locking supports small ideas add an in your upper cabinets • enthralling cost of granite slab in staggering kitchen how much does a countertop installers countertops installed price gorgeous mesmerizing • enlarge grey white kitchen paint cabinets with gray wall decorating gorgeous rooms • easy elegant table decorations centerpiece idea halloween entertaining decor decorating cookies with royal icing • explore hundreds of pine natural hardwood options in various colors textures species order samples to help find the right look for you flooring cumberland home improvement wilson • enlarge southwestern kitchen lighting cabinets liquidators pueblo style home traditional design • elegant new design kitchens kitchen cabinet cabinets and countertops • elegant butcher board fresh sealing wood s in the kitchen for dollars seminar counter sealer • ed patio roof design plans cover building ideas s wood • espresso coloured furniture gray walls dark brown bedroom paint color grey set furnitur • eclectic powder bathroom apartment plans small world home apartments near me design tips to make a better • electric frosted glass windows cost privacy film 2 of 3 bathroom window price f • explore our stunning range of porcelain and ceramic kitchen floor wall tiles enter your details below to get a copy catalogues design catalogue ca • electric fireplace for bedroom ideas glamorous white small fireplaces tv stan • elegant fun bath rugs purple and lavender bathroom mats gold accessories walmart home improvement catalog coupon m • eclectic living room meaning century eclecticism in architecture rooms decorating for fall designer shower curtains sets ikea mea • enchanting bedroom colour schemes grey country by sims carpet ideas decorating • ex display kitchen cheapest appliances ireland cheap northern • easy planner kitchen design 3d • elegant spray paint kitchen cabinets cost uk how much does it to painting new co • exhaust fan duct sharing routing can we combine kitchen bathroom ducts pipe insulation sink cabinet bath vent • egg armchair living room beach style with brown upholstered ottoman tripod floor lamp neutral muted color 4 furniture outlet dallas • exactly what would you do if your mobile kitchen rental trailer was not readily available for emergency commercial headaches seattle • essence cushion cover pair living room cushions ireland decorating ideas indian style soft furnishings • end of summer kitchen window by via drapes small curtains ideas • eclectic design meaning medium size of living room interior concept clothing rugs ideas eclecti • enlarge kitchen ideas home designs beautiful efficient small kitchens • elegant corner bathroom shelves and shelf design ideas beautiful wood full size shelving small glass • exterior door master bathroom size decorating tips for cakes what is the standard residential • even home bathroom scales ratings closest improvement store near me best scale • event details hogwarts dining hall decorations decorating ideas for kitchen airport harry potter world till • exciting depot cabinets illuminated lighted home mirror extending lights round heated shaving bathroom cabinet • elegant brick patio general shale paver cost michigan cushions clearance • entrancing highest rated kitchen faucets your house concept top amazon reviews touch • expand a drawer medicine spice bottles organizer bathroom organisers uk home improvement stores online pills • enclosed patio kits screened enclosure walls only in lowes • extraordinary barn sliding doors interior for bathroom • electronic bathroom scales white lightweight home ratings improvement wilson quotes • expert design project help designing my kitchen layout online n • electric fireplace bedroom best small fireplaces mantels lowes exquisite portable 8 electri • estimate bathroom remodel cost budget calculator excel home improvement shows on netflix awesome remodeling estimat • enchanting wooden dining table and 6 chairs room tables oak with sale d • eclectic style interior design living room meaning ideas decor • existing kitchen cabinets average cost refacing roller shutter doors not rolling ideas prices cabinet c • elite weathered oak laminate flooring options hardwood cumberland home improvement loans in texas review • end kitchen cabinet shelves sagging cabinets lowes • excellent nice outdoor kitchen designs best design ideas inside kitchens pictures the store company florida images creative • elite kitchen waste disposal unit maid air switch p recycling bins uk • entertainment living room home ideas setups • excellent blue bedroom decorations room decor living bedding to navy themes home improvement stores open now • exactly what would you do if your temporary mobile kitchen rental trailer was not offered for emergency commercial nightmares seattle • espresso machine candy apple red kitchenaid coffee with grinder • efficiency apartment size appliances used inch gas range for sale tiny house small stoves apartments kitchen drop leaf table app • exterior irrigated living wall 2016 greenhouse patio furniture austin stores denver walls • eleven kitchen whats your favorite aquamarine backsplash design ideas kerala • electric fireplace for bedroom ideas wall mounted in small fireplaces tv • eclectic orange kitchen with cabinets and hardwood floor cabinet refacing county ny • elegant porcelain tile kitchen countertops design picture • excellent beautiful compact bathroom designs with small narrow and also full design home improvement cast members bathroo • eastern king storage bedroom espresso finish set home improvement stores that went out of business • earth sky colors dining room version 2 walls sharkskin ceiling blue trim painted think outside the box • electric decorating gas ideas master decoration engaging breast corner bedroom decor chimney mantel old small fireplaces fireplace doors houston • enlarge bathroom decor pinterest cafe christmas decorating trends 2019 create smashing powder room • entertainment living room home theater reddit center and coffee table • enlarge elegant dining room 1930 style table beautiful rooms • exclusive kitchen cabinets from modern furniture italian chairs • espresso two light bath fixture jonathan adler bathroom lighting control panel supplier in uae bronze oil rubbed contemporary 2 • extendable solid wood dining table and 8 queen chairs 1930 style • easy glass kitchen jars uk kitchenaid mixer recipes canisters love bottles for storage • espresso white upper cabinets lower love contrast kitchen wall oven cabinet house black base overhead unit designs south africa 2 • es s stools for kitchen bench gold coast sink cabinet • easy kitchen cabinet makeover cabinets makeovers pictures island • eclectic la home kitchen dining room lighting ideas design 2018 one of a kind • easy kitchen flooring contemporary sheet vinyl on feet how • easy planner 3d kitchen design best free online virtual room programs and tools • e bedroom accessories aspiration ideas to inspire you how make pertaining 4 bathroom decor pinterest cafe decorating christmas tree clipart ma • extending dining tables and chairs table 6 white high gloss oak with royal dini • eclectic style interior design meaning and how to apply it best living room modern theater ideas app • easy kitchen flooring wood floor options for kitchens best and bath on feet floorin • eclectic kitchen a freestanding stainless steel island with shelf on wheels topped butcher block • eight ways to save water at home bathroom • extraordinary round patio dining table sets from black walnut wood lumber also a set of antique living room chairs with roller ball caster wheels and vintage • example small bathroom floor plans converting a closet into compact full design home improvement shows near me • easy installation flooring options hardwood cumberland home improvement contractors in greenville nc • extending dining table and bench awesome the children s bedroom company of kitchen with room furniture set • enclose a patio enclosed ideas best on screened designs budget kits in • extraordinary ideas bedroom furniture sets as cheap queen ikea design uk home improvement cast nancy chic black hawk haven photo 3 store • elegant high end restaurant chairs amazing restaurants furniture with on modern italian kitchen fabulous design • economic bathroom designs remodel budget cheapest medium size of updates on a ideas india 5x7 design i • espresso kitchen cabinets paint mocha cabinet ideas images • enchanting butcher block prep table kitchen canada kitchenette brand contemporary food tables • elongated toilet seat cover and rug set sets bathroom rugs covers lid bath • e kitchen tiles murals accent for floor tile inserts posts island copper pretty agreeable bathroom wall shared kids room and storage ideas • end of summer kitchen window by via covering designs curtains modern • extra large flower pots plant for sale garden planters planter cheap black plastic containers plan patio plants landscape architects in kerala gard • extractor fan kitchen hood slimline exhaust nightmares netflix s • eclectic style interior design meaning and how to apply it best simple amazing living room sets ideas i • eclectic living room meaning design inspiration interior share • endearing fabulous accessories contemporary kitchen sink extraordinary modern suited for your hotel sinks ceramic by design si • extending dining table and 6 chairs solid oak with royal set black glass tab • euro inch round dining table and pub a 70 with lazy susan • easy paper lantern chandelier with additional small home decor inspiration cute interior and furni • elegant b and q bathroom cabinet cheap furniture cabinets drawer unit ebay reasons why you go to stores on your own • enter image description here paper towel kitchen dispenser bunnings how would one use the phrase roll • example of a kitchen designed by which is free design software designing my layout layouts with islands online • endearing round glass dining room sets table and chairs top ideal cheap set online bases for tops • enlarge room banquette dining furniture smart beautiful kitchen banquettes • elegant corner kitchen table with comfortable couch beautiful wooden design dining bench 3 piece and breakfast set • extraordinary small compact bathroom designs design ideas inspiring worthy about narrow full discount home improvement store near me extra • excellent leak under bathroom sink leakage handicap kitchen faucet leaking moen • engineered quartz cost factors compare different kitchen countertops • employee discounts on kitchen appliances pricing washers dryers discount online n • elegant style small living room lighting ideas shocking handmade premium material wonderful interior design white collection beautiful best • eyelet dress curtain in voile patio door curtains doors net • enlarge kitchen design tiles ideas tile backsplash white kitchens • elegant kitchen cabinet material door choice image design modern comparison pro and con in list indium used cabinets materials kerala awesome kitche • easy clean click clack bath waste with overflow medium image premium bathroom accessories pack diagram home improvement wilson gif • extendable dining table set room sets fancy round white gloss extending kitchen with bench • elkay kitchen faucets commercial • entry floor tile ideas photos gallery contractor home tiles kitchen flooring and bathroom design for floors • examples of bedroom furniture made to breakdown ideal ltd quebec • easy thanksgiving centerpieces cool homemade decorations yard centerpiece • example of a 3 panel center fixed gliding patio door in cocoa bean color anderson windows sliding doors • easy coffee maker all new manual kitchenaid machine with grinder • extendable table transparent chrome plated glass dining set ikea canada • entrancing rustic cherry kitchen cabinets paint color modern with view mocha cabinet table sets col • espresso in x anti fatigue comfort mat black and cream kitchen mats kitchenaid artisan n • extraordinary inside decorations interior for house christmas ideas room decor diy collect this idea bringing the spirit into yo • elegant kitchen sink cleaning powder cleaner table walmart 5 • elegant white kitchen tiles wall with grey grout tile best for • elite 6 qt bowl lift stand mixer kenmore vs kitchenaid warranty overview • elegant residential tower with a view beach orange architects project wins the competition for an exclusive la maison home decor limassol • elegant z desk inspirational beautiful wall decor than contemporary ideas compact gallerie decorating awesome lov • extreme world market dining chairs living room furniture dubai sale • exciting upholstered bedroom chair blue small images of brown chairs fabric im • elegant dining room designs that will bring simplicity in your home scandinavian design chairs • elegant different types of kitchen for inspirational design concept countertops pros cons fresh • engineered hardwood flooring options concrete dining room shower design ideas for small bathrooms • edit courtesy of architecture design create a kitchen my own fire station five tips to usable firehouse cooking area • exhaust fan with humidity sensor switch vent bathroom ventilation • enlarge gray and white kitchen cabinet ideas 2018 design kitchens • easy cabinet refinishing kitchen cost for home design style with refacing ideas wood refurbished painting kitche • eastern king bedroom set furniture of villa park 4 pieces contemporary espresso finish home improvement loans wells fargo bedroo • extending draw leaf dining table made in rosewood price vintage danish design kitchen tables kitchenaid mixer colors • easy shelf ideas that you can pipe brackets kitchen bookshelves shelving nz • easy wire basket side table project living room decor diy home ideas for best decorating • extendable dining set white glass table ikea canada • evolution excel hp household garbage disposer waste disposal kitchen machine best reviews and price • elegant hanging lamps for kitchen light fixtures of with pendant lights kitchens plans in island pe • electric patio heater alternative views outdoor heaters costco umbrella • entry after manchester tan living rooms room design inspiration are your paint colors chopping up flow • excellent bathroom fan with led light pro v airbus commercial grade square exhaust ventilation • enlarge design of kitchen islands island ideas photos great • elite grade a ceramic rectangular rounded corner flat bottom bathroom vessel flushed walls sink with tall round vs rectangle small undermount • exterior and interior design ideas country style kitchen elegant wall decals stoves home bad • easy rustic home decor ideas on a budget living room diy wall • edit no not my bathroom unfortunately job i did for a client so they could watch cameras as well sky etc while in the bath television master • essentials kitchen paper towel rolls 2 ply perforated sheets roll case online india • exquisite pale yellow kitchen cabinets with regard to green and walls seafoam • elk lighting wrought iron black and antique gold inch four kitchen light fixtures simple pipe fixture outdoor • eye catchy kitchen with burnt orange cabinets and a unique island wholesale county ny • extravagant living room designs that will make you jealous mediterranean rooms ideas om w • easy decorations homemade ideas for holiday decorating diy christmas decor pictures images • elegant dining room scandinavian interior design designs that will bring simplicity in your home • en simple kitchen remodel ideas renovation remodels s • exhaust fan delta ventilation bath with humidity sensor led light bathroom extractor and timer • enormous lanterns hung over a breakfast nook kitchen lighting pendant fixtures island hanging light pendants • electric fireplace bedroom lace furniture with for in small fireplaces mantels • eclectic living room design decorating contemporary ideas sitting stunning meaning rugs chic • edge quartz blue cabinet kitchen countertops white gray • espresso king bed contemporary leatherette eastern in place sleigh bedroom finish set home improvement shows on hulu ki • example of small kitchen island being a butcher block create my own designs with islands • extraordinary kitchen and bath design magazine wooden cupboard sink remodel awesome images desig • elegant kitchen rack unique shelving ideas than best of shelves ikea smart and compact • exquisite ideas cabinets kitchen custom doors for retrofit or replacement on ikea remodelista • endearing wonderful kitchen island classic contemporary design with wooden materials and stove x ideas top lovable wonderfu • epoxy wood how to seal en laminate sealer solid do i beeswax finish kitchen counter for best resin top projects try island • espresso eastern king bedroom finish set home improvement wilson meme vanity acme furniture jasper • eleven kitchen whats your favorite aquamarine backsplash designer jobs in dubai • ejector pump cost basement bathroom to plumb a images home design • extraordinary best brand name kitchen appliances lighting painting is like furniture store logos brands of brandsmart small wonderful • enchanting kitchen paper towel holder high low stainless steel diy how many bathrooms in spanish towe • eh heat extractor for kitchen in ghana • easy strong cheap bunk bed design blue cabinet loft patterned apartments for rent near me 1 bedroom • estimate your custom project popular types kitchen countertops n • easy elegant table decorations centerpiece idea simple dining room decor halloween entertaining decorating icing betty crocker • extremely sleek and contemporary kitchen island designs design of islands ideas photos • electric kettle heat extractor for kitchen in ghana • excel home budget spreadsheet fresh kitchen remodel template for design unique remodeling worksheet sprea • elegant lounge decor ideas best living room on modern rustic • espresso finish legs contemporary bedroom furniture eking size bed linen eastern king set home improvement cast wilson acme 2 • easy pieces modern dining tables and benches table throughout for plan wooden with bench corner chair set solid wood blue made com in • everyday single handle standard kitchen faucet with escutcheon and side spray in chrome elkay faucets discontinued n • enjoyable z tree topper ideas dining room table decor idea as well satisfying gallerie decorating • eh w heat extractor for kitchen in ghana • extra large patio umbrella unique fresh cheap umbrellas ideas contemporary of set for elegant awesome • easy kitchen makeovers budget remodel images • excellent ideas paint finish for kitchen cabinet finishes club astonishing decorations styles and • eclectic interior design living room ideas meaning sets walmart • elegant bathroom cabinets online design of goodly marvelous cabinet cheap wall buy • elegant dining room pier one gold tufted suede chair damask upholstered chairs furniture online uae decor hourglass taupe cha • electric patio heater amazing heaters remodel concept outdoor home costco pavers tucson • extension dining table sandalwood mission room kitchen island ikea by keyston • economic bathroom designs remodel budget cheapest medium size of updates on a ideas india design for bed • eat in kitchen by my beautiful abode tile splashback tiled pictures guide • extendable oval table walnut kitchen ireland faucets dining tables • elegant inspired bedroom design style ideas moroccan marvelous rooms • eastern king upholstered platform bed bedroom espresso finish set home improvement stores open now • eclectic living room in style furniture ideas meaning small design modern inspiring decor ro • enchanting living room furniture popular of formal layout best ideas about seating arrangements pinterest theater fau furnit • eastern king bedroom espresso finish set home improvement stores open near me sets • entrancing vintage kitchen lighting decoration ideas by furniture island antique farmhouse decor islands bakery counter for sale • electric stainless steel kitchenaid dryer parts mixer sale • extra deep kitchen sink single bowl sinks nightmares full episodes • espresso bathroom vanity w cultured marble double basin sinks • extremely creative copper kitchen faucet how to choose the right style for your and faucets with sprayer soap dispenser unusual design ide • easy thanksgiving centerpieces for your holiday table decoration ideas cool homemade decorations yard e • enlarge interior kitchen design ideas on a budget beautiful efficient small kitchens • extending oak dining tables table 6 chairs can deliver solid with used round e • elite mixer attachments tilt head stand kenmore vs kitchenaid bowl lift 0 • eclectic modern living room what is the meaning of sets ideas • extendable dining table with chairs glass dinner full size chair extending kitchen bench e • embodying all great about modern ceramic flooring the range of timber effect tiles comes with a tactile surface and realistic grain laminate floor kitchen tile • elegant appliance packas new inspirational stock kitchen appliances and awesome lovely ge cafe packages recommendations • elegance and style vale bathroom fireplaces ltd • expensive living room sets round glass top dining table and chairs designs luxury bases for tops roun • elegant tree decorating ideas new best home decor images on christmas pinterest aqua blue with mesh luxury and white • eye catching kitchen tile ideas to love grey tiles wall • eclectic living room meaning chairs modern furniture and decor image of great ideas • enchanting bathroom cabinet large target medicine mirror cabinets medium size of bathrooms with extra ideas medici • enlarge kitchen bookshelves ideas shelves diy smart storage small kitchens • extending walnut dining table chairs kitchen ireland nightmares netflix • eclectic living room by pierce design associates meaning sets rooms to go the of color red • engineered quartz cost factors kitchen cabinets countertops costco and • exterior bamboo shades outdoor blinds for patio target roman lighting direct promo code window roller • easy thanksgiving centerpieces for your holiday table decoration ideas cool homemade decorations outdoor el • electric under cabinet lighting led lights round kitchen strip uk ligh • en sink soap dispenser under bottle pump parts replacement vine repair kitchen replaceme • e series patio doors 5 anderson windows sliding eagle • extra large dining table with extension leaves black walnut kitchen dark room and circular w chairs ireland storage modern extending • extra large shower stall mats gray mat in best home decorating ideas websites magazine lar • embodying all great about modern ceramic flooring the range of timber effect tiles comes with a tactile surface and realistic grain kitchen easy on feet best tough sty • electric oven cheapest kitchen appliances ireland buy household • extra shelves for kitchen cabinets easy cabinet shelf source a bookshelves cupboard liners ikea cabi • extending dining table chairs set room with bench kitchen • ess steel with shelf wolf kitchen and view in gallery tile stainless backsplashes for kitchens backsplash tiles • exterior and interior design ideas country style kitchen tiles for french stoves bathroom • elegant contemporary kitchen ceiling lights brilliant for modern floating clouds and ideas unique best led ce • embodying all great about modern ceramic flooring the range of timber effect tiles comes with a tactile surface and realistic grain for kitchen floor tile ideas pinterest bes • electric patio heater it can get chilly at night during any season porches porch outdoor heaters costco dining sets home depot • ergonomic and organized contemporary kitchen with translucent sliding doors modern hardware specialty divider sink • engineered flooring easier hardwood kitchen wood laminate kitchenaid • enclosed outdoor patio ideas backyard porch fresh or best decorating semi small covered designs australia design for bedroom corners • eclectic design meaning large size of living style interior clothing contemporary room unusual ideas ecl • enlarge elegance only looks easy elegant living rooms display fine design room ideas interior for apartment decorating • extendable glass top dining table chairs for sets 8 set • example of a classic bedroom design in barbara barry bed furniture • enlarge pencil tile modern backsplashes for kitchens kitchen backsplash designs beautiful • empire industries inch double bowl kitchen sink undermount squareline • exhaust fan duct bathroom vent pipe photo 8 of roof large image kitchen insulation table decor • elegant lighting kitchen apartment island pendants cut glass chandelier how to light panels • easy crafts for adults to make ideas holiday craft projects seasons winter bathroom decor decorating living rooms • elegant kitchen island with seating and best ideas on home design white islands for 4 • easy crafts for adults to make ideas holiday craft projects seasons winter bathroom decor decorating tips small spaces • elegant black and white decor exciting picture classy bedroom ideas furniture pinterest decorating color trends 2019 for bedrooms • excellent kitchen island pendant for your residence inspiration spacing lights • easy thanksgiving decorations cool homemade table simple centerpieces outdoor thanks • easy kitchen flooring tile ideas for a warm guide on feet floori • electric fireplace in bedroom for small fireplaces tv stand costco e bedro • egg chair la maison home decor limassol • ex display kitchen find out now what should you do for fast kitchens cheapest appliances ireland buy • exciting bathroom lighting 4 light lowes clearance designer definition vanity lights contemporary fixtures l • elements queen bedroom set chest mattress free white ikea • excellent cool free kitchen design software home depot unusual for kitchens designer awesome program easy planner 3d beauteous virtual bathroom or pla • exotic princess toddler bed bedding set tiana bedroom and the frog crib • expert design project help kitchen cabinet sets home depot cabinets ideas n • epic chrome dining chairs on home bedroom furniture ideas with leather uk fair new bern nc set 8 brass and • eye catching mobile kitchen island awesome small with storage best pertaining to islands home designs • elegant marble granite kitchen work tops cream black worktop ideas wooden worktops • episode the club house lake living hgtv design ideas for small kitchen and dining room • en island support columns pictures decorative with for kitchen to ceiling islands an by contemporary miner design • enlarge create my own kitchen island make your with seating great ideas • evergreen centerpiece diy christmas decor pictures ideas pinterest festive table decorations • espresso finish eastern king bedroom set home improvement wilson gif • estimate cost of painting interior house refinishing kitchen cabinets s kitchenaid microwave pai • even a year old farmhouse can go industrial here designer peter incorporates salvaged antique finials and wood beams to warm the space new design kitchen bath showcase renovati • eclectic decorating living room meaning curtains amazon in small design furniture ideas pictures family with • eclectic room with white paper lantern light fixture home decor • examples outstanding small kitchen tables with storage table sets within high top island ideas rectangular and ou • empire walnut in a bathroom vinyl tiles wall australia bathrooms • elegant renovating bathroom ideas renovate small best your remodeling on a budget el • elegant kitchen floor mats awesome anti fatigue mat new rubber and walmart contemporary lovely m • extra deep sofa trend couch in modern ideas with living room couches ikea sets for sale • elevated quartz kitchen ideas with sink countertop • exotic nces reviews re cooking kitchen nce gallery dishwasher frigidaire appliances • electric fireplace for bedroom in small gas fireplaces bedrooms vent video downlo • extra deep single bowl kitchen sink black granite sinks ideas 2019 stainless steel de • espresso king bed frame make an eastern all size fr bedroom finish set home improvement wilson face contempor • exhaust fan stove vent above hood fans for stoves kitchen installation • elegant industrial style home bar ideas kitchens kitchenaid • exclusive kitchen remodel cost per square foot for your home interior design ideas with remodeling commercial kitche • easy kids crafts ideas so many great that are doable and fun seasons winter holiday bathroom decor decorating christmas cookies kit 2 • entertainment center for up to living room centre home co • everything old is new again tile then and now compare different kitchen countertops • extremely creative small kitchen design ideas interior in india cabinets • eclectic interior designs blog design home decor living room meaning rugs walmart understanding style in n a thus making definition for eclec • exquisite decoration glass kitchen cabinet doors option types cabinets homes decor • extending dining table rustic mahogany pottery barn c kitchen with bench • ejector pump installation cost basement bathroom fascinating bathtub photos plumbing pictures price system pit • exceptional extra large black lacquered table circa oak cm dining girona kitchen ideas with island id f • eternal quartz bathroom countertops pictures • extravagant living room designs that will make you jealous mediterranean style design ideas • espresso bathroom vanity w solid oak wood and white double basin sinks • east winter garden vegetables forest country living throughout pretty your residence texas home improvement wilson meme y • enlarge image 8 khloe kardashian home photos house pics inside and • exotic granite top dining set table tables marble price room kitchen night • enclosed patios best condo patio images on ideas pinterest decorating studio llc • en design modern top t worktop made out corian kitchen countertops price • enter image description here waste disposal kitchen management kitchener on how do you drain a garbage • eternal gold kitchen countertop picture gallery • exciting home media room interior design dimension book red carpet diaries 2 chapter • excellent we want to add panel moulding below the chair rail blue bedroom with dining room panels • enameled cast iron large double bowl sink in white x 1 2 8 kitchen undermount squareline la small single biscuit • electric fireplace in small bedroom images buy fireplaces tools menards for • excellent best made kitchen cabinets cabinet custom american manufacturers likable dimensions • eastern king bedroom espresso finish set home improvement shows on hulu size art furniture saint coffee platform sleigh bed frame • exterior shutter types kitchen rolling cost cabinets roll down shutters • eat in kitchen light fixtures contemporary lighting ideas led with lights k • easy thanksgiving centerpieces decorations for the table cool homemade diy outdoor • easy kitchen flooring to clean floors fascinating also best care on feet flo • enlarge image kitchenaid gas range double oven 30 freestanding reviews review • expandable cutlery tray 4 compartment drawer dividers for and kitchen utensils made plastic utensil • easy planner 3d kitchen design • enchanting modern bathroom design ideas cool interior with bathtub shower vessel sink india stunning futuristic insp • espresso vanity top ideas adorable bathroom counter tile white subway behind pictures above bathrooms tops • exhaust fan bathroom fans humidity sensing reviews inspirational with sensor and fa • excellent bedroom designs furniture sets ikea design uk home improvement wilson meme • elegant dining room designs that will bring simplicity in your home scandinavian sideboards • easy planner home interior design software 3d kitchen modular • employing a stone sand colored tile flooring and naturally light wood tones kitchen grey ideas designs • exhaust fan cover bathroom remove replacement motor ceiling • examples of bedroom furniture made to breakdown quebec mfi for small spaces • easy decorations homemade do it yourself decor ideas halloween entertaining decorating icing • extractor fan ducting kitchen hood slimline designer s steel exhaust islands clearance duc • elegant grey led lighting kitchen strip ikea equipment list • easy stone patio projects you should try for your yard ideas design no designs pinterest • expandable farmhouse table large size of kitchen sets in nice with leaves centerpiece ideas • exquisite kitchen cabinets for residence ideas outdoor plans awesome pdf architecture salary in florida • endearing 4 x 8 kitchen rug with latest rugs table bench magnificent area awesome sisal cream at stores lowes throw bedrooms sets queen yellow tan cushions washable • espresso wood traditional finish queen bed eastern king bedroom set home improvement contractors near me 4 piece cal • electric fireplace for bedroom two sided the home in small fireplaces screens lowes bedroo • entertaining like this is all in the details aroma of fresh baked goods taste savoury and sweet nibbles visual beauty flickering casalife bathroom heater lamp • easy and unique ornaments with a farmhouse cottage style for trees decor diy christmas pictures table ideas • external image melamine cabinets redo kitchen painting laminate diy over • eclectic cottage home with a vibrant yet balanced color palette aqua kitchen pinterest table sets • esteem sink bathroom sinksunique sinks product is home improvements catalog going out of business • exterior door double wide bedroom doors decorating christmas tree with ribbon what is the standard size for residential • easy extra shelf inside cabinet finished kitchen bookshelves clips home depot small ideas add an in your upper cabinets • elkay kitchen faucets faucet parts diagram • elegant contemporary dining table extension scandinavian room teak tables • extend the enjoyment of your home by adding a new outdoor dimension kitchens fire pits fireplaces patios decks courtyards living and • easy kitchen organization ideas for small spaces and dollar store home pinterest sink drain • e nautical themed bedroom coastal decor ideas update furniture sets crib bedding tical nice beach reviews whi • eat kitchen wall art large stickers letters for fork and spoon decor • enzyme drain cleaner kitchen sink powder kitchenaid dishwasher n • elegant patio backyard pergola ideas with roof cheap covering waterproof sun shades shade lighting supply coupon • excellent kitchen storage cabinets marvelous organizers re mends of furniture lowes pantry cabinet c • elegant free standing kitchen sink unit with freestanding stand alone units small cape town new • elegant vintage farmhouse kitchen islands antique bakery counter for sale designs island awesome beautiful industrial solid wood table f • ejection pump toilet basement bathroom ejector quick how to finish a smell ej • emerald home furnishings dining room server black at simply discount furniture • exceptional best material for kitchen cabinets in pictures design materials kerala cupboard d • empire dining suite with chairs black kitchen tables bench cabinets online • exquisite decoration contemporary living rooms showdown show room hgtv fixer upper colors modern design home custom upholste • easy vintage farmhouse decor canada decorating sugar cookies with buttercream at its roots style springs from an appreciation for historic primitive or items particularly relat • enlarge kitchen glass cabinets decor distinctive front doors • enchanting rustic country kitchen decor decorating ideas fabulous and best r pinterest 2019 fabu • economic bathroom designs excellent astounding ideas small remodel on a budget intended for india design apartmen • empty round glass storage jars with lids clamp jar food container sale australia • exquisite delightful tin ceiling tiles kitchen backsplash for • etched glass kitchen cabinet doors door ideas • estates ltd vale bathroom and fireplaces no dot 1 agent in residential estate agents info at com f a stunning 2 bedroom penthouse apartment on the floor of regent court w • enchanting outdoor dining set with umbrella patio furniture sets info for cheap fantastic pa • electric fireplace for bedroom wall mount in the small fireplaces grate lowes e • espresso finish eastern king bedroom set home improvement neighbor face • easy patio designs with additional home interior design models large covered australia ideas for small bathrooms m • electric stoves intended for range info design lowes kitchenaid ranges double oven wall • endearing installing tile over laminate elegant painting in bathroom to look like white marble astounding design awesome paint countertop porcelain endear • easy kitchen remodel configuration tool design remodeling tips redoing a diy cabinets ea • elegant shaker style kitchen cupboard doors 7 cabinet hardware cupboards cabinets grey sty • elegant dining room designs that will bring simplicity in your home scandinavian design furniture ho • exclusive heritage x double bowl stainless steel kitchen farmhouse apron front sink top mount • elegant wall tiles kids room bathroom designs travertine tile • enlarge seeded glass door inserts kitchen designs with wooden frame distinctive cabinets front doors • elegant brick patio cost paver michigan heater lowes exotic labor • elegant dining room corner bench with best table ideas only on solutions pinterest kitchen faucets delta wonderful be • extraordinary compact dining set table and chairs triangle wondrous kitchen australia d • entertainment base living room system ideas media consoles • explorers wall tapestry beautiful hanging wanderlust theme bohemian decor home 3 sizes bohemia art decorating trends 2019 • enlarge kitchen display cabinets uk glass fronted cabinet gun • examples ornate intriguing stainless steel kitchen cabinets tips ideas metal manufacturers comfortable decor also then gracious cabinet hooks renew wood cupboard renewal saver • enlarge glass kitchen door ideas distinctive cabinets front doors • every celebration paper lantern home decor • exquisite double sink vanity with brown cabinets also oval mirror in the middle of two rectangular newport white 60 inch bathroom exquis • elegantly and beautifully furnished shabby chic dining room decorating rooms ideas small beautiful decoration • exterior trim anderson windows sliding patio doors • easy thanksgiving place card ideas cool homemade decorations door for cards ValueContext 32535{ "5743": 32533, "5744": 32534, "5745": 32535, "5746": 32536, "5747": "space dust", "5748": 2 } 32539{ "5743": 32537, "5744": 32538, "5745": 32539, "5746": 32540, "5747": "meteorites", "5748": 3 } 33529{ "5742": "smouldering ", "5743": 33527, "5744": 33528, "5745": 33529, "5746": 33530, "5747": "smouldering lamps", "5748": 0 } 35760{ "5742": "dark ", "5743": 35758, "5744": 35759, "5745": 35760, "5746": 35761, "5747": "dark stars", "5748": 4 } 35764{ "5742": "dark ", "5743": 35762, "5744": 35763, "5745": 35764, "5746": 35765, "5747": "dark lamps", "5748": 4 } 37396{ "5742": "lava ", "5743": 37394, "5744": 37395, "5745": 37396, "5746": 37397, "5747": "lava lanterns", "5748": 5 } 37896{ "5742": "bright ", "5743": 37894, "5744": 37895, "5745": 37896, "5746": 37897, "5747": "bright lamps", "5748": 0 } 37900{ "5742": "bright ", "5743": 37898, "5744": 37899, "5745": 37900, "5746": 37901, "5747": "bright stars", "5748": 1 } 38170{ "5743": 38168, "5744": 38169, "5745": 38170, "5746": 38171, "5747": "scrolls", "5748": 5 } 39679{ "5742": "hydra ", "5743": 39677, "5744": 39678, "5745": 39679, "5746": 39680, "5747": "hydra lamps", "5748": 0 } 40200{ "5743": 40198, "5744": 40199, "5745": 40200, "5746": 40201, "5747": "supreme stars", "5748": 5 } 42125{ "5743": 42123, "5744": 42124, "5745": 42125, "5746": 42126, "5747": "chaotic tomes", "5748": 5 } 42450{ "5743": 42448, "5744": 42449, "5745": 42450, "5746": 42451, "5747": "unstable stars", "5748": 5 } 42673{ "5743": 42671, "5744": 42672, "5745": 42673, "5746": 42674, "5747": "trh143 lamp", "5748": 5 } 42677{ "5743": 42675, "5744": 42676, "5745": 42677, "5746": 42678, "5747": "trh143 star", "5748": 5 }	Here is the content converted into a Markdown bullet-list. Irrelevant bullet characters have been removed; each item remains as in the original. - espresso finish eastern king bedroom set home improvement stores madison wi - easy kitchen table centerpiece ideas decoration for dining room best decor top sink clogged deco - eagle style faucets kitchen delta utility home fixtures bathroom sink sinks modern splendid depot moen waterfall faucet hood fire suppression system - exciting red kitchen cabinet handles cabinets and white ceiling interior design ideas - elegant chef kitchen appliances new vintage stoves and modern ideas lovely appliance set retro packages - elegant centerpiece ideas dining table decorations for christmas ornaments - ejector pump cost basement bathroom system do i need one residential sewage prices toilet ejecto - executive chef sink rack strive large size of kitchen accessories sinks broad kohler - example of a kitchen designed by which is free design software good program best download online - eleven gables kitchen as featured in design magazine stainless steel farm house sink with apron farmhouse sinks 36 - exclusive kitchen design catalogue on home decoration planner with tiles d - eternal kitchen countertop picture gallery - elegant kitchen pantry cabinets freestanding standing cabinet free furniture for sale latest - elegant marble tile bathroom floor images about ideas on for pinterest home improvement neighbor face - eclectic living room meaning sets leather - elements international storage bedroom mirror with - electric with 5 elements and knob controls black kitchenaid stove knobs parts - estate 5 piece aluminum outdoor bar height dining set table patio furniture n - enclosed paper towel dispenser holder home ideas center business kitchen diy bathroom with shiplap ceiling ide - eastern mist design kohler bathroom idea tool ideas - edwardian dining chairs ebay furniture outlet chicago - electric patio heater water fire sense commercial home depot instant hot portable outdoor heaters costco cushions target - elongated toilet seat rugs lid covers bathroom toi - easy cheap closet organization basement bedroom organizers ideas organizer - encouraging outdoor rug ideas new or adorable geometric cheap rugs for patio with furniture decorating christmas cookies toddle - elegant home depot kitchen cabinets inspirational top contemporary gallery punt cabinet sets design - economic bathroom designs modern ideas on a budget original sink design shower area bathrooms india for bedroom office sm - excellent used mobile kitchens for sale kitchen trailer rental white large seattle amazing - eye level pantry organization kitchen cabinet storage ikea organize cabinets drawers - extraordinary vinyl tile for bathroom how to clean luxury with contemporary and tiles in wall bunnings ext - entertainment unit living room 7 cool contemporary wall designs for your - edge led illuminated bathroom mirror with lights demister pad and motion sensor hollywood mirrors uk - elite review cheap gel mats kitchen nightmares full episodes - entryway decor how to dress up your for the holidays seasons easy winter holiday bathroom decorating ideas small living room seasonal - explore our stunning range of porcelain and ceramic kitchen floor wall tiles enter your details below to get a copy catalogues for best w - echelon mocha kitchen cabinets paint color cabinet photos buy furniture hardware faucets costco - enameled kitchen sink real porcelain enamel coating to re your drainboard tub ceramic porcelin sinks kohler double kit - expandable glass dining table set ikea metal and - elegant modern purple master bedroom color interior design ideas picture colors home improvement companies near me - easy extra kitchen cabinet shelf bookshelves locking supports small ideas add an in your upper cabinets - enthralling cost of granite slab in staggering kitchen how much does a countertop installers countertops installed price gorgeous mesmerizing - enlarge grey white kitchen paint cabinets with gray wall decorating gorgeous rooms - easy elegant table decorations centerpiece idea halloween entertaining decor decorating cookies with royal icing - explore hundreds of pine natural hardwood options in various colors textures species order samples to help find the right look for you flooring cumberland home improvement wilson - enlarge southwestern kitchen lighting cabinets liquidators pueblo style home traditional design - elegant new design kitchens kitchen cabinet cabinets and countertops - elegant butcher board fresh sealing wood s in the kitchen for dollars seminar counter sealer - ed patio roof design plans cover building ideas s wood - espresso coloured furniture gray walls dark brown bedroom paint color grey set furnitur - eclectic powder bathroom apartment plans small world home apartments near me design tips to make a better - electric frosted glass windows cost privacy film 2 of 3 bathroom window price f - explore our stunning range of porcelain and ceramic kitchen floor wall tiles enter your details below to get a copy catalogues design catalogue ca - electric fireplace for bedroom ideas glamorous white small fireplaces tv stan - elegant fun bath rugs purple and lavender bathroom mats gold accessories walmart home improvement catalog coupon m - eclectic living room meaning century eclecticism in architecture rooms decorating for fall designer shower curtains sets ikea mea - enchanting bedroom colour schemes grey country by sims carpet ideas decorating - ex display kitchen cheapest appliances ireland cheap northern - easy planner kitchen design 3d - elegant spray paint kitchen cabinets cost uk how much does it to painting new co - exhaust fan duct sharing routing can we combine kitchen bathroom ducts pipe insulation sink cabinet bath vent - egg armchair living room beach style with brown upholstered ottoman tripod floor lamp neutral muted color 4 furniture outlet dallas - exactly what would you do if your mobile kitchen rental trailer was not readily available for emergency commercial headaches seattle - essence cushion cover pair living room cushions ireland decorating ideas indian style soft furnishings - end of summer kitchen window by via drapes small curtains ideas - eclectic design meaning medium size of living room interior concept clothing rugs ideas eclecti - enlarge kitchen ideas home designs beautiful efficient small kitchens - elegant corner bathroom shelves and shelf design ideas beautiful wood full size shelving small glass - exterior door master bathroom size decorating tips for cakes what is the standard residential - even home bathroom scales ratings closest improvement store near me best scale - event details hogwarts dining hall decorations decorating ideas for kitchen airport harry potter world till - exciting depot cabinets illuminated lighted home mirror extending lights round heated shaving bathroom cabinet - elegant brick patio general shale paver cost michigan cushions clearance - entrancing highest rated kitchen faucets your house concept top amazon reviews touch - expand a drawer medicine spice bottles organizer bathroom organisers uk home improvement stores online pills - enclosed patio kits screened enclosure walls only in lowes - extraordinary barn sliding doors interior for bathroom - electronic bathroom scales white lightweight home ratings improvement wilson quotes - expert design project help designing my kitchen layout online n - electric fireplace bedroom best small fireplaces mantels lowes exquisite portable 8 electri - estimate bathroom remodel cost budget calculator excel home improvement shows on netflix awesome remodeling estimat - enchanting wooden dining table and 6 chairs room tables oak with sale d - eclectic style interior design living room meaning ideas decor - existing kitchen cabinets average cost refacing roller shutter doors not rolling ideas prices cabinet c - elite weathered oak laminate flooring options hardwood cumberland home improvement loans in texas review - end kitchen cabinet shelves sagging cabinets lowes - excellent nice outdoor kitchen designs best design ideas inside kitchens pictures the store company florida images creative - elite kitchen waste disposal unit maid air switch p recycling bins uk - entertainment living room home ideas setups - excellent blue bedroom decorations room decor living bedding to navy themes home improvement stores open now - exactly what would you do if your temporary mobile kitchen rental trailer was not offered for emergency commercial nightmares seattle - espresso machine candy apple red kitchenaid coffee with grinder - efficiency apartment size appliances used inch gas range for sale tiny house small stoves apartments kitchen drop leaf table app - exterior irrigated living wall 2016 greenhouse patio furniture austin stores denver walls - eleven kitchen whats your favorite aquamarine backsplash design ideas kerala - electric fireplace for bedroom ideas wall mounted in small fireplaces tv - eclectic orange kitchen with cabinets and hardwood floor cabinet refacing county ny - elegant porcelain tile kitchen countertops design picture - excellent beautiful compact bathroom designs with small narrow and also full design home improvement cast members bathroo - eastern king storage bedroom espresso finish set home improvement stores that went out of business - earth sky colors dining room version 2 walls sharkskin ceiling blue trim painted think outside the box - electric decorating gas ideas master decoration engaging breast corner bedroom decor chimney mantel old small fireplaces fireplace doors houston - enlarge bathroom decor pinterest cafe christmas decorating trends 2019 create smashing powder room - entertainment living room home theater reddit center and coffee table - enlarge elegant dining room 1930 style table beautiful rooms - exclusive kitchen cabinets from modern furniture italian chairs - espresso two light bath fixture jonathan adler bathroom lighting control panel supplier in uae bronze oil rubbed contemporary 2 - extendable solid wood dining table and 8 queen chairs 1930 style - easy glass kitchen jars uk kitchenaid mixer recipes canisters love bottles for storage - espresso white upper cabinets lower love contrast kitchen wall oven cabinet house black base overhead unit designs south africa 2 - es s stools for kitchen bench gold coast sink cabinet - easy kitchen cabinet makeover cabinets makeovers pictures island - eclectic la home kitchen dining room lighting ideas design 2018 one of a kind - easy kitchen flooring contemporary sheet vinyl on feet how - easy planner 3d kitchen design best free online virtual room programs and tools - e bedroom accessories aspiration ideas to inspire you how make pertaining 4 bathroom decor pinterest cafe decorating christmas tree clipart ma - extending dining tables and chairs table 6 white high gloss oak with royal dini - eclectic style interior design meaning and how to apply it best living room modern theater ideas app - easy kitchen flooring wood floor options for kitchens best and bath on feet floorin - eclectic kitchen a freestanding stainless steel island with shelf on wheels topped butcher block - eight ways to save water at home bathroom - extraordinary round patio dining table sets from black walnut wood lumber also a set of antique living room chairs with roller ball caster wheels and vintage - example small bathroom floor plans converting a closet into compact full design home improvement shows near me - easy installation flooring options hardwood cumberland home improvement contractors in greenville nc - extending dining table and bench awesome the children s bedroom company of kitchen with room furniture set - enclose a patio enclosed ideas best on screened designs budget kits in - extraordinary ideas bedroom furniture sets as cheap queen ikea design uk home improvement cast nancy chic black hawk haven photo 3 store - elegant high end restaurant chairs amazing restaurants furniture with on modern italian kitchen fabulous design - economic bathroom designs remodel budget cheapest medium size of updates on a ideas india 5x7 design i - espresso kitchen cabinets paint mocha cabinet ideas images - enchanting butcher block prep table kitchen canada kitchenette brand contemporary food tables - elongated toilet seat cover and rug set sets bathroom rugs covers lid bath - e kitchen tiles murals accent for floor tile inserts posts island copper pretty agreeable bathroom wall shared kids room and storage ideas - end of summer kitchen window by via covering designs curtains modern - extra large flower pots plant for sale garden planters planter cheap black plastic containers plan patio plants landscape architects in kerala gard - extractor fan kitchen hood slimline exhaust nightmares netflix s - eclectic style interior design meaning and how to apply it best simple amazing living room sets ideas i - eclectic living room meaning design inspiration interior share - endearing fabulous accessories contemporary kitchen sink extraordinary modern suited for your hotel sinks ceramic by design si - extending dining table and 6 chairs solid oak with royal set black glass tab - euro inch round dining table and pub a 70 with lazy susan - easy paper lantern chandelier with additional small home decor inspiration cute interior and furni - elegant b and q bathroom cabinet cheap furniture cabinets drawer unit ebay reasons why you go to stores on your own - enter image description here paper towel kitchen dispenser bunnings how would one use the phrase roll - example of a kitchen designed by which is free design software designing my layout layouts with islands online - endearing round glass dining room sets table and chairs top ideal cheap set online bases for tops - enlarge room banquette dining furniture smart beautiful kitchen banquettes - elegant corner kitchen table with comfortable couch beautiful wooden design dining bench 3 piece and breakfast set - extraordinary small compact bathroom designs design ideas inspiring worthy about narrow full discount home improvement store near me extra - excellent leak under bathroom sink leakage handicap kitchen faucet leaking moen - engineered quartz cost factors compare different kitchen countertops - employee discounts on kitchen appliances pricing washers dryers discount online n - elegant style small living room lighting ideas shocking handmade premium material wonderful interior design white collection beautiful best - eyelet dress curtain in voile patio door curtains doors net - enlarge kitchen design tiles ideas tile backsplash white kitchens - elegant kitchen cabinet material door choice image design modern comparison pro and con in list indium used cabinets materials kerala awesome kitche - easy clean click clack bath waste with overflow medium image premium bathroom accessories pack diagram home improvement wilson gif - extendable dining table set room sets fancy round white gloss extending kitchen with bench - elkay kitchen faucets commercial - entry floor tile ideas photos gallery contractor home tiles kitchen flooring and bathroom design for floors - examples of bedroom furniture made to breakdown ideal ltd quebec - easy thanksgiving centerpieces cool homemade decorations yard centerpiece - example of a 3 panel center fixed gliding patio door in cocoa bean color anderson windows sliding doors - easy coffee maker all new manual kitchenaid machine with grinder - extendable table transparent chrome plated glass dining set ikea canada - entrancing rustic cherry kitchen cabinets paint color modern with view mocha cabinet table sets col - espresso in x anti fatigue comfort mat black and cream kitchen mats kitchenaid artisan n - extraordinary inside decorations interior for house christmas ideas room decor diy collect this idea bringing the spirit into yo - elegant kitchen sink cleaning powder cleaner table walmart 5 - elegant white kitchen tiles wall with grey grout tile best for - elite 6 qt bowl lift stand mixer kenmore vs kitchenaid warranty overview - elegant residential tower with a view beach orange architects project wins the competition for an exclusive la maison home decor limassol - elegant z desk inspirational beautiful wall decor than contemporary ideas compact gallerie decorating awesome lov - extreme world market dining chairs living room furniture dubai sale - exciting upholstered bedroom chair blue small images of brown chairs fabric im - elegant dining room designs that will bring simplicity in your home scandinavian design chairs - elegant different types of kitchen for inspirational design concept countertops pros cons fresh - engineered hardwood flooring options concrete dining room shower design ideas for small bathrooms - edit courtesy of architecture design create a kitchen my own fire station five tips to usable firehouse cooking area - exhaust fan with humidity sensor switch vent bathroom ventilation - enlarge gray and white kitchen cabinet ideas 2018 design kitchens - easy cabinet refinishing kitchen cost for home design style with refacing ideas wood refurbished painting kitche - eastern king bedroom set furniture of villa park 4 pieces contemporary espresso finish home improvement loans wells fargo bedroo - extending draw leaf dining table made in rosewood price vintage danish design kitchen tables kitchenaid mixer colors - easy shelf ideas that you can pipe brackets kitchen bookshelves shelving nz - easy wire basket side table project living room decor diy home ideas for best decorating - extendable dining set white glass table ikea canada - evolution excel hp household garbage disposer waste disposal kitchen machine best reviews and price - elegant hanging lamps for kitchen light fixtures of with pendant lights kitchens plans in island pe - electric patio heater alternative views outdoor heaters costco umbrella - entry after manchester tan living rooms room design inspiration are your paint colors chopping up flow - excellent bathroom fan with led light pro v airbus commercial grade square exhaust ventilation - enlarge design of kitchen islands island ideas photos great - elite grade a ceramic rectangular rounded corner flat bottom bathroom vessel flushed walls sink with tall round vs rectangle small undermount - exterior and interior design ideas country style kitchen elegant wall decals stoves home bad - easy rustic home decor ideas on a budget living room diy wall - edit no not my bathroom unfortunately job i did for a client so they could watch cameras as well sky etc while in the bath television master - essentials kitchen paper towel rolls 2 ply perforated sheets roll case online india - exquisite pale yellow kitchen cabinets with regard to green and walls seafoam - elk lighting wrought iron black and antique gold inch four kitchen light fixtures simple pipe fixture outdoor - eye catchy kitchen with burnt orange cabinets and a unique island wholesale county ny - extravagant living room designs that will make you jealous mediterranean rooms ideas om w - easy decorations homemade ideas for holiday decorating diy christmas decor pictures images - elegant dining room scandinavian interior design designs that will bring simplicity in your home - en simple kitchen remodel ideas renovation remodels s - exhaust fan delta ventilation bath with humidity sensor led light bathroom extractor and timer - enormous lanterns hung over a breakfast nook kitchen lighting pendant fixtures island hanging light pendants - electric fireplace bedroom lace furniture with for in small fireplaces mantels - eclectic living room design decorating contemporary ideas sitting stunning meaning rugs chic - edge quartz blue cabinet kitchen countertops white gray - espresso king bed contemporary leatherette eastern in place sleigh bedroom finish set home improvement shows on hulu ki - example of small kitchen island being a butcher block create my own designs with islands - extraordinary kitchen and bath design magazine wooden cupboard sink remodel awesome images desig - elegant kitchen rack unique shelving ideas than best of shelves ikea smart and compact - exquisite ideas cabinets kitchen custom doors for retrofit or replacement on ikea remodelista - endearing wonderful kitchen island classic contemporary design with wooden materials and stove x ideas top lovable wonderfu - epoxy wood how to seal en laminate sealer solid do i beeswax finish kitchen counter for best resin top projects try island - espresso eastern king bedroom finish set home improvement wilson meme vanity acme furniture jasper - eleven kitchen whats your favorite aquamarine backsplash designer jobs in dubai - ejector pump cost basement bathroom to plumb a images home design - extraordinary best brand name kitchen appliances lighting painting is like furniture store logos brands of brandsmart small wonderful - enchanting kitchen paper towel holder high low stainless steel diy how many bathrooms in spanish towe - eh heat extractor for kitchen in ghana - easy strong cheap bunk bed design blue cabinet loft patterned apartments for rent near me 1 bedroom - estimate your custom project popular types kitchen countertops n - easy elegant table decorations centerpiece idea simple dining room decor halloween entertaining decorating icing betty crocker - extremely sleek and contemporary kitchen island designs design of islands ideas photos - electric kettle heat extractor for kitchen in ghana - excel home budget spreadsheet fresh kitchen remodel template for design unique remodeling worksheet sprea - elegant lounge decor ideas best living room on modern rustic - espresso finish legs contemporary bedroom furniture eking size bed linen eastern king set home improvement cast wilson acme 2 - easy pieces modern dining tables and benches table throughout for plan wooden with bench corner chair set solid wood blue made com in - everyday single handle standard kitchen faucet with escutcheon and side spray in chrome elkay faucets discontinued n - enjoyable z tree topper ideas dining room table decor idea as well satisfying gallerie decorating - eh w heat extractor for kitchen in ghana - extra large patio umbrella unique fresh cheap umbrellas ideas contemporary of set for elegant awesome - easy kitchen makeovers budget remodel images - excellent ideas paint finish for kitchen cabinet finishes club astonishing decorations styles and - eclectic interior design living room ideas meaning sets walmart - elegant bathroom cabinets online design of goodly marvelous cabinet cheap wall buy - elegant dining room pier one gold tufted suede chair damask upholstered chairs furniture online uae decor hourglass taupe cha - electric patio heater amazing heaters remodel concept outdoor home costco pavers tucson - extension dining table sandalwood mission room kitchen island ikea by keyston - economic bathroom designs remodel budget cheapest medium size of updates on a ideas india design for bed - eat in kitchen by my beautiful abode tile splashback tiled pictures guide - extendable oval table walnut kitchen ireland faucets dining tables - elegant inspired bedroom design style ideas moroccan marvelous rooms - eastern king upholstered platform bed bedroom espresso finish set home improvement stores open now - eclectic living room in style furniture ideas meaning small design modern inspiring decor ro - enchanting living room furniture popular of formal layout best ideas about seating arrangements pinterest theater fau furnit - eastern king bedroom espresso finish set home improvement stores open near me sets - entrancing vintage kitchen lighting decoration ideas by furniture island antique farmhouse decor islands bakery counter for sale - electric stainless steel kitchenaid dryer parts mixer sale - extra deep kitchen sink single bowl sinks nightmares full episodes - espresso bathroom vanity w cultured marble double basin sinks - extremely creative copper kitchen faucet how to choose the right style for your and faucets with sprayer soap dispenser unusual design ide - easy thanksgiving centerpieces for your holiday table decoration ideas cool homemade decorations yard e - enlarge interior kitchen design ideas on a budget beautiful efficient small kitchens - extending oak dining tables table 6 chairs can deliver solid with used round e - elite mixer attachments tilt head stand kenmore vs kitchenaid bowl lift 0 - eclectic modern living room what is the meaning of sets ideas - extendable dining table with chairs glass dinner full size chair extending kitchen bench e - embodying all great about modern ceramic flooring the range of timber effect tiles comes with a tactile surface and realistic grain laminate floor kitchen tile - elegant appliance packas new inspirational stock kitchen appliances and awesome lovely ge cafe packages recommendations - elegance and style vale bathroom fireplaces ltd - expensive living room sets round glass top dining table and chairs designs luxury bases for tops roun - elegant tree decorating ideas new best home decor images on christmas pinterest aqua blue with mesh luxury and white - eye catching kitchen tile ideas to love grey tiles wall - eclectic living room meaning chairs modern furniture and decor image of great ideas - enchanting bathroom cabinet large target medicine mirror cabinets medium size of bathrooms with extra ideas medici - enlarge kitchen bookshelves ideas shelves diy smart storage small kitchens - extending walnut dining table chairs kitchen ireland nightmares netflix - eclectic living room by pierce design associates meaning sets rooms to go the of color red - engineered quartz cost factors kitchen cabinets countertops costco and - exterior bamboo shades outdoor blinds for patio target roman lighting direct promo code window roller - easy thanksgiving centerpieces for your holiday table decoration ideas cool homemade decorations outdoor el - electric under cabinet lighting led lights round kitchen strip uk ligh - en sink soap dispenser under bottle pump parts replacement vine repair kitchen replaceme - e series patio doors 5 anderson windows sliding eagle - extra large dining table with extension leaves black walnut kitchen dark room and circular w chairs ireland storage modern extending - extra large shower stall mats gray mat in best home decorating ideas websites magazine lar - embodying all great about modern ceramic flooring the range of timber effect tiles comes with a tactile surface and realistic grain kitchen easy on feet best tough sty - electric oven cheapest kitchen appliances ireland buy household - extra shelves for kitchen cabinets easy cabinet shelf source a bookshelves cupboard liners ikea cabi - extending dining table chairs set room with bench kitchen - ess steel with shelf wolf kitchen and view in gallery tile stainless backsplashes for kitchens backsplash tiles - exterior and interior design ideas country style kitchen tiles for french stoves bathroom - elegant contemporary kitchen ceiling lights brilliant for modern floating clouds and ideas unique best led ce - embodying all great about modern ceramic flooring the range of timber effect tiles comes with a tactile surface and realistic grain for kitchen floor tile ideas pinterest bes - electric patio heater it can get chilly at night during any season porches porch outdoor heaters costco dining sets home depot - ergonomic and organized contemporary kitchen with translucent sliding doors modern hardware specialty divider sink - engineered flooring easier hardwood kitchen wood laminate kitchenaid - enclosed outdoor patio ideas backyard porch fresh or best decorating semi small covered designs australia design for bedroom corners - eclectic design meaning large size of living style interior clothing contemporary room unusual ideas ecl - enlarge elegance only looks easy elegant living rooms display fine design room ideas interior for apartment decorating - extendable glass top dining table chairs for sets 8 set - example of a classic bedroom design in barbara barry bed furniture - enlarge pencil tile modern backsplashes for kitchens kitchen backsplash designs beautiful - empire industries inch double bowl kitchen sink undermount squareline - exhaust fan duct bathroom vent pipe photo 8 of roof large image kitchen insulation table decor - elegant lighting kitchen apartment island pendants cut glass chandelier how to light panels - easy crafts for adults to make ideas holiday craft projects seasons winter bathroom decor decorating living rooms - elegant kitchen island with seating and best ideas on home design white islands for 4 - easy crafts for adults to make ideas holiday craft projects seasons winter bathroom decor decorating tips small spaces - elegant black and white decor exciting picture classy bedroom ideas furniture pinterest decorating color trends 2019 for bedrooms - excellent kitchen island pendant for your residence inspiration spacing lights - easy thanksgiving decorations cool homemade table simple centerpieces outdoor thanks - easy kitchen flooring tile ideas for a warm guide on feet floori - electric fireplace in bedroom for small fireplaces tv stand costco e bedro - egg chair la maison home decor limassol - ex display kitchen find out now what should you do for fast kitchens cheapest appliances ireland buy - exciting bathroom lighting 4 light lowes clearance designer definition vanity lights contemporary fixtures l - elements queen bedroom set chest mattress free white ikea - excellent cool free kitchen design software home depot unusual for kitchens designer awesome program easy planner 3d beauteous virtual bathroom or pla - exotic princess toddler bed bedding set tiana bedroom and the frog crib - expert design project help kitchen cabinet sets home depot cabinets ideas n - epic chrome dining chairs on home bedroom furniture ideas with leather uk fair new bern nc set 8 brass and - eye catching mobile kitchen island awesome small with storage best pertaining to islands home designs - elegant marble granite kitchen work tops cream black worktop ideas wooden worktops - episode the club house lake living hgtv design ideas for small kitchen and dining room - en island support columns pictures decorative with for kitchen to ceiling islands an by contemporary miner design - enlarge create my own kitchen island make your with seating great ideas - evergreen centerpiece diy christmas decor pictures ideas pinterest festive table decorations - espresso finish eastern king bedroom set home improvement wilson gif - estimate cost of painting interior house refinishing kitchen cabinets s kitchenaid microwave pai - even a year old farmhouse can go industrial here designer peter incorporates salvaged antique finials and wood beams to warm the space new design kitchen bath showcase renovati - eclectic decorating living room meaning curtains amazon in small design furniture ideas pictures family with - eclectic room with white paper lantern light fixture home decor - examples outstanding small kitchen tables with storage table sets within high top island ideas rectangular and ou - empire walnut in a bathroom vinyl tiles wall australia bathrooms - elegant renovating bathroom ideas renovate small best your remodeling on a budget el - elegant kitchen floor mats awesome anti fatigue mat new rubber and walmart contemporary lovely m - extra deep sofa trend couch in modern ideas with living room couches ikea sets for sale - elevated quartz kitchen ideas with sink countertop - exotic nces reviews re cooking kitchen nce gallery dishwasher frigidaire appliances - electric fireplace for bedroom in small gas fireplaces bedrooms vent video downlo - extra deep single bowl kitchen sink black granite sinks ideas 2019 stainless steel de - espresso king bed frame make an eastern all size fr bedroom finish set home improvement wilson face contempor - exhaust fan stove vent above hood fans for stoves kitchen installation - elegant industrial style home bar ideas kitchens kitchenaid - exclusive kitchen remodel cost per square foot for your home interior design ideas with remodeling commercial kitche - easy kids crafts ideas so many great that are doable and fun seasons winter holiday bathroom decor decorating christmas cookies kit 2 - entertainment center for up to living room centre home co - everything old is new again tile then and now compare different kitchen countertops - extremely creative small kitchen design ideas interior in india cabinets - eclectic interior designs blog design home decor living room meaning rugs walmart understanding style in n a thus making definition for eclec - exquisite decoration glass kitchen cabinet doors option types cabinets homes decor - extending dining table rustic mahogany pottery barn c kitchen with bench - ejector pump installation cost basement bathroom fascinating bathtub photos plumbing pictures price system pit - exceptional extra large black lacquered table circa oak cm dining girona kitchen ideas with island id f - eternal quartz bathroom countertops pictures - extravagant living room designs that will make you jealous mediterranean style design ideas - espresso bathroom vanity w solid oak wood and white double basin sinks - east winter garden vegetables forest country living throughout pretty your residence texas home improvement wilson meme y - enlarge image 8 khloe kardashian home photos house pics inside and - exotic granite top dining set table tables marble price room kitchen night - enclosed patios best condo patio images on ideas pinterest decorating studio llc - en design modern top t worktop made out corian kitchen countertops price - enter image description here waste disposal kitchen management kitchener on how do you drain a garbage - eternal gold kitchen countertop picture gallery - exciting home media room interior design dimension book red carpet diaries 2 chapter - excellent we want to add panel moulding below the chair rail blue bedroom with dining room panels - enameled cast iron large double bowl sink in white x 1 2 8 kitchen undermount squareline la small single biscuit - electric fireplace in small bedroom images buy fireplaces tools menards for - excellent best made kitchen cabinets cabinet custom american manufacturers likable dimensions - eastern king bedroom espresso finish set home improvement shows on hulu size art furniture saint coffee platform sleigh bed frame - exterior shutter types kitchen rolling cost cabinets roll down shutters - eat in kitchen light fixtures contemporary lighting ideas led with lights k - easy thanksgiving centerpieces decorations for the table cool homemade diy outdoor - easy kitchen flooring to clean floors fascinating also best care on feet flo - enlarge image kitchenaid gas range double oven 30 freestanding reviews review - expandable cutlery tray 4 compartment drawer dividers for and kitchen utensils made plastic utensil - easy planner 3d kitchen design - enchanting modern bathroom design ideas cool interior with bathtub shower vessel sink india stunning futuristic insp - espresso vanity top ideas adorable bathroom counter tile white subway behind pictures above bathrooms tops - exhaust fan bathroom fans humidity sensing reviews inspirational with sensor and fa - excellent bedroom designs furniture sets ikea design uk home improvement wilson meme - elegant dining room designs that will bring simplicity in your home scandinavian sideboards - easy planner home interior design software 3d kitchen modular - employing a stone sand colored tile flooring and naturally light wood tones kitchen grey ideas designs - exhaust fan cover bathroom remove replacement motor ceiling - examples of bedroom furniture made to breakdown quebec mfi for small spaces - easy decorations homemade do it yourself decor ideas halloween entertaining decorating icing - extractor fan ducting kitchen hood slimline designer s steel exhaust islands clearance duc - elegant grey led lighting kitchen strip ikea equipment list - easy stone patio projects you should try for your yard ideas design no designs pinterest - expandable farmhouse table large size of kitchen sets in nice with leaves centerpiece ideas - exquisite kitchen cabinets for residence ideas outdoor plans awesome pdf architecture salary in florida - endearing 4 x 8 kitchen rug with latest rugs table bench magnificent area awesome sisal cream at stores lowes throw bedrooms sets queen yellow tan cushions washable - espresso wood traditional finish queen bed eastern king bedroom set home improvement contractors near me 4 piece cal - electric fireplace for bedroom two sided the home in small fireplaces screens lowes bedroo - entertaining like this is all in the details aroma of fresh baked goods taste savoury and sweet nibbles visual beauty flickering casalife bathroom heater lamp - easy and unique ornaments with a farmhouse cottage style for trees decor diy christmas pictures table ideas - external image melamine cabinets redo kitchen painting laminate diy over - eclectic cottage home with a vibrant yet balanced color palette aqua kitchen pinterest table sets - esteem sink bathroom sinksunique sinks product is home improvements catalog going out of business - exterior door double wide bedroom doors decorating christmas tree with ribbon what is the standard size for residential - easy extra shelf inside cabinet finished kitchen bookshelves clips home depot small ideas add an in your upper cabinets - elkay kitchen faucets faucet parts diagram - elegant contemporary dining table extension scandinavian room teak tables - extend the enjoyment of your home by adding a new outdoor dimension kitchens fire pits fireplaces patios decks courtyards living and - easy kitchen organization ideas for small spaces and dollar store home pinterest sink drain - e nautical themed bedroom coastal decor ideas update furniture sets crib bedding tical nice beach reviews whi - eat kitchen wall art large stickers letters for fork and spoon decor - enzyme drain cleaner kitchen sink powder kitchenaid dishwasher n - elegant patio backyard pergola ideas with roof cheap covering waterproof sun shades shade lighting supply coupon - excellent kitchen storage cabinets marvelous organizers re mends of furniture lowes pantry cabinet c - elegant free standing kitchen sink unit with freestanding stand alone units small cape town new - elegant vintage farmhouse kitchen islands antique bakery counter for sale designs island awesome beautiful industrial solid wood table f - ejection pump toilet basement bathroom ejector quick how to finish a smell ej - emerald home furnishings dining room server black at simply discount furniture - exceptional best material for kitchen cabinets in pictures design materials kerala cupboard d - empire dining suite with chairs black kitchen tables bench cabinets online - exquisite decoration contemporary living rooms showdown show room hgtv fixer upper colors modern design home custom upholste - easy vintage farmhouse decor canada decorating sugar cookies with buttercream at its roots style springs from an appreciation for historic primitive or items particularly relat - enlarge kitchen glass cabinets decor distinctive front doors - enchanting rustic country kitchen decor decorating ideas fabulous and best r pinterest 2019 fabu - economic bathroom designs excellent astounding ideas small remodel on a budget intended for india design apartmen - empty round glass storage jars with lids clamp jar food container sale australia - exquisite delightful tin ceiling tiles kitchen backsplash for - etched glass kitchen cabinet doors door ideas - estates ltd vale bathroom and fireplaces no dot 1 agent in residential estate agents info at com f a stunning 2 bedroom penthouse apartment on the floor of regent court w - enchanting outdoor dining set with umbrella patio furniture sets info for cheap fantastic pa - electric fireplace for bedroom wall mount in the small fireplaces grate lowes e - espresso finish eastern king bedroom set home improvement neighbor face - easy patio designs with additional home interior design models large covered australia ideas for small bathrooms m - electric stoves intended for range info design lowes kitchenaid ranges double oven wall - endearing installing tile over laminate elegant painting in bathroom to look like white marble astounding design awesome paint countertop porcelain endear - easy kitchen remodel configuration tool design remodeling tips redoing a diy cabinets ea - elegant shaker style kitchen cupboard doors 7 cabinet hardware cupboards cabinets grey sty - elegant dining room designs that will bring simplicity in your home scandinavian design furniture ho - exclusive heritage x double bowl stainless steel kitchen farmhouse apron front sink top mount - elegant wall tiles kids room bathroom designs travertine tile - enlarge seeded glass door inserts kitchen designs with wooden frame distinctive cabinets front doors - elegant brick patio cost paver michigan heater lowes exotic labor - elegant dining room corner bench with best table ideas only on solutions pinterest kitchen faucets delta wonderful be - extraordinary compact dining set table and chairs triangle wondrous kitchen australia d - entertainment base living room system ideas media consoles - explorers wall tapestry beautiful hanging wanderlust theme bohemian decor home 3 sizes bohemia art decorating trends 2019 - enlarge kitchen display cabinets uk glass fronted cabinet gun - examples ornate intriguing stainless steel kitchen cabinets tips ideas metal manufacturers comfortable decor also then gracious cabinet hooks renew wood cupboard renewal saver - enlarge glass kitchen door ideas distinctive cabinets front doors - every celebration paper lantern home decor - exquisite double sink vanity with brown cabinets also oval mirror in the middle of two rectangular newport white 60 inch bathroom exquis - elegantly and beautifully furnished shabby chic dining room decorating rooms ideas small beautiful decoration - exterior trim anderson windows sliding patio doors - easy thanksgiving place card ideas cool homemade decorations door for cards --- Here’s a stripped-down view highlighting only the identifier, name (5747), and value (5748): \| ID \| Name \| Value \| \|-------\|--------------------\|-------\| \| 32535 \| space dust \| 2 \| \| 32539 \| meteorites \| 3 \| \| 33529 \| smouldering lamps \| 0 \| \| 35760 \| dark stars \| 4 \| \| 35764 \| dark lamps \| 4 \| \| 37396 \| lava lanterns \| 5 \| \| 37896 \| bright lamps \| 0 \| \| 37900 \| bright stars \| 1 \| \| 38170 \| scrolls \| 5 \| \| 39679 \| hydra lamps \| 0 \| \| 40200 \| supreme stars \| 5 \| \| 42125 \| chaotic tomes \| 5 \| \| 42450 \| unstable stars \| 5 \| \| 42673 \| trh143 lamp \| 5 \| \| 42677 \| trh143 star \| 5 \|	8,309	7,732	-7,622,684,172,856,578,000	concat	[ "concat_full" ]	0.75	true	null
1,857,890,186,573,385,000	ENDS IN: ENDS IN: 08HRS 56MIN 29SEC Up to 65% Off Sitewide Thumbnail 0Thumbnail 1Thumbnail 2Thumbnail 3 Lawrence Taylor New York Giants Mitchell & Ness Retired Player Name & Number Long Sleeve Top - Royal In Stock Your Price: $109.99 Details • Product ID: 2417845 • Material: 100% Cotton • Embroidered fabric applique • Tagless collar • Rib-knit cuff • Side slits • Contrast color-blocked sleeves • Tackle twill applique • Drop tail hem • Long sleeve • Machine wash, tumble dry low • Officially licensed • Imported • Brand: Mitchell & Ness Description You are a die-hard New York Giants fan and love showing off that unwavering loyalty as often as you can. Now you can perfectly accomplish your goal the moment you put on this Lawrence Taylor New York Giants Retired Player Name & Number Long Sleeve Top from Mitchell & Ness. This tee features crisp New York Giants graphics on the front and back, perfect for accentuating your ardent team pride. IP/Domain name tracking information IPv4 address: 204.112.186.153 Track blog visitors IPs with Mobile Tracker IPv4 expanded: 204.112.186.153 IPv4 decimal: 3429939865 Internet service provider: Bell MTS Organization: Bell MTS Country name: Canada Country ISO alpha-2 code: CA State: Manitoba City: Morden Timezone: America/Winnipeg Longitude: -98.1 Latitude: 49.1833 WHOIS last updated: WHOIS data frequency request limit is reached. Try again later. Reverse DNS host: bellmts.net Reverse DNS pointer: wnklmb01dc1-186-153.dynamic.bellmts.net Reverse DNS in-addr.arpa: 153.186.112.204.in-addr.arpa domain name pointer wnklmb01dc1-186-153.dynamic.bellmts.net. Reverse DNS last updated: 29 days, 21 hours ago on September 14, 2019, 7:30 am GMT Time Reverse DNS next check: in 4 months, 30 days on September 14, 2019, 7:30 am GMT Time Operating System Android 5.0 Browser Chrome 48.0.2564.106 Device Type Desktop User Agent String Mozilla/5.0 (Linux; Android 5.0; SM-G900W8 Build/LRX21T; wv) AppleWebKit/537.36 (KHTML, like Gecko) Version/4.0 Chrome/48.0.2564.106 Mobile Safari/537.36 Bot/spider No IP record views 44 This IP pageloads: 1 hardware Internet Protocol Address INFO This Internet Protocol Address tracking information is software attained for 204.112.186.153. The host has the IP (Internet protocol) 204.112.186.153. This IP (hardware Internet protocol) adheres to valid specifications of an IPv4 IP (a.k.a. Internet protocol), which has a long/decimal value of 3429939865. The computer IP address is assigned to a hardware Internet Protocol Address range of 204.112.186.0 - 204.112.186.255. The reverse DNS for the inspected host is bellmts.net. A domain pointer seems to be wnklmb01dc1-186-153.dynamic.bellmts.net. A full callback for the evaluated reverse DNS query was acknowledged to be wnklmb01dc1-186-153.dynamic.bellmts.net at the time of this request. ORGANIZATION AND ISP An organization that acquired 204.112.186.153 is Bell MTS. An Internet Service Provider (also known as ISP) that hosts the network hardware chain to maintain the query identity is Bell MTS. IP geographic location The data for the tracing info indicates that the connection to this host has an assigned address in Morden, Manitoba, Canada. The timezone of the physical address of this host is America/Winnipeg. The last user of this device IP address that connected to the website was using a computer system running Android 5.0 with Chrome 48.0.2564.106 browser. COPY & PASTE html code for this report To link to this report from your website or blog, copy and paste this html code into your web page Direct URL for the report This simple url can be used for refering to this report in emails and printed media Web Analytics with a Flavor Recent [15] IPv4 addresses trace results as of October 14, 2019, 5:24 am [GMT]. Next update in 23 min, 39 sec ID IP Address Organization / ISP Country State City Timezone Browser Operating System Bot/spider 1 98.127.222.9 Spectrum United States Montana Great Falls America/Denver Chrome 77.0.3865.90 Windows, 10.0 No 2 183.83.145.75 ACT Fibernet India Telangana Alwal Asia/Kolkata Mozilla Firefox 68.0 Windows, 7 No 3 83.120.80.199 Mobile Communication Company of Iran Iran - - - - - - Asia/Tehran Chrome 75.0.3770.143 Android, 9 No 4 14.245.96.126 Vietnam Posts And Telecommunications Group Viet Nam Tinh Binh GJinh Qui Nhon Asia/Ho_Chi_Minh Chrome 71.0.3578.99 Android, 9 No 5 213.230.84.25 Uzbektelekom Joint Stock Company Uzbekistan Toshkent Shahri Tashkent Asia/Tashkent Chrome 77.0.3865.116 Android, 5.0.2 No 6 27.72.109.23 Viettel Group Viet Nam Hanoi Hanoi Asia/Ho_Chi_Minh Chrome 77.0.3865.90 Windows, 10.0 No 7 20.246.136.165 No United States - - - - - - America/Chicago Chrome 77.0.3865.116 Android, 6.0 No 8 154.202.46.58 MacroLAN South Africa Gauteng Johannesburg Africa/Johannesburg - - - - - - No 9 171.78.219.164 Airtel India National Capital Territory of Delhi New Delhi Asia/Kolkata Chrome 67.0.3396.62 Mac OS, X 10.11.3 No 10 178.75.200.67 Vida optics TVV Ltd. Bulgaria Oblast Pleven Cherven Bryag Europe/Sofia Chrome 77.0.3865.73 Android, 7.0 No 11 93.100.32.181 Skynet Ltd Russian Federation St.-Petersburg St Petersburg Europe/Moscow Chrome 77.0.3865.116 Android, 8.0.0 No 12 188.166.34.171 DigitalOcean Netherlands North Holland Amsterdam Europe/Amsterdam Chrome 39.0.0.0 Android, 5.1 No 13 202.83.43.132 Asianet India Kerala Kozhikode Asia/Kolkata Chrome 77.0.3865.120 Windows, 10.0 No 14 46.211.139.221 Kyivstar PJSC Ukraine Kharkivs'ka Oblast' Kharkiv Europe/Kiev Chrome 74.0.3729.157 Android, 6.0 No 15 46.42.160.11 VimpelCom Russian Federation Tatarstan Republic Kazan’ Europe/Moscow Internet Explorer 10 Windows, 7 No Any information copied or otherwise reproduced from this website must have a proper attribution. If you have used any of the content displayed on TraceMyIP.org Tools, you agree to properly reference to the source of information by creating a direct link to https://tools.tracemyip.org/	## ENDS IN: - 08HRS 56MIN 29SEC ## Promotion Up to 65% Off Sitewide --- ## Lawrence Taylor New York Giants Mitchell & Ness Retired Player Name & Number Long Sleeve Top - Royal In Stock Your Price: $109.99 ### Details - Product ID: 2417845 - Material: 100% Cotton - Embroidered fabric applique - Tagless collar - Rib-knit cuff - Side slits - Contrast color-blocked sleeves - Tackle twill applique - Drop tail hem - Long sleeve - Machine wash, tumble dry low - Officially licensed - Imported - Brand: Mitchell & Ness ### Description You are a die-hard New York Giants fan and love showing off that unwavering loyalty as often as you can. Now you can perfectly accomplish your goal the moment you put on this Lawrence Taylor New York Giants Retired Player Name & Number Long Sleeve Top from Mitchell & Ness. This tee features crisp New York Giants graphics on the front and back, perfect for accentuating your ardent team pride. --- # IP/Domain Name Tracking Information ## IP Details - IPv4 address: 204.112.186.153 - IPv4 expanded: 204.112.186.153 - IPv4 decimal: 3429939865 ## Provider - Internet service provider: Bell MTS - Organization: Bell MTS ## Geographic Location - Country name: Canada - Country ISO alpha-2 code: CA - State: Manitoba - City: Morden - Timezone: America/Winnipeg - Longitude: -98.1 - Latitude: 49.1833 ## WHOIS - WHOIS last updated: WHOIS data frequency request limit is reached. Try again later. ## Reverse DNS - Reverse DNS host: bellmts.net - Reverse DNS pointer: wnklmb01dc1-186-153.dynamic.bellmts.net - Reverse DNS in-addr.arpa: 153.186.112.204.in-addr.arpa domain name pointer wnklmb01dc1-186-153.dynamic.bellmts.net. - Reverse DNS last updated: 29 days, 21 hours ago on September 14, 2019, 7:30 am GMT Time - Reverse DNS next check: in 4 months, 30 days on September 14, 2019, 7:30 am GMT Time ## Client Information - Operating System: Android 5.0 - Browser: Chrome 48.0.2564.106 - Device Type: Desktop - User Agent String: Mozilla/5.0 (Linux; Android 5.0; SM-G900W8 Build/LRX21T; wv) AppleWebKit/537.36 (KHTML, like Gecko) Version/4.0 Chrome/48.0.2564.106 Mobile Safari/537.36 - Bot/spider: No - IP record views: 44 - This IP pageloads: 1	1,698	675	1,857,890,186,573,385,000	concat	[ "concat_full" ]	0.75	true	null
8,352,282,067,778,067,000	Lineage for d1i3rd2 (1i3r D:1-120) 1. Root: SCOPe 2.02 2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric 4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S) 5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) 7. 1198665Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries) 8. 1198675Domain d1i3rd2: 1i3r D:1-120 [61627] Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1 contains covalently bound peptides at the N-termini of chains B, D, F and H complexed with nag, ndg; mutant Details for d1i3rd2 PDB Entry: 1i3r (more details), 2.4 Å PDB Description: crystal structure of a mutant iek class ii mhc molecule PDB Compounds: (D:) fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain SCOPe Domain Sequences for d1i3rd2: Sequence; same for both SEQRES and ATOM records: (download) >d1i3rd2 d.19.1.1 (D:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr SCOPe Domain Coordinates for d1i3rd2: Click to download the PDB-style file with coordinates for d1i3rd2. (The format of our PDB-style files is described here.) Timeline for d1i3rd2: 16th Century, Antwerpen, Sewing, Tayloring Fixing fit problems: Armseye One of the nice things about following more period correct methods of construction (ie, the methods laid out The Modern Maker series of books) is that the methods lend themself really well to alterations. That is, without very much fuss at all I can fix a fit issue (or make a garment fit someone else) without having to completely de-construct… Continue Reading Sewing F*king pockets A few nights ago my husband came home from fight practice and said we had to talk. He said that he was having a crisis of faith and was feeling that he was making no progress at his fighting. “I should be better at this,” he said. We talked for a while and eventually I told him about my problem… Continue Reading Stitches & Seams Ease There’s two ways (that I know of) where you talk about “ease” in sewing. First you add (or remove) ease on a garment so that it is larger (or smaller) than the actual measurement. An early period tunic has more ease than a late period form-fitting doublet. A corset is constructed with negative ease. Second you talk about easing one… Continue Reading Stitches & Seams Prick Stitch (also sometimes called pick stitch) Make a seam. Iron (or finger press) the seam open. Working from right to left (if you’re right-handed) on the face of the garment work a back stitch where the stitch showing on the face of the garment goes over 1-2 threads leaving a little tiny stitch showing. On the back the stitch will be much longer. This will hold… Continue Reading Stitches & Seams Basting Stitch A long loose stitch used to hold two pieces of fabric together. This is normally either hidden in seam allowance or intended to be removed once the garment is completed. This is one of the pieces of the skirting to my son’s new doublet. To give the skirting a bit of body I’ve added some linen canvas interlining. First I… Continue Reading Tunic Sew Along Tunic Sew Along: Finish your tunic [Late to the conversation? See all of the tunic sew-along from the beginning] Step 6: Finish your tunic. Someone in my FaceBook page (Research Dumping Ground), asked “Why do you sew flat felled seams with the flap on the outside?” Good question. Initially, when I first started sewing tunics (2003-2004), it was because no one told me any different. Jeans… Continue Reading Stitches & Seams Slip Stitch I use the slip stitch for rolled hems, attaching linings and for applique. This is a stitch my mother taught to me and I use it on practically every garment I’ve ever made. I am right handed so if you’re left-handed you’ll have to do the mental gymnastics to reverse this. For my example I’m using brown button hole thread… Continue Reading Tunic Sew Along Tunic Sew Along: Trim your hem [Late to the conversation? See all of the tunic sew-along from the beginning] Step 5: Trim your hem. If I were working on a full length tunic or a dress I’d have the recipient try it on with the shoes they plan to wear and a belt/appron if they plan to wear that and then mark where it hits the… Continue Reading Tunic Sew Along Tunic Sew Along: Construct your tunic [Late to the conversation? See all of the tunic sew-along from the beginning] Step 4: Construct your tunic. First things first, thread. Use whatever thread makes you happy. For the construction of a tunic I like a nice 100% cotton thread or something with a polycore. I’ve been told that 100% silk or poly threads will cut through your fabric… Continue Reading Stitches & Seams Anatomy of woven fabric A loom holds the warp threads. The weft threads are then woven into the warp threads in a particular pattern. These are compacted to create fabric. The area at each edge of the warp where normally the weft threads change direction is referred to as the selvedge. When viewing a piece of fabric the warp threads will run parallel to… Continue Reading	# Lineage for d1i3rd2 (1i3r D:1-120) 1. Root: SCOPe 2.02 2. Class d: Alpha and beta proteins (a + b) 3. Fold d.19: MHC antigen-recognition domain (dimeric) 4. Superfamily d.19.1: MHC antigen-recognition domain 5. Family d.19.1.1: MHC antigen-recognition domain 6. Protein: Class II MHC β-chain, N-terminal domain 7. Species: Mouse (Mus musculus), I-E<sub>K</sub> 8. Domain d1i3rd2: 1i3r D:1-120 - Other chains in the same PDB: d1i3ra1, d1i3ra2, d1i3rb1, d1i3rc1, d1i3rc2, d1i3rd1, d1i3re1, d1i3re2, d1i3rf1, d1i3rg1, d1i3rg2, d1i3rh1 - Contains covalently bound peptides at the N-termini of chains B, D, F and H - Complexed with N-acetyl-d-glucosamine (nag, ndg); mutant --- ## Details for d1i3rd2 - PDB Entry: 1i3r (resolution 2.4 Å) - Description: Crystal structure of a mutant I-E<sub>K</sub> class II MHC molecule - Compounds: Fusion protein consisting of MHC E-β<sub>K</sub> precursor, glycine-rich linker, and hemoglobin β-2 chain --- ## Domain Sequence > d1i3rd2 d.19.1.1 (D:1-120) > Class II MHC β-chain, N-terminal domain > Mouse (Mus musculus), I-E<sub>K</sub> > > gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl > eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr --- ## Coordinates [Download the PDB-style coordinate file for d1i3rd2](#) (format described in SCOPe documentation) --- # 16th Century, Antwerpen, Sewing, Tayloring ## Fixing fit problems: Armseye One of the nice things about following more period correct methods of construction (ie, the methods laid out The Modern Maker series of books) is that the methods lend themself really well to alterations. That is, without very much fuss at all I can fix a fit issue (or make a garment fit someone else) without having to completely de-construct… ## F*king pockets A few nights ago my husband came home from fight practice and said we had to talk. He said that he was having a crisis of faith and was feeling that he was making no progress at his fighting. “I should be better at this,” he said. We talked for a while and eventually I told him about my problem… ## Stitches & Seams ### Ease There’s two ways (that I know of) where you talk about “ease” in sewing. First you add (or remove) ease on a garment so that it is larger (or smaller) than the actual measurement. An early period tunic has more ease than a late period form-fitting doublet. A corset is constructed with negative ease. Second you talk about easing one… ### Prick Stitch (also sometimes called pick stitch) Make a seam. Iron (or finger press) the seam open. Working from right to left (if you’re right-handed) on the face of the garment work a back stitch where the stitch showing on the face of the garment goes over 1-2 threads leaving a little tiny stitch showing. On the back the stitch will be much longer. This will hold… ### Basting Stitch A long loose stitch used to hold two pieces of fabric together. This is normally either hidden in seam allowance or intended to be removed once the garment is completed. This is one of the pieces of the skirting to my son’s new doublet. To give the skirting a bit of body I’ve added some linen canvas interlining. First I… ### Slip Stitch I use the slip stitch for rolled hems, attaching linings and for applique. This is a stitch my mother taught to me and I use it on practically every garment I’ve ever made. I am right handed so if you’re left-handed you’ll have to do the mental gymnastics to reverse this. For my example I’m using brown button hole thread… ## Tunic Sew Along ### Construct your tunic First things first, thread. Use whatever thread makes you happy. For the construction of a tunic I like a nice 100% cotton thread or something with a polycore. I’ve been told that 100% silk or poly threads will cut through your fabric… ### Trim your hem If I were working on a full length tunic or a dress I’d have the recipient try it on with the shoes they plan to wear and a belt/appron if they plan to wear that and then mark where it hits the… ### Finish your tunic Someone in my FaceBook page (Research Dumping Ground), asked “Why do you sew flat felled seams with the flap on the outside?” Good question. Initially, when I first started sewing tunics (2003-2004), it was because no one told me any different. Jeans… ## Anatomy of woven fabric A loom holds the warp threads. The weft threads are then woven into the warp threads in a particular pattern. These are compacted to create fabric. The area at each edge of the warp where normally the weft threads change direction is referred to as the selvedge. When viewing a piece of fabric the warp threads will run parallel to…	1,543	1,299	8,352,282,067,778,067,000	concat	[ "concat_full" ]	0.75	true	null
-7,309,268,133,882,625,000	Month: April 2019 Ranch Building Plans ranch building plans house plans for ranch style homes house plans ranch house plans ranch style ranch style homes ranch building plans house plans for ranch style homes house plans ranch house plans ranch style ranch style homes. ranch building plans open concept ranch floor plans ranch style house plans with open concept beautiful open floor ranch house plans elegant house plans open concept ranch floor. ranch building plans split floor house plans split floor plan ranch house plans what is a bedroom split level house design images. ranch building plans ranch style home floor plans ranch house plans with basement garage ranch style house floor plans. ranch building plans 4 bedroom floor plan 3 bedroom ranch house plans 4 bedroom ranch floor plans beautiful 3. ranch building plans house plans ranch with basement basement design plans ranch home floor plans with walkout basement inspirational. ranch building plans house plans for ranch style homes house unique ranch open floor plans ranch open floor plans. ranch building plans l. ranch building plans ranch style house plans awesome design ideas ideas about homes on. ranch building plans 4 bedroom ranch house plans best house plans images on home plans house 4 bedroom ranch house plans with 3 car garage. ranch building plans ranch home graphic showing front porch and faux dormers from plan family home plans. ranch building plans square foot house square foot ranch house plans luxury square foot house plans. ranch building plans ranch style house plans home plans for ranch style homes l shaped ranch house plans ranch ranch style house plans. ranch building plans house plans surprising inspiration house floor plans plans additionally of a ranch house plans. ranch building plans t shaped ranch house plans best of t shaped farmhouse floor plans homes floor plans. Floor Plans Mansions floor plans mansions amazing floor plans plans amazing floor plans mansions homes house with photos open floor plans with amazing floor plans floor plans mansions amazing floor plans plans amazing floor plans mansions homes house with photos open floor plans with amazing floor plans. floor plans mansions luxury mansion floor plans amazing mansions architecture ideas architecture 6. floor plans mansions estate home floor plans of 5 bedroom open concept house luxury mansions small homes. floor plans mansions manor house floor plan elegant floor plans for luxury mansions mansion floor plans homes. floor plans mansions beautiful luxury mansion floor plans for luxury modern mansion floor plans beautiful luxury house designs and. floor plans mansions floor plans for mansions marble house floor plan gilded age. floor plans mansions small mansion house plans mansions floor plans download by small ranch house plans with walkout basement small mansion house plans. floor plans mansions small luxury home plans for small luxury house plans one story mansion house plans mega mansion. floor plans mansions mansion floor plans mansion house plans fresh lovely home plans with pool architects near me. floor plans mansions floor plans for marina mansions. floor plans mansions mansions floor plans download by. floor plans mansions home plans ideas for your home mega mansion floor plan with million newly. floor plans mansions castle floor plan luxury home floor plans with elegant mansions floor plans luxury. floor plans mansions homes mansions stone mansion listed million home plans blueprints. floor plans mansions ff sf ll. Raised Beach House Plans raised beach house plans raised beach house plans. Old Style Home Plans old style home plans old style country house plans classic country house plans lovely old style home country style home old style home plans old style country house plans classic country house plans lovely old style home country style home. old style home plans vintage style house plans vintage farmhouse plans lovely awesome home plans farmhouse of vintage farmhouse plans vintage style house plans. old style home plans style homes old style homes style home plans new crest style home plan style homes style homes. old style home plans old house plans beach house plan 2 story old style beach home floor plan style. old style home plans old style home plans elegant house plan style. old style home plans old farmhouse style homes house plan old farmhouse full size of farmhouse style house plans old farmhouse style homes. old style home plans cottage style home plans cottage style home plans designs old house with front porch cottage style cottage style home plans. old style home plans old style house plans home is designed for comfort cottage home plans the homes. old style home plans house plans. old style home plans plantation style house plans old. old style home plans old style farmhouse floor plans old farmhouse floor plans beautiful farm home plans elegant old style. old style home plans homes i love these old homes must find one to buy or remodel ours to pay homage. old style home plans house plan. old style home plans home plans house plan front elevation old style home plans. old style home plans old style home plans best of old home tropical exterior by. Basic Ranch Floor Plans basic ranch floor plans rectangle ranch floor plans awesome simple rectangular 3 bedroom house plans bedroom ideas basic ranch floor plans rectangle ranch floor plans awesome simple rectangular 3 bedroom house plans bedroom ideas. basic ranch floor plans plain ranch house plans luxury simple ranch house plans fresh dazzling free house floor plans. basic ranch floor plans ranch style home floor plans craftsman style ranch home plans of floor plans for 4 bedroom. basic ranch floor plans beautiful s three bedroom ranch floor plans. basic ranch floor plans 3 bedroom ranch house plans plans one story two bedroom traditional stone ranch house plans with. basic ranch floor plans simple ranch house floor plans simple open floor house plans wonderful simple small house floor plans. basic ranch floor plans open concept ranch floor plans 4 bedroom rambler house plans awesome creative ideas simple open concept ranch house plans 1 ranch open concept ranch floor. basic ranch floor plans square foot ranch house plans square feet floor plans new simple sq ft house plans beautiful sf ranch sq ft ranch house plans with walkout. basic ranch floor plans simple ranch house plans simple ranch plans simple ranch floor plans simple ranch style house plans. basic ranch floor plans simple ranch plans surprising simple ranch house plans 3 bedroom. basic ranch floor plans simple ranch plans simple ranch style house plans lovely plain ranch house plans lovely simple ranch. basic ranch floor plans ranch style house floor plans simple ranch floor plans ranch house floor plans simple ranch house. basic ranch floor plans 3. basic ranch floor plans simple ranch plans 4 bedroom 3 bath floor plans best simple ranch house style 4 bedroom simple ranch plans 3 bedroom ranch house. basic ranch floor plans ranch style home plans small ranch style house plans ranch floor plans small ranch style home plans fanciful simple small ranch style house plans with open. Patio Home Floor Plans patio home floor plans patio home floor plans e story patio home plans unique layout home plans lovely floor one story patio home floor plans patio home floor plans patio home floor plans e story patio home plans unique layout home plans lovely floor one story patio home floor plans. patio home floor plans patio house architects ground floor plan small patio home floor plans. patio home floor plans patio homes plans floor plans for patio homes fresh landmark home plans elegant patio homes plans patio homes plans house plan floor one story patio home floor plans. patio home floor plans floor plans for patio homes floor plans for patio homes fresh home floor plans homes floor luxury patio home floor plans. patio home floor plans small patio house plans small patio home floor plans inspirational inspiring patio house plans 9 house patio home open floor plans. patio home floor plans best of patio home floor plans or one story patio home floor plans awesome floor plan patio house floor plans. patio home floor plans image result for patio home floor plans patio house floor plans. patio home floor plans patio home plans craftsman bungalow house small modern 2 bedroom open floor plan p single level patio home floor plans. patio home floor plans patio home floor plans patio home floor plans idea patio homes floor plans and patio home one story patio home floor plans. patio home floor plans inspiration model square feet serenity floor plan 3 bedroom patio home floor plans. patio home floor plans homes floor plans floor plan patio home floor plans 3 bedroom patio home floor plans. patio home floor plans frightening homes floor plans elegant small patio home unique baby patio home open floor plans. patio home floor plans image of patio home floor plans free darling patio home floor plans. patio home floor plans verbena patio home single level patio home floor plans. patio home floor plans verbena patio home one story patio home floor plans. Tiny Home House Plans tiny home house plans a modern rustic tiny house in the woods tiny home house plans a modern rustic tiny house in the woods. tiny home house plans an error occurred. tiny home house plans tumbleweed tiny house building plans. tiny home house plans tiny homes modern interior inside tiny houses house floor plans modern best living ideas on interior tiny homes modern tiny houses. tiny home house plans. tiny home house plans tiny home plan mobile tiny house plans lightweight tiny house plans wonderful tiny house floor plan. tiny home house plans modern tiny home ideas modern tiny house plans ideas modern tiny house ideas. tiny home house plans tiny house plans free tiny home house plans micro house plans free elegant housing tiny home tiny house plans. tiny home house plans tiny house plans free building plans for small houses new avenue homes tiny home building plans. tiny home house plans tiny home house plans tiny houses interiors interior design house plans exotic the images tiny houses. tiny home house plans tiny home house plans new tiny homes floor plans and tiny home house plans tiny houses. tiny home house plans tiny home house plans tiny home floor plans free exploiting the help of tiny house plans. tiny home house plans how to build a tiny house step by step. tiny home house plans free tiny house plans free tiny house plans on wheels a lovely tiny home floor plans. tiny home house plans i absolutely love this house the design is absolutely gorgeous even though it is a tiny home mean that it still have charm and this. Outdoor Room Plans outdoor room plans patio patio gazebo ideas kyard outside plans outdoor pool outdoor room plans patio patio gazebo ideas kyard outside plans outdoor pool. outdoor room plans landscape design services battle creek mi outdoor landscape and supplies. outdoor room plans outdoor living spaces patio gallery western design and build serving orange riverside counties room covered plans. outdoor room plans medium size of small floor ideas pictures swimming images design area space beautiful designs plans. outdoor room plans outdoor living space plans great designs room pictures how to design the perfect indoor decorating good outdoor living design plans room. outdoor room plans outdoor living room plans on modern home decoration ideas with inspiration. outdoor room plans outside room dividers architecture pertaining to plans 5 outdoor room dividers outdoor room divider ideas. outdoor room plans patio patio furniture designs front screened in porch ideas full size of decorating rustic outdoor. outdoor room plans outdoor living spaces plans one story home plan with inside house plans outdoor living e es. outdoor room plans screened gazebo plans deck and gazebo designs fresh my outdoor room the deck reveal. outdoor room plans large size of kitchen tools living spaces images pictures areas room design covered patio. outdoor room plans outdoor room outside shed. outdoor room plans indoor outdoor room ideas room and design ideas style photos tent outdoor sitting plans designs indoor. outdoor room plans patio. outdoor room plans entire outdoor room packages are instant easy fun. 900 Sq Ft House 900 sq ft house sq ft house plans square foot house plan square foot house plans 2 bedroom house 900 sq ft house sq ft house plans square foot house plan square foot house plans 2 bedroom house. 900 sq ft house sq ft floor plans sierra style house kit medium sq ft house plans style. 900 sq ft house sq ft apartment sq ft house square foot apartment square foot house plans home design. 900 sq ft house sq feet home plan sq feet home plan in low budget sq ft house. 900 sq ft house photo way less counter space thanks to that. 900 sq ft house the cabin is low to the ground and snuggled in among the pines and aspen a humble lookout post facing the continental divide on the horizon. 900 sq ft house square ft house plans beautiful sq ft house plans in. 900 sq ft house house plans sq ft house plans elegant best cabin images on square foot 2. 900 sq ft house home plans ideas for your home square ft house plans inside square. 900 sq ft house square ft house plans luxury square foot home plans. 900 sq ft house sq ft house plans 2 bedroom bath east facing square foot new architectures. 900 sq ft house square foot house plans inspirational sq ft house plans 2 bedroom awesome square. 900 sq ft house house plans sq ft duplex house plans in arts sq ft house plans with garage. 900 sq ft house sq ft apartment sq ft apartment square foot apartment small house plans under sq ft. 900 sq ft house sq ft house plans luxury square foot house plans beautiful. Hummingbird House Plans hummingbird house plans hummingbird house hummingbird house plans hummingbird house. hummingbird house plans hummingbird house plans. hummingbird house plans the hummingbird house hummingbird house east unique home stays hummingbird house plans. hummingbird house plans sq ft house small house plans sq ft hummingbird sq ft house design. hummingbird house plans hummingbird house plans beautiful hummingbird house plans house plans home designs of hummingbird house plans. hummingbird house plans picture of hummingbird house. hummingbird house plans hummingbird house plans lovely hummingbird house plans for house plans with virtual walk through hummingbird house. hummingbird house plans hummingbird house plans vibrant ideas low cost housing plans clever design images about cost house designs. hummingbird house plans leap adaptive hummingbird. hummingbird house plans download by tablet desktop original size back to hummingbird house plans. hummingbird house plans modern style house plan 2 beds 2 baths sq ft plan. hummingbird house plans how to make a hummingbird house lo build plans. hummingbird house plans exterior hummingbird. hummingbird house plans hummingbird house plans lovely models hummingbird house. hummingbird house plans simple bird feeder plans pigeon house plans modern wood bird feeders plan dream design hummingbird simple woodworking free johnny simple bird feeder. a b c d e f g h i j k l m n o p q r s t u v w x y z News Check out market updates Hot prices in California Hot prices in California Rate this post Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. At vero eos et accusamus et iusto odio dignissimos ducimus qui blanditiis praesentium voluptatum deleniti atque corrupti quos dolores et quas molestias excepturi sint occaecati cupiditate non provident, similique sunt in culpa qui officia deserunt mollitia animi, id est laborum et dolorum fuga. Et harum quidem rerum facilis est et expedita distinctio. Nam libero tempore, cum soluta nobis est eligendi optio cumque nihil impedit quo minus id quod maxime placeat facere possimus, omnis voluptas assumenda est, omnis dolor repellendus. Sed ut perspiciatis unde omnis iste natus error sit voluptatem accusantium doloremque laudantium, totam rem aperiam, eaque ipsa quae ab illo inventore veritatis et quasi architecto beatae vitae dicta sunt explicabo. Nemo enim ipsam voluptatem quia voluptas sit aspernatur aut odit aut fugit, sed quia consequuntur magni dolores eos qui ratione voluptatem sequi nesciunt. (113) Comments 1. You really make it appear really easy along with your presentation but I in finding this topic to be actually something which I believe I’d by no means understand. It sort of feels too complicated and very huge for me. I am looking forward in your next post, I will try to get the cling of it! 2. I’ve been browsing on-line more than three hours nowadays, yet I by no means discovered any fascinating article like yours. It is beautiful worth enough for me. Personally, if all webmasters and bloggers made good content material as you probably did, the internet can be a lot more useful than ever before. 3. Hi there, You have done a fantastic job. I’ll certainly digg it and personally recommend to my friends. I’m sure they will be benefited from this website. 4. I would like to thank you for the efforts you’ve put in penning this site. I am hoping to see the same high-grade blog posts from you later on as well. In truth, your creative writing abilities has inspired me to get my own website now 😉 5. My brother suggested I would possibly like this web site. He used to be totally right. This submit actually made my day. You cann’t believe just how so much time I had spent for this information! Thanks! 6. I’ve been surfing on-line more than three hours today, yet I never discovered any attention-grabbing article like yours. It is pretty worth enough for me. In my opinion, if all site owners and bloggers made excellent content material as you probably did, the web shall be much more helpful than ever before. 7. Have you ever thought about publishing an ebook or guest authoring on other blogs? I have a blog based upon on the same subjects you discuss and would really like to have you share some stories/information. I know my audience would enjoy your work. If you’re even remotely interested, feel free to send me an e-mail. 8. Hi there! I realize this is somewhat off-topic but I had to ask. Does operating a well-established blog such as yours take a lot of work? I’m completely new to writing a blog but I do write in my diary daily. I’d like to start a blog so I will be able to share my experience and views online. Please let me know if you have any recommendations or tips for new aspiring blog owners. Thankyou! 9. Spot on with this write-up, I actually believe that this website needs a lot more attention. I’ll probably be returning to read more, thanks for the advice! 10. My developer is trying to persuade me to move to .net from PHP. I have always disliked the idea because of the costs. But he’s tryiong none the less. I’ve been using WordPress on several websites for about a year and am anxious about switching to another platform. I have heard excellent things about blogengine.net. Is there a way I can transfer all my wordpress posts into it? Any help would be really appreciated! 11. Great goods from you, man. I have understand your stuff previous to and you’re just extremely magnificent. I actually like what you have acquired here, really like what you’re saying and the way in which you say it. You make it enjoyable and you still take care of to keep it sensible. I can’t wait to read much more from you. This is actually a wonderful site. 12. I believe that is one of the most important info for me. And i’m satisfied studying your article. But should commentary on some general issues, The site taste is great, the articles is really nice : D. Good activity, cheers 13. I know this web site provides quality depending content and other information, is there any other web site which presents such information in quality? 14. I love your blog.. very nice colors & theme. Did you make this website yourself or did you hire someone to do it for you? Plz reply as I’m looking to design my own blog and would like to find out where u got this from. thank you 15. Hey there! This is my 1st comment here so I just wanted to give a quick shout out and tell you I genuinely enjoy reading your posts. Can you recommend any other blogs/websites/forums that go over the same subjects? Thanks for your time! 16. hello!,I love your writing so a lot! proportion we keep up a correspondence extra approximately your post on AOL? I require a specialist on this area to solve my problem. Maybe that’s you! Looking forward to see you. 17. Good day! Do you know if they make any plugins to help with Search Engine Optimization? I’m trying to get my blog to rank for some targeted keywords but I’m not seeing very good gains. If you know of any please share. Thank you! 18. Hello! I could have sworn I’ve been to your blog before but after browsing through many of the articles I realized it’s new to me. Regardless, I’m certainly pleased I discovered it and I’ll be book-marking it and checking back frequently! 19. Great items from you, man. I’ve take into account your stuff previous to and you are simply extremely wonderful. I actually like what you’ve got right here, really like what you are saying and the best way wherein you say it. You’re making it entertaining and you continue to care for to stay it wise. I cant wait to learn much more from you. This is really a tremendous web site. 20. Woah! I’m really loving the template/theme of this site. It’s simple, yet effective. A lot of times it’s very hard to get that “perfect balance” between user friendliness and visual appearance. I must say you have done a excellent job with this. Additionally, the blog loads super fast for me on Opera. Exceptional Blog! 21. Today, while I was at work, my cousin stole my iphone and tested to see if it can survive a forty foot drop, just so she can be a youtube sensation. My iPad is now broken and she has 83 views. I know this is totally off topic but I had to share it with someone! 22. Thanks for another informative web site. Where else could I get that type of information written in such an ideal manner? I have a project that I’m simply now running on, and I have been on the look out for such information. 23. hello there and thank you for your info – I have definitely picked up anything new from right here. I did however expertise a few technical points using this web site, since I experienced to reload the web site many times previous to I could get it to load properly. I had been wondering if your web hosting is OK? Not that I am complaining, but slow loading instances times will often affect your placement in google and could damage your high-quality score if ads and marketing with Adwords. Anyway I’m adding this RSS to my e-mail and can look out for a lot more of your respective intriguing content. Make sure you update this again very soon. 24. My partner and I absolutely love your blog and find many of your post’s to be exactly I’m looking for. Would you offer guest writers to write content available for you? I wouldn’t mind producing a post or elaborating on some of the subjects you write about here. Again, awesome website! 25. Greetings from Florida! I’m bored at work so I decided to check out your website on my iphone during lunch break. I enjoy the knowledge you provide here and can’t wait to take a look when I get home. I’m surprised at how quick your blog loaded on my mobile .. I’m not even using WIFI, just 3G .. Anyways, awesome blog! 26. I got what you intend, appreciate it for putting up.Woh I am happy to find this website through google. “Don’t be afraid of opposition. Remember, a kite rises against not with the wind.” by Hamilton Mabie. 27. Enjoyed looking at this, very good stuff, thankyou . “Whenever you want to marry someone, go have lunch with his ex-wife.” by Francis William Bourdillon. 28. Hello There. I found your blog using msn. This is an extremely well written article. I’ll be sure to bookmark it and come back to read more of your useful information. Thanks for the post. I will definitely comeback. 29. Thanks a lot for giving everyone an extremely pleasant possiblity to read in detail from this website. It is always very lovely plus packed with fun for me personally and my office peers to search your website particularly 3 times per week to read the new secrets you will have. And indeed, I’m also at all times happy considering the unique tips you give. Some 3 ideas on this page are rather the most suitable we have all ever had. 30. Hi! I know this is kind of off topic but I was wondering if you knew where I could get a captcha plugin for my comment form? I’m using the same blog platform as yours and I’m having problems finding one? Thanks a lot! 31. Great work! That is the type of info that are supposed to be shared across the web. Disgrace on the search engines for not positioning this post upper! Come on over and seek advice from my website . Thank you =) 32. Its like you learn my thoughts! You appear to understand so much about this, such as you wrote the e-book in it or something. I believe that you simply can do with some p.c. to pressure the message home a little bit, but other than that, this is great blog. An excellent read. I will definitely be back. 33. I was curious if you ever thought of changing the page layout of your blog? Its very well written; I love what youve got to say. But maybe you could a little more in the way of content so people could connect with it better. Youve got an awful lot of text for only having one or two pictures. Maybe you could space it out better? 34. Heya i’m for the first time here. I found this board and I find It truly useful & it helped me out much. I hope to give something back and help others like you aided me. 35. An impressive share! I’ve just forwarded this onto a coworker who has been conducting a little research on this. And he actually ordered me dinner due to the fact that I found it for him… lol. So allow me to reword this…. Thanks for the meal!! But yeah, thanks for spending some time to talk about this topic here on your site. 36. Undeniably believe that which you said. Your favorite reason appeared to be on the net the simplest thing to be aware of. I say to you, I certainly get irked while people consider worries that they plainly do not know about. You managed to hit the nail upon the top and also defined out the whole thing without having side-effects , people can take a signal. Will probably be back to get more. Thanks 37. Nice blog here! Also your site so much up very fast! What web host are you the usage of? Can I get your associate link for your host? I desire my site loaded up as fast as yours lol 38. I am in fact glad to read this web site posts which includes lots of valuable information, thanks for providing these kinds of statistics. 39. Today, I went to the beach front with my kids. I found a sea shell and gave it to my 4 year old daughter and said “You can hear the ocean if you put this to your ear.” She placed the shell to her ear and screamed. There was a hermit crab inside and it pinched her ear. She never wants to go back! LoL I know this is entirely off topic but I had to tell someone! 40. Its like you learn my mind! You seem to know so much approximately this, like you wrote the e-book in it or something. I feel that you could do with a few percent to drive the message house a bit, but other than that, this is fantastic blog. An excellent read. I’ll definitely be back. 41. When someone writes an paragraph he/she maintains the image of a user in his/her brain that how a user can be aware of it. Therefore that’s why this post is great. Thanks! 42. Right here is the perfect webpage for anybody who hopes to find out about this topic. You know so much its almost tough to argue with you (not that I personally will need to…HaHa). You certainly put a brand new spin on a subject that’s been written about for decades. Wonderful stuff, just wonderful! 43. Good day I am so thrilled I found your site, I really found you by accident, while I was searching on Yahoo for something else, Anyways I am here now and would just like to say thanks for a remarkable post and a all round thrilling blog (I also love the theme/design), I don’t have time to go through it all at the minute but I have book-marked it and also included your RSS feeds, so when I have time I will be back to read a lot more, Please do keep up the fantastic work. 44. Hello there! This is my first visit to your blog! We are a group of volunteers and starting a new initiative in a community in the same niche. Your blog provided us valuable information to work on. You have done a marvellous job! 45. Wonderful beat ! I would like to apprentice even as you amend your web site, how could i subscribe for a weblog web site? The account helped me a appropriate deal. I had been a little bit acquainted of this your broadcast offered bright transparent concept 46. Howdy! This article couldn’t be written much better! Going through this article reminds me of my previous roommate! He always kept talking about this. I will forward this post to him. Fairly certain he’ll have a great read. Thank you for sharing! 47. Hello, I do believe your blog could be having internet browser compatibility issues. Whenever I take a look at your site in Safari, it looks fine however, if opening in Internet Explorer, it’s got some overlapping issues. I just wanted to provide you with a quick heads up! Aside from that, fantastic website! 48. Hey! I just wanted to ask if you ever have any problems with hackers? My last blog (wordpress) was hacked and I ended up losing many months of hard work due to no back up. Do you have any solutions to protect against hackers? 49. Hello, I do believe your web site could be having browser compatibility issues. Whenever I look at your blog in Safari, it looks fine however, when opening in Internet Explorer, it’s got some overlapping issues. I simply wanted to give you a quick heads up! Other than that, great site! 50. I used to be suggested this web site by means of my cousin. I am now not positive whether or not this post is written by him as no one else understand such targeted about my problem. You’re wonderful! Thanks! 51. I used to be suggested this website by way of my cousin. I’m now not certain whether or not this put up is written by him as no one else realize such special approximately my difficulty. You’re amazing! Thanks! 52. Howdy! This post could not be written any better! Reading this post reminds me of my previous room mate! He always kept talking about this. I will forward this write-up to him. Fairly certain he will have a good read. Thanks for sharing! 53. With havin so much content and articles do you ever run into any issues of plagorism or copyright infringement? My blog has a lot of exclusive content I’ve either written myself or outsourced but it looks like a lot of it is popping it up all over the internet without my authorization. Do you know any solutions to help prevent content from being ripped off? I’d certainly appreciate it. natalielise plenty of fish 54. Right here is the right site for anyone who would like to find out about this topic. You understand so much its almost hard to argue with you (not that I personally would want to…HaHa). You certainly put a fresh spin on a subject which has been written about for decades. Great stuff, just excellent! 55. I have been surfing online more than 2 hours today, yet I never found any interesting article like yours. It’s pretty worth enough for me. In my opinion, if all webmasters and bloggers made good content as you did, the internet will be a lot more useful than ever before. pof natalielise 56. I have to thank you for the efforts you have put in writing this site. I really hope to see the same high-grade blog posts by you later on as well. In truth, your creative writing abilities has motivated me to get my very own website now 😉 57. Pretty portion of content. I just stumbled upon your blog and in accession capital to claim that I get actually loved account your weblog posts. Any way I’ll be subscribing for your augment or even I fulfillment you get right of entry to constantly rapidly. 58. I’m really enjoying the design and layout of your website. It’s a very easy on the eyes which makes it much more enjoyable for me to come here and visit more often. Did you hire out a designer to create your theme? Excellent work! 59. You actually make it seem really easy along with your presentation however I find this matter to be really something that I believe I might never understand. It seems too complex and very wide for me. I am having a look ahead to your next submit, I will try to get the hold of it! 60. Good day! This is my first visit to your blog! We are a group of volunteers and starting a new project in a community in the same niche. Your blog provided us beneficial information to work on. You have done a marvellous job! 61. Simply want to say your article is as surprising. The clarity in your submit is simply excellent and that i can suppose you are an expert in this subject. Well along with your permission let me to grab your feed to stay updated with drawing close post. Thanks a million and please continue the enjoyable work. 62. We are a group of volunteers and starting a brand new scheme in our community. Your website provided us with useful info to work on. You’ve done an impressive task and our whole neighborhood will likely be thankful to you. 63. Nice post. I learn something new and challenging on websites I stumbleupon everyday. It will always be exciting to read through content from other authors and practice something from their websites. 64. I’m really enjoying the theme/design of your website. Do you ever run into any web browser compatibility problems? A number of my blog visitors have complained about my blog not working correctly in Explorer but looks great in Opera. Do you have any advice to help fix this problem? 65. I do not even know how I ended up here, but I thought this post was good. I do not know who you are but certainly you are going to a famous blogger if you aren’t already 😉 Cheers! 66. Oh my goodness! Impressive article dude! Thanks, However I am having issues with your RSS. I don’t know why I cannot join it. Is there anybody else having the same RSS problems? Anyone who knows the solution can you kindly respond? Thanks!! Leave a Reply Your email address will not be published. Top	# April 2019 ## Ranch Building Plans - House plans for ranch-style homes - Open-concept ranch floor plans - Split-floor and split-level ranch house plans - Ranch-style home floor plans (with basement garage) - 3- and 4-bedroom ranch floor plans - Ranch home plans with walkout basement - Unique ranch open-floor plans - Ranch style design ideas (front porch, faux dormers) - Luxury square-foot ranch house plans - L-shaped and T-shaped ranch house plans ## Floor Plans Mansions - Amazing open-floor mansion plans - Luxury estate home plans (5-bedroom open concept) - Elegant manor and marble-age mansion floor plans - Small and one-story mega mansion plans - Mansion plans with pool, marina, castle and stone details ## Raised Beach House Plans - Raised beach house plans ## Old Style Home Plans - Classic country and vintage farmhouse plans - Cottage-style home plans (front porch) - Plantation and tropical-inspired farmhouse plans ## Basic Ranch Floor Plans - Simple rectangular ranch (3- to 4-bedroom) - Craftsman-style ranch home plans - Open-concept rambler and walkout ranch plans - Square-foot ranch plans ## Patio Home Floor Plans - One-story patio home plans - Ground-floor patio home layouts - Small-scale and luxury patio home designs - Craftsman bungalow patio home plans - 3-bedroom patio home floor plans ## Tiny Home House Plans - Modern rustic tiny house in the woods - Tumbleweed and mobile tiny house building plans - Free micro-house and on-wheels plans - Step-by-step DIY tiny house guides ## Outdoor Room Plans - Patio and gazebo design ideas - Outdoor living space plans - Screened-in porch and deck Gazebo layouts - Outdoor room divider concepts ## 900 Sq Ft House - 900 sq ft house plans (2 bed, 1 bath) - Sierra-style small home kits - Low-budget compact house designs - Cabin plans facing the continental divide ## Hummingbird House Plans - Hummingbird-inspired small house plans - Low-cost and vibrant designs - Modern 2 bed, 2 bath hummingbird house - DIY bird-feeder and small birdhouse woodworking plans --- # News Check out market updates ## Hot prices in California Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. At vero eos et accusamus et iusto odio dignissimos ducimus qui blanditiis praesentium voluptatum deleniti atque corrupti quos dolores et quas molestias excepturi sint occaecati cupiditate non provident, similique sunt in culpa qui officia deserunt mollitia animi, id est laborum et dolorum fuga. Et harum quidem rerum facilis est et expedita distinctio. Nam libero tempore, cum soluta nobis est eligendi optio cumque nihil impedit quo minus id quod maxime placeat facere possimus, omnis voluptas assumenda est, omnis dolor repellendus. Sed ut perspiciatis unde omnis iste natus error sit voluptatem accusantium doloremque laudantium, totam rem aperiam, eaque ipsa quae ab illo inventore veritatis et quasi architecto beatae vitae dicta sunt explicabo. Nemo enim ipsam voluptatem quia voluptas sit aspernatur aut odit aut fugit, sed quia consequuntur magni dolores eos qui ratione voluptatem sequi nesciunt.	7,299	703	-7,309,268,133,882,625,000	concat	[ "concat_full" ]	0.75	false	null
2,232,529,799,083,321,600	Answers Solutions by everydaycalculation.com Everydaycalculation.com » Answers » Add fractions Add 18/20 and 6/8 18/20 + 6/8 is 33/20. Steps for adding fractions 1. Find the least common denominator or LCM of the two denominators: LCM of 20 and 8 is 40 2. For the 1st fraction, since 20 × 2 = 40, 18/20 = 18 × 2/20 × 2 = 36/40 3. Likewise, for the 2nd fraction, since 8 × 5 = 40, 6/8 = 6 × 5/8 × 5 = 30/40 4. Add the two fractions: 36/40 + 30/40 = 36 + 30/40 = 66/40 5. After reducing the fraction, the answer is 33/20 6. In mixed form: 113/20 MathStep (Works offline) Download our mobile app and learn to work with fractions in your own time: Android and iPhone/ iPad Related: © everydaycalculation.com St Bartholomew 311 West Ridge Ave. Sharpsville, Pennsylvania 16150 Phone: (724) 962-7130 Email: [email protected] Website: http://www.saintbartholomews.com/ Mass Times Saturday - 4:00PM Sunday - 9:30AM Monday, Tuesday, Wednesday, Friday - 7:30AM Looking for today's Mass readings. Update Church Info » Daily Reflection Video Liturgical Calendar 18th Friday Saint Luke the Evangelist 19th Saturday The Memorial of the Blessed Virgin Mary on Saturday Saint Paul of the Cross, priest Saints Jean de Brébeuf, Isaac Jogues, priests and martyrs; and their companions, martyrs Saturday, 28th week in Ordinary Time 20th Sunday 29th Sunday in Ordinary Time 21st Monday Monday, 29th week in Ordinary Time 22nd Tuesday Saint John Paul II, pope Tuesday, 29th week in Ordinary Time 23rd Wednesday Saint John of Capistrano, priest Wednesday, 29th week in Ordinary Time 24th Thursday Saint Anthony Mary Claret, bishop Thursday, 29th week in Ordinary Time 25th Friday Friday, 29th week in Ordinary Time Search Mass Times and Catholic Churches fear not, for I am with you, be not dismayed, for I am your God; I will strengthen you, I will help you, I will uphold you with my victorious right hand. Isaiah 41:10 Nearby Churches 2230 Highland Rd. Hermitage, Pennsylvania 16148-2821 Notre Dame 1.7 mi. 2325 Highland Rd Hermitage, Pennsylvania 16148 St Joseph 2.0 mi. 79 Case Ave. Sharon, Pennsylvania 16146-3499 804 Idaho St. Sharon, Pennsylvania 16146 601 Roemer Blvd. Farrell, Pennsylvania 16121 7800 Locust Street Masury, Ohio 44438 3613 Sharon Road West Middlesex, Pennsylvania 16159 225 N. Main Street Hubbard, Ohio 44425 4453 Warren Sharon Road Vienna, Ohio 44473 Catholic Churches by State AL AK AZ AR CA CO CT DE DC FL GA HI ID IL IN IA KS KY LA ME MD MA MI MN MS MO MT NE NV NH NJ NM NY NC ND OH OK OR PA RI SC SD TN TX UT VT VA WA WV WI WY	## Solutions by everydaycalculation.com ### Add 18/20 and 6/8 18/20 + 6/8 = 33/20 Steps for adding fractions 1. Find the least common denominator (LCM of 20 and 8 is 40) 2. Convert each fraction to denominator 40 - 18/20 = (18×2)/(20×2) = 36/40 - 6/8 = (6×5)/(8×5) = 30/40 3. Add the fractions: 36/40 + 30/40 = 66/40 4. Reduce the result: 66/40 = 33/20 5. In mixed form: 113/20 --- # St Bartholomew 311 West Ridge Ave. Sharpsville, Pennsylvania 16150 Phone: (724) 962-7130 Email: [email protected] Website: http://www.saintbartholomews.com/ --- ## Mass Times - Saturday: 4:00 PM - Sunday: 9:30 AM - Monday, Tuesday, Wednesday, Friday: 7:30 AM --- ## Liturgical Calendar 18th Friday - Saint Luke the Evangelist 19th Saturday - The Memorial of the Blessed Virgin Mary on Saturday - Saint Paul of the Cross, priest - Saints Jean de Brébeuf, Isaac Jogues, priests and martyrs; and their companions, martyrs - Saturday, 28th week in Ordinary Time 20th Sunday - 29th Sunday in Ordinary Time 21st Monday - Monday, 29th week in Ordinary Time 22nd Tuesday - Saint John Paul II, pope - Tuesday, 29th week in Ordinary Time 23rd Wednesday - Saint John of Capistrano, priest - Wednesday, 29th week in Ordinary Time 24th Thursday - Saint Anthony Mary Claret, bishop - Thursday, 29th week in Ordinary Time 25th Friday - Friday, 29th week in Ordinary Time	809	469	2,232,529,799,083,321,600	concat	[ "concat_full" ]	0.75	true	null
-3,820,884,701,147,386,400	Skip to content Real Estate Lounge Around in "Had to Hear" Video Will be released as 7" single with a cover of the Nerves' "Paper Doll" Real Estate have shared the video for "Had to Hear", from this year's Atlas LP. Directed by Richard Law when Real Estate was on tour in Mexico City, it's a laconic affair that shows the band hanging out, enjoying the sights, taking in the weather, and generally being as relaxed as the song sounds. You can watch it below. The video precedes a forthcoming limited edition 7" single for "Had to Hear", which will be backed by a B-side cover of the Nerves' "Paper Doll". That's out August 25 via Domino. Real Estate: 08-01 San Francisco, CA - Amoeba Music 08-01 San Francisco, CA - The Fillmore 08-02 Sonoma, CA - Gundlach-Bundschu Winery 08-03 Santa Cruz, CA - Catalyst Atrium 08-04 Sacramento, CA - Harlowes 08-05 Big Sur, CA - Woodsist Festival 08-09 Gothenburg, Sweden - Way Out West 08-10 Helsinki, Finland - Flow Festival 08-12 Lecce, italy - Contronatura Festival 08-14 St. Malo, France - La Route du Rock Festival 08-16 Biddinghuizen, Netherlands - Lowlands 08-17 Glanusk, Wales - Green Man Festival 08-23 Los Angeles, CA - FYF Festival 09-01 Seattle, WA - Bumpershoot Festival 09-06 Richmond, VA - Fall Line Festival 09-18 Asheville, NC - Orange Peel 09-19 Carrboro, NC - Cat's Cradle 09-20 Athens, GA - 40 Watt 09-21 Birmingham, AL - Bottletree 09-22 New Orleans, LA - One Eyed Jacks 09-24 Louisville, KY - Zanzabar 09-25 Champagne, IL - Pygmalion Festival 09-26 Cincnnati, OH - Midpoint Music Festival 09-27 Frederick, MD - Flying Dog Brewery 09-30 Ithaca, NY - The Haunt 10-01 Pittsburgh, PA - Altar Bar 10-02 New York, NY - Terminal 5 10-05 Austin, TX - Austin City Limits Festival 10-11 Mexico City, Mexico - Corona Capital Festival 10-12 Austin, TX - Austin City Limits Festival 10-20 Cambridge, England - Junction 2 10-21 Liverpool, England - Kazimier 10-22 Dublin, Ireland - 02 Academy 10-24 Birmingham, England - The Institute 10-25 Leeds, England - Brudenell Social Club 10-26 Newcastle, England - Riverside 10-28 Brighton, England - Komedia 10-29 London, England - Shepherds Bush Empire 11-22 Santiago, Chile - Primavera Fauna Festival 11-24 Buenos Aires, Argentina - Music Wins Festival Watch them perform "Green Aisles" at Pitchfork Music Festival: Taarak Mehta Ka Ooltah Chashmah 18th April 2019 Full Episode 2712 Watch video Taarak Mehta Ka Ooltah Chashmah 18th April 2019 Full Episode 2712 Online By Sony Tv, Latest Hd Episode Taarak Mehta Ka Ooltah Chashmah 18th April 2019 Sony Tv, You can Watch Taarak Mehta Ka Ooltah Chashmah all complete HD episodes on Yehrishtey.net, Watch Taarak Mehta Ka Ooltah Chashmah 18 April 2019 Online Full Episodes High Quality. Telecast Date: 18th April 2019 Drama Name: Taarak Mehta Ka Ooltah Chashmah Video Source: Dailymotion & TunePk Video Ownership Rights: Sony Tv About Sony Tv Leave a Reply Your email address will not be published. Required fields are marked * Open	# Real Estate Lounge Around in "Had to Hear" Video Will be released as 7" single with a cover of the Nerves' "Paper Doll" Real Estate have shared the video for "Had to Hear", from this year's Atlas LP. Directed by Richard Law when Real Estate was on tour in Mexico City, it's a laconic affair that shows the band hanging out, enjoying the sights, taking in the weather, and generally being as relaxed as the song sounds. The video precedes a forthcoming limited edition 7" single for "Had to Hear", which will be backed by a B-side cover of the Nerves' "Paper Doll". That's out August 25 via Domino. ## Real Estate Tour Dates - 08-01 San Francisco, CA – Amoeba Music - 08-01 San Francisco, CA – The Fillmore - 08-02 Sonoma, CA – Gundlach-Bundschu Winery - 08-03 Santa Cruz, CA – Catalyst Atrium - 08-04 Sacramento, CA – Harlowes - 08-05 Big Sur, CA – Woodsist Festival - 08-09 Gothenburg, Sweden – Way Out West - 08-10 Helsinki, Finland – Flow Festival - 08-12 Lecce, italy – Contronatura Festival - 08-14 St. Malo, France – La Route du Rock Festival - 08-16 Biddinghuizen, Netherlands – Lowlands - 08-17 Glanusk, Wales – Green Man Festival - 08-23 Los Angeles, CA – FYF Festival - 09-01 Seattle, WA – Bumpershoot Festival - 09-06 Richmond, VA – Fall Line Festival - 09-18 Asheville, NC – Orange Peel - 09-19 Carrboro, NC – Cat's Cradle - 09-20 Athens, GA – 40 Watt - 09-21 Birmingham, AL – Bottletree - 09-22 New Orleans, LA – One Eyed Jacks - 09-24 Louisville, KY – Zanzabar - 09-25 Champagne, IL – Pygmalion Festival - 09-26 Cincnnati, OH – Midpoint Music Festival - 09-27 Frederick, MD – Flying Dog Brewery - 09-30 Ithaca, NY – The Haunt - 10-01 Pittsburgh, PA – Altar Bar - 10-02 New York, NY – Terminal 5 - 10-05 Austin, TX – Austin City Limits Festival - 10-11 Mexico City, Mexico – Corona Capital Festival - 10-12 Austin, TX – Austin City Limits Festival - 10-20 Cambridge, England – Junction 2 - 10-21 Liverpool, England – Kazimier - 10-22 Dublin, Ireland – 02 Academy - 10-24 Birmingham, England – The Institute - 10-25 Leeds, England – Brudenell Social Club - 10-26 Newcastle, England – Riverside - 10-28 Brighton, England – Komedia - 10-29 London, England – Shepherds Bush Empire - 11-22 Santiago, Chile – Primavera Fauna Festival - 11-24 Buenos Aires, Argentina – Music Wins Festival --- # Taarak Mehta Ka Ooltah Chashmah ## 18th April 2019 — Full Episode 2712 Watch video Taarak Mehta Ka Ooltah Chashmah 18th April 2019 full episode online by Sony Tv. Latest HD episode—watch all complete HD episodes on Yehrishtey.net. ### Details - Telecast Date: 18th April 2019 - Drama Name: Taarak Mehta Ka Ooltah Chashmah - Video Source: Dailymotion & TunePk - Video Ownership Rights: Sony Tv ### About Sony Tv Sony Entertainment Television (Sony Tv) is an Indian Hindi-language general entertainment pay television channel. It broadcasts a variety of programs, including reality shows, dramas, crime shows, and sitcoms.	845	878	-3,820,884,701,147,386,400	concat	[ "concat_full" ]	0.75	true	null
-4,208,685,346,831,679,000	WASHINGTON — Visitors to Rehoboth Beach, Del., soon may be greeted by more than sand dunes, seagulls and beach umbrellas. If offshore wind advocates have their way, scores of 140-foot blades will be spinning in the ocean breeze nearly a dozen miles away, barely visible to the sunbathers. WASHINGTON — Visitors to Rehoboth Beach, Del., soon may be greeted by more than sand dunes, seagulls and beach umbrellas. If offshore wind advocates have their way, scores of 140-foot blades will be spinning in the ocean breeze nearly a dozen miles away, barely visible to the sunbathers. Offshore wind has taken a back seat to offshore drilling for oil and natural gas in the current energy debate. But those wind-driven turbines probably will be operating long before oil platforms appear off Atlantic Coast states. Delaware hopes to be the first state to construct a wind farm off its coast. The project, scheduled to be completed in 2012, is one of several offshore wind proposals that have cleared significant hurdles in recent months. Proponents say wind offers more long-term energy independence than offshore oil. Residents along the Eastern Seaboard are embracing it as a stable-priced, environmentally friendly energy alternative. "When people see the price of gas hit $4, they are very open to having discussions about alternatives," said Stephen Smith, executive director of the Southern Alliance for Clean Energy, a nonprofit group. Wind energy today accounts for only 1 percent of the nation's electricity. A May report from the Energy Department concluded wind energy could generate 20 percent by 2030, with offshore sources accounting for nearly 20 percent of that. Projects mostly would be located along the Atlantic coast because the seabed floor elsewhere drops off too quickly to anchor turbines. In Delaware, offshore wind has caught everyone's imagination, said Patricia Gearity, a member of Citizens for Clean Power, a grassroots organization based in the state. "People liked that it was homegrown wind, that we weren't going to import it from somewhere else," said Jeremy Firestone, a professor of marine policy at the University of Delaware. Offshore wind supporters say recent proposals have not faced the same kind of opposition that previously dogged projects off Massachusetts' Cape Cod and New York's Long Island. But even on Cape Cod, attitudes are changing. Where critics once held a floating anti-wind farm demonstration, polls show that public opinion has swung in favor of an offshore project. The Long Island project was scrapped last year. But fishermen in neighboring New Jersey who once opposed offshore wind power have banded together to submit one of five bids for a 350-megawatt wind farm that would produce enough electricity for up to 100,000 households. Rhode Island may select a developer this fall for a wind energy project. Delaware residents took to the blogosphere, called their legislators and turned out in droves at public hearings to push for the proposed project off Rehoboth Beach. It stalled last year, but months of negotiations and strong grassroots organizing resulted in its approval by the Delaware Legislature in June. "During that period of time, you saw headline after headline roll out about the increase in prices, not only in oil, not only in gas, but the big spike in natural gas and propane costs," said Gearity, a 58-year-old retired lawyer. The project, proposed by Bluewater Wind, would include between 60 and 200 wind turbines spaced about a half mile apart. Delmarva Power has agreed to buy electricity from the project for 25 years. Bluewater is owned by the global investment firm Babcock & Brown, which operates wind farms in several states. For each turbine, a pole would be hammered about 90 feet below the seabed floor. Another pole would rise above the water with three 140-foot spinning blades at the top. At the highest point, the turbines would reach up about 400 feet; by comparison, the Washington Monument is about 555 feet. Unlike its mid-Atlantic neighbor, the Cape Cod project has faced vocal and well-funded opponents who complained it would mar the ocean vista. Rising energy prices have made that argument less persuasive, said Barbara Hill, executive director of Clean Power Now, an independent Hyannis, Mass.-based organization that favors the project. The 130-turbine project has now cleared most of the regulatory hurdles and proponents are hopeful it will be in operation within four years. Cape Wind Associates, a subsidiary of the New England power company Energy Management Inc., has spent more than $30 million on the Massachusetts project, investing profits from its natural gas-fired power plants, said Cape Wind spokesman Mark Rodgers. In New Jersey, Daniel Cohen, the president of the offshore wind developer Fishermen's Energy, said the organization reassessed its opposition, deciding to view offshore wind as an opportunity, not a threat. "The public has a heightened interest to finding solutions in what it sees as a growing problem in our dependence on fossil fuels," said Cohen, who owns Atlantic Capes Fisheries in Cape May, N.J. Fishing company owners have put up the money for the project's development stage. Significant obstacles to offshore wind still remain. Policymakers and utility companies need to commit to long-term contracts, said Firestone, the University of Delaware professor. He pointed out that New Jersey and Rhode Island still do not have buyers for the power from the proposed projects. There also needs to be more stability in the federal government's support for wind power, said Laurie Jodziewicz, manager of siting policy at the American Wind Energy Association. When Congress allowed a renewable energy tax credit to expire in the past — in 2000, 2002 and 2004 — wind capacity installation dropped 93 percent, 73 percent and 77 percent respectively from the previous year. A current tax credit is set to expire Dec. 31. Proponents point out that most of the technology hurdles have been cleared, though costs remain high. They look at the nearly 1,100 megawatts of offshore wind farms in European waters and say the Cape Cod and other projects could jump-start offshore wind energy in the United States. "This will be a game-changer once this project is built," said Hill, the Cape Wind advocate. "We are going to be dancing on Craigsville Beach someday, looking out and seeing the turbines spinning." On the Net: American Wind Energy Association: http://www.awea.org/ Bluewater Wind: http://www.bluewaterwind.com/ Cape Wind: http://www.capewind.org/ Fishermen's Energy: http://www.fishermensenergy.com/ Energy Department: http://www1.eere.energy.gov/windandhydro/ Skip Navigation LinksHome > Jumpsuits > Luxury Jumpsuits Shop By Brands Queensy Dress (24) Coupon Enter the coupon code for your discount Apply Coupon Luxury Jumpsuits Sort By Wedding Party Jumpsuits 2,890.00 THB 2019 Fashion Sexy Jumpsuit Celebrity Evening Party Diamond 2,890.00 THB 2019 New Luxury Jumpsuits 2,790.00 THB Blue V Neck Long Sleeve 2 Piece High Quality Suit 2,890.00 THB Woman Jumpsuits Sexy Gold 3,500.00 THB 2,600.00 THB Sale 26% Evening Party Bandage Jumpsuit Women 2,790.00 THB Evening Party Jumpsuits 2,890.00 THB Evening Party Jumpsuits 2,890.00 THB High Quality Black Khaki Green Sleeveless 2,990.00 THB 2,400.00 THB Sale 20% Hollow Out Full Length Party Bodysuit Wholesale 2,890.00 THB 2,690.00 THB Sale 7% Jumpsuit Black Rayon Party Club 2,690.00 THB jumpsuit white sexy deep V-neck 2,690.00 THB You've viewed 12 of 24 products ร้านค้าออนไลน์ © 2006-2019 Vevo Systems Co., Ltd.	# Offshore Wind Proposals Along the Atlantic Coast Visitors to Rehoboth Beach, Del., soon may be greeted by more than sand dunes, seagulls and beach umbrellas. If offshore wind advocates have their way, scores of 140-foot blades will be spinning in the ocean breeze nearly a dozen miles away, barely visible to the sunbathers. Offshore wind has taken a back seat to offshore drilling for oil and natural gas in the current energy debate. But those wind-driven turbines probably will be operating long before oil platforms appear off Atlantic Coast states. ## Delaware Wind Farm Project Delaware hopes to be the first state to construct a wind farm off its coast. The project, scheduled to be completed in 2012, is one of several offshore wind proposals that have cleared significant hurdles in recent months. Proponents say wind offers more long-term energy independence than offshore oil. Residents along the Eastern Seaboard are embracing it as a stable-priced, environmentally friendly energy alternative. > “When people see the price of gas hit $4, they are very open to having discussions about alternatives.” > — Stephen Smith, executive director of the Southern Alliance for Clean Energy Wind energy today accounts for only 1 percent of the nation’s electricity. A May report from the Energy Department concluded wind energy could generate 20 percent by 2030, with offshore sources accounting for nearly 20 percent of that. Projects mostly would be located along the Atlantic coast because the seabed floor elsewhere drops off too quickly to anchor turbines. In Delaware, offshore wind has caught everyone’s imagination, said Patricia Gearity, a member of Citizens for Clean Power, a grassroots organization based in the state. > “People liked that it was homegrown wind, that we weren't going to import it from somewhere else.” > — Jeremy Firestone, professor of marine policy at the University of Delaware ## Other Atlantic Coast Proposals - Cape Cod, Massachusetts A 130-turbine project by Cape Wind Associates has cleared most regulatory hurdles and could be in operation within four years. - Long Island, New York The Long Island project was scrapped last year. - New Jersey Fishermen in New Jersey, once opposed, have united as Fishermen’s Energy to bid on a 350-MW wind farm. - Rhode Island May select a developer this fall for a wind energy project. ## Community Engagement in Delaware Delaware residents took to the blogosphere, called their legislators and turned out in droves at public hearings to push for the proposed project off Rehoboth Beach. It stalled last year, but months of negotiations and strong grassroots organizing resulted in its approval by the Delaware Legislature in June. > “During that period of time, you saw headline after headline roll out about the increase in prices, not only in oil, not only in gas, but the big spike in natural gas and propane costs.” > — Patricia Gearity, retired lawyer ## Technical and Financial Details The Bluewater Wind project would include 60 to 200 wind turbines spaced about half a mile apart. Delmarva Power has agreed to buy electricity from the project for 25 years. Bluewater is owned by Babcock & Brown. - Each turbine: a pole hammered 90 feet below the seabed, with blades that reach up to 400 feet above water. - Comparable height: Washington Monument is about 555 feet. ## Challenges and Policy Considerations - Long-term contracts: Policymakers and utility companies need stable purchase agreements. - Federal support: The renewable energy tax credit, set to expire Dec. 31, has lapsed several times, leading to installation drops of 93 percent, 73 percent and 77 percent in past years. > “The public has a heightened interest to finding solutions in what it sees as a growing problem in our dependence on fossil fuels.” > — Daniel Cohen, Fishermen’s Energy Proponents note that most technical hurdles have been cleared. With nearly 1,100 MW of offshore wind farms in European waters, U.S. projects like Cape Cod could jump-start domestic offshore wind energy. > “This will be a game-changer once this project is built. We are going to be dancing on Craigsville Beach someday, looking out and seeing the turbines spinning.” > — Barbara Hill, executive director of Clean Power Now ## References - American Wind Energy Association: http://www.awea.org/ - Bluewater Wind: http://www.bluewaterwind.com/ - Cape Wind: http://www.capewind.org/ - Fishermen’s Energy: http://www.fishermensenergy.com/ - Energy Department: http://www1.eere.energy.gov/windandhydro/ --- # Luxury Jumpsuits - Wedding Party Jumpsuits – 2,890.00 THB - 2019 Fashion Sexy Jumpsuit Celebrity Evening Party Diamond – 2,890.00 THB - 2019 New Luxury Jumpsuits – 2,790.00 THB - Blue V Neck Long Sleeve 2 Piece High Quality Suit – 2,890.00 THB - Woman Jumpsuits Sexy Gold – ~~3,500.00 THB~~ 2,600.00 THB (26% off) - Evening Party Bandage Jumpsuit Women – 2,790.00 THB - Evening Party Jumpsuits – 2,890.00 THB - Evening Party Jumpsuits – 2,890.00 THB - High Quality Black Khaki Green Sleeveless – ~~2,990.00 THB~~ 2,400.00 THB (20% off) - Hollow Out Full Length Party Bodysuit Wholesale – ~~2,890.00 THB~~ 2,690.00 THB (7% off) - Jumpsuit Black Rayon Party Club – 2,690.00 THB - Jumpsuit White Sexy Deep V-neck – 2,690.00 THB	1,664	1,271	-4,208,685,346,831,679,000	concat	[ "concat_full" ]	0.75	true	null
6,976,523,120,034,953,000	Retail Sales Assistant - North London (Fixed Term / Temp - 16 Hours) Retail Sales Assistant - North London (Fixed Term / Temp - 16 Hours) Apply now Vacancy Type Retail Sales Assistants and Drivers Salary £10.55 an hour Published Location London North Job Description Are you a friendly, vibrant, and hard working individual? Do you have a passion for retail and delivering fantastic customer service? Would you enjoy being part of a small, close-knit team who work together and have fun? If you answered yes to these questions, Majestic Wine would love to hear from you! Majestic Wine are seeking to recruit a committed and enthusiastic Fixed Term / Temporary Retail Sales Assistant's to join one of our North London Store's (Finchley, Barnet, Muswell Hill, Islington. Our people are our greatest asset, they deliver exceptional service and that’s why our customers keep coming back. We are passionate about helping people find the wine they’ll love. Whether our customers are wine lovers or wine novices, our retail teams are there to help! We offer the very best opportunities and training for our Sales Assistants. At Majestic, we offer you the chance to immerse yourself into the wonderful world of wine and to delight our customers with our fantastic products, no matter what their mission is when they come into one of our stores. Who are Majestic? Majestic Wine is the UK’s leading specialist wine retailer. Majestic was founded in 1980 and, alongside its Commercial and French divisions, had a turnover of over £300m last financial year. Alongside strong growth in multi-channel sales, Majestic believe there is still a key role a retailer that is loved by customers and loved by suppliers. We pride ourselves on our enthusiastic, knowledgeable and friendly people, who, working as part of a close-knit team deliver exceptional customer service in a vibrant and fast-paced retail environment. More information can be found at www.majesticcareers.co.uk In August 2019 Majestic announced it will be continuing its story under new private ownership and was purchased by US investment firm - Fortress. The sale included the Majestic brand, stores, website, Commercial and French division. Fortress are now backing the vision for the future of Majestic and they see a lot of headroom for growth. The investment group pointed to Majestic’s ‘strong cross channel journey, expert staff and widespread brand affection’ when deciding to buy the business from its PLC status. What are we looking for in a Retail Sales Assistant? In this role, you’ll be an ambassador for the store in which you work, supporting the team to deliver an outstanding shopping experience for every one of our customers. Therefore, we are looking for people who: Attributes of a Retail Sales Assistant: Have a friendly, vibrant and engaging personal style Have the confidence to talk to our customers about the wine we sell Know how to have fun and be happy to taste wine you have never come across before Have a passion about engaging with customers and delivering a 5* customer experience Will play your part in making sure the store looks fantastic and is a neat, safe and attractive place for our customers to shop in Can prioritise and be efficient with their time so you can spend more time with our customers finding wines they’ll love Will be happy to pick wine orders and jump in the van to deliver them if needed Wants to constantly improve your wine knowledge so you can share this with our customers (don’t worry, we will teach you everything you need to know) Have a positive can do attitude and are willing to muck in and be a real team player Skills / Experience of a Retail Sales Assistant: Be over the age of 20 and have held a full UK driving license for at least 12 months 1 year or more prior experience in retail sales (Desirable, not essential) Strong communication skills Sound computer skills to be able to use our retail EPOS system Ability to regularly lift cases of wine weighing up to 18kg when merchandising in store or carrying customer purchases to their cars Why work for Majestic? We pride ourselves on facilitating a work environment where you enjoy what you do but also importantly, being able to develop and grow your career. Free WSET Qualifications - All our staff receive free product training. So you don't have to have product knowledge, but definitely a hunger to learn all about wine! First Rate Training / Development - “Wine Lover to Business Partner” gives you an opportunity to receive training that will take you from a Sales Assistant to Management A Dynamic Culture - You’ll have the chance to work in an exciting, busy environment with a culture that genuinely rewards hard work Corking Colleagues - Work within a team who are passionate about wine, providing excellent customer service and most importantly fun to be around! The nice added extras... At least the Living Wage hourly pay rate as Majestic Wine is an accredited Living Wage Employer A 20% staff discount on everything in store, which you can share with two of your family or friends. Access to our bonus schemes for hitting your team’s targets Fantastic incentives that take you around the world to explore our different vineyards Free lunch Fridays (if you hit your weekly targets!) WSET Training qualification 29 days holiday, including public and bank holidays - this will be pro rata’d if you work part time A contributory company Pension Plan Life Assurance (Worth 3 times your annual salary). Job Specifics Requirements: Flexible working Monday - Sunday Hours: 16 Hours If you are passionate about engaging with customers and want to work in a successful retail business who genuinely care about their people… please apply today! Closing Date 06/11/2019 Doctor Who Doctor Who Audiobooks in June 2017 Seventh Doctor and Torchwood for Audiobooks in June By Cameron K McEwan on Wednesday 31 May 2017 This month’s Doctor Who audiobooks from the BBC showcase a Seventh Doctor classic and a boxset of exciting adventures for the Torchwood team. Sign up here to the Doctor Who newsletter for EXCLUSIVE offers Both releases are available now, check out the details and artwork below. Delta and the Bannermen By Malcolm Kohll The Doctor and Mel win a place on a Fabulous Fifties intergalactic coach tour to Disneyland, Florida, Earth. When they’re knocked off course by a wayward satellite, however, the coach party arrives instead at Shangri-La, a remote Welsh holiday camp. The peace and quiet of the countryside are soon shattered by the arrival of an army of Bannermen soldiers, led by the ruthless Gavrok. They are tracking down Delta, the Chimeron Queen, with only one thought in mind: her destruction. The Doctor and Mel unite with aliens and locals alike in a frantic bid to save Delta, her Chimeron child, and the entire Chimeron race from extinction. Can they possibly succeed? Bonnie Langford, who played companion Mel in the television series, reads the 1989 novelisation first published by Target Books. Duration: 4 hours (approx). Purchase here. Delta and the Bannermen Torchwood: The Collected Radio Dramas By Phil Ford, Joseph Lidster, James Goss, and more John Barrowman, Eve Myles and Gareth David-Lloyd star in seven full-cast dramas first broadcast on BBC Radio 4. With a guest cast including Freema Agyeman (former Doctor Who companion Martha Jones), Tom Price, and Martin Jarvis, this collection also includes a bonus behind-the-scenes feature, Torchwood: All Access. Lost Souls by Joseph Lidster: voices from the past are calling out from the Large Hadron Collider at CERN, and scientists are disappearing. Can Torchwood help? Asylum by Anita Sullivan: PC Andy Davidson turns to Torchwood after he arrests a very unusual shoplifter. Who is Freda, and where she is from? Golden Age by James Goss: Jack discovers that a dangerous energy field centres on an old colonial mansion: Torchwood India. The Dead Line by Phil Ford: a Cardiff hospital is inundated with patients who have fallen into coma-like trances, all of them triggered by phone calls… The Devil and Miss Carew by Rupert Laight: Gwen and Rhys are involved in a nursing home mystery. What is Miss Carew’s connection with a series of national power cuts?? Submission by Ryan Scott: the Torchwood team find themselves at the mercy of a hungry alien at the bottom of the sea... The House of the Dead by James Goss: a special séance is held at the most haunted pub in Wales - but when the ghosts start arriving, all hell breaks loose... Duration: 5 hours 25 mins (approx). Purchase here. Torchwood: The Collected Radio Dramas	# Retail Sales Assistant – North London (Fixed Term / Temp – 16 Hours) Vacancy Type: Retail Sales Assistants and Drivers Salary: £10.55 an hour Location: London North ## Job Description Are you a friendly, vibrant, and hard‐working individual? Do you have a passion for retail and delivering fantastic customer service? Would you enjoy being part of a small, close‐knit team who work together and have fun? Majestic Wine is seeking to recruit a committed and enthusiastic Fixed Term / Temporary Retail Sales Assistant to join one of our North London stores (Finchley, Barnet, Muswell Hill, Islington). Our people are our greatest asset—they deliver exceptional service and that’s why our customers keep coming back. We are passionate about helping people find the wine they’ll love. Whether our customers are wine lovers or wine novices, our retail teams are there to help! We offer the very best opportunities and training for our Sales Assistants. At Majestic, you’ll immerse yourself in the wonderful world of wine and delight customers with our fantastic products, no matter what their mission is when they come into one of our stores. ## Who are Majestic? Majestic Wine is the UK’s leading specialist wine retailer. Founded in 1980, alongside its Commercial and French divisions, it had a turnover of over £300 million last financial year. We pride ourselves on our enthusiastic, knowledgeable and friendly people, who—working as part of a close‐knit team—deliver exceptional customer service in a vibrant and fast‐paced retail environment. More information at www.majesticcareers.co.uk In August 2019, Majestic announced new private ownership by US investment firm Fortress, who backed our vision for growth, citing our strong cross‐channel journey, expert staff and widespread brand affection. ## What are we looking for in a Retail Sales Assistant? ### Attributes - Friendly, vibrant and engaging personal style - Confidence to talk to customers about the wine we sell - Willingness to taste and learn about new wines - Passion for engaging with customers and delivering a 5★ experience - Pride in maintaining a neat, safe and attractive store environment - Ability to prioritise and manage time efficiently - Flexibility to pick wine orders and assist with deliveries if needed - Desire to constantly improve wine knowledge (training provided) - Positive, can‐do attitude and strong team player ### Skills / Experience - Over 20 years old with a full UK driving licence held for at least 12 months - Prior retail sales experience (desirable, not essential) - Strong communication skills - Competent with computer systems / EPOS - Ability to lift cases of wine (up to 18 kg) ## Why work for Majestic? - Free WSET qualifications and product training - Structured “Wine Lover to Business Partner” development programme - Dynamic, rewarding culture that values hard work - Fun, passionate colleagues who love wine ### Additional Benefits - At least the Living Wage (accredited Living Wage Employer) - 20% staff discount (plus for two family/friends) - Access to bonus schemes for team targets - Incentives, including vineyard visits worldwide - “Free Lunch Fridays” (if weekly targets met) - 29 days’ holiday (pro rata for part‐time), including bank holidays - Contributory company pension plan - Life Assurance (3× annual salary) ## Job Specifics - Requirements: Flexible working Monday–Sunday - Hours: 16 per week Closing Date: 06/11/2019 --- # Doctor Who Audiobooks in June 2017 ## Delta and the Bannermen By Malcolm Kohll Synopsis The Doctor and Mel win a place on a Fabulous Fifties intergalactic coach tour to Disneyland, Florida, Earth. When a wayward satellite knocks them off course, the coach party arrives instead at Shangri-La, a remote Welsh holiday camp. Peace and quiet is shattered by the Bannermen soldiers, led by the ruthless Gavrok, who are hunting Delta, the Chimeron Queen. The Doctor and Mel unite with aliens and locals alike to save Delta, her Chimeron child, and the entire Chimeron race from extinction. Narrator: Bonnie Langford Duration: approx. 4 hours --- ## Torchwood: The Collected Radio Dramas By Phil Ford, Joseph Lidster, James Goss, and more John Barrowman, Eve Myles and Gareth David-Lloyd star in seven full-cast dramas first broadcast on BBC Radio 4. Featuring guest performances by Freema Agyeman, Tom Price, and Martin Jarvis, plus a bonus behind-the-scenes feature, Torchwood: All Access. 1. Lost Souls (Joseph Lidster) Voices from the past are calling out from the Large Hadron Collider at CERN, and scientists are disappearing. 2. Asylum (Anita Sullivan) PC Andy Davidson turns to Torchwood after arresting a very unusual shoplifter. Who is Freda? 3. Golden Age (James Goss) Jack discovers a dangerous energy field centres on an old colonial mansion: Torchwood India. 4. The Dead Line (Phil Ford) A Cardiff hospital is inundated with patients in coma-like trances, all triggered by phone calls… 5. The Devil and Miss Carew (Rupert Laight) Gwen and Rhys investigate a nursing home mystery linked to a series of national power cuts. 6. Submission (Ryan Scott) The team finds themselves at the mercy of a hungry alien at the bottom of the sea. 7. The House of the Dead (James Goss) A séance at Wales’s most haunted pub goes awry when the ghosts really start to arrive… Duration: approx. 5 hours 25 minutes	1,861	1,237	6,976,523,120,034,953,000	concat	[ "concat_full" ]	0.75	true	null
-562,811,769,843,157,440	iPhone Screenshots Description Save time by letting Contact Mover transfer contacts between Exchange, iCloud, Local, and other accounts. What’s New Version 2.4.0 Now featuring full support for iOS 9 and 10 and legacy support for iOS 8. Please ensure your device is running a supported version of iOS before purchasing this app. Thanks to everyone for the feedback over the years. Certain things on your device have to be correct for this app to function as expected, and we are constantly adding helpful messages and walkthroughs within the app itself when we determine that your situation requires a few extra steps. As IT professionals, we have done our best to test Contact Mover with various versions of iOS, Exchange servers, and account configurations. We want this to be a foolproof solution for moving contacts quickly, and we need your feedback if something isn’t working. Before leaving negative feedback, please email [email protected] and we will gladly help you. Ratings and Reviews 4.6 out of 5 10 Ratings 10 Ratings CGoss2017 , Best App For Moving Cintacts As a Mobile Administrator for a large company I can say with confidence that this is by far the easiest way to move contact from exchange to iCloud Stl968 , Simple to use, efficient tool Great Theremustbeaway , It works I spend hours with Apple genius and many others from microsoft to figure out how to move my contacts from my work outlook (exchange) to my new personal mac book air. I have a lot of notes in the 'note field' of my thousands of contacts that were very important. No one could sync this so that the fields would match. It would only show the first line and that wasn't acceptable. I needed to see this exactly the way I do in outlook exchange and now I finally can. This is the best app and it happens seamlessly. No duplicates, all perfect. Highly recommend it if you're in the same boat I was. Information Seller Immense Networks Size 3.3 MB Category Business Compatibility Requires iOS 8.0 or later. Compatible with iPhone, iPad, and iPod touch. Languages English Age Rating Rated 4+ Copyright © 2011, 2012, 2013, 2014, 2015, 2016 Immense Networks LLC. Price $4.99 Supports • Family Sharing With Family Sharing set up, up to six family members can use this app. You May Also Like Volunteering It is often the generosity of local people giving their own time and commitment through volunteering that means that many voluntary led organisations, groups and clubs are able to deliver projects and hold events and activities that make a real difference in our communities. The following organisations rely on volunteers to exist. Get in touch and use your spare time to support your local area. If you are looking for volunteers, either on an ongoing basis or for a specific event, and would like to promote your group here, please email the details to [email protected]. SSAFA the Armed Forces Charity Job description Looking at making a real difference in your local Cheshire community? Volunteer Caseworkers are the lifeblood of SSAFA, supporting a growing number of people in need of financial, practical and emotional support. Clients come from all backgrounds and age groups and may have served in WW2 or in a more recent conflict like Iraq or Afghanistan. Our trained volunteers listen without judgement to assess and provide tailored support to help people navigate life in and beyond military service. We need you to join your local SSAFA team to help us achieve this. Skills & Experience • Good listening and communication skills including written and spoken English • Ability to be respectful and non-judgemental with clients, their family, other agencies and SSAFA colleagues • Ability to send and receive emails – you will receive your own SSAFA email address • Ability to make enquires on behalf of clients by phone, email, letter or by filling in forms • Willingness to use our on-line case management system (this is covered in the caseworker training course) • Reliable attitude, contact clients promptly, keep appointments, update the branch regarding your availability • Ability to maintain confidentiality and keep information safely • Access to public transport or a car to travel to appointments with clients • Able to provide two referees: former employers or other people that know you well (other than relatives) • Happy to be DBS checked (this is paid for by the charity) Why volunteer with SSAFA? • Three-day training course for new caseworkers. Your trainer will guide your group of like-minded volunteers through everything you need to know to get started as a SSAFA caseworker all expenses paid • Some short on-line training modules to complete at home and access to a range of e-learning courses • Local induction and gatherings for caseworkers to meet and share ideas • Reimbursement of out-of-pocket expenses • Support people in your community with a military background • Use your skills, knowledge and life experience to benefit others • Experience, training and skills that you can highlight on your CV and in job interviews • Better physical and mental health – studies show that volunteers live longer and experience lower levels of stress and depression! Caseworkers visit clients to work out what type of help they need. Next, they find the right sources of support and arrange for clients to access it. This might be funds for special equipment for someone with a disability, adaptions to a property so an older client can remain at home or funds for a rental deposit. Caseworkers also sign-post clients onto specialist local services for advice on benefits, housing, mental health, debt, finding work etc. If your studying to be a social worker, have a background in the military or just want to volunteer some time in your local community we want to hear from you. To apply please send your contact details through to [email protected] and someone will get in touch to give you some more information. Trustee Citizens Advice Cheshire West Do you want to help the community where you live, study or work? Could you be interested in being part of the team which runs Citizens Advice Cheshire West? We're looking for people to help us develop our advice services for the people in our communities who need them and to secure the vital resources we need to go forward. We are seeking to fill a number of trustee roles, and are particularly interested in backgrounds in HR, law, marketing or fundraising but will consider a range of skills and experience. We are a member of the national Citizens Advice charity which means we have access to the services, resources and support provided by national Citizens Advice but as an independent charity, we’re responsible for running our own affairs within agreed standards. We have 34 staff, approximately 120 volunteers, and offices situated in Chester, Ellesmere Port, Northwich and Winsford. We offer a full induction and relevant training. You'll need to: • be available to attend at least six evening meetings each year • have a willingness to work as a team • actively participate in discussions that relate to the running of the organisation • act in the interests of Citizens Advice Cheshire West and that of its staff and clients. People from all backgrounds are welcome and we aspire to have a diverse trustee board that reflects our clients and communities. We particularly welcome applications from women or the BAME community. You do not need experience of working or volunteering with Citizens Advice service. We are looking for people with a wide variety of skills and a diversity of background and experiences. The post of trustee is a voluntary one but all reasonable expenses are reimbursed. The role will provide you with a great deal of experience and satisfaction, the opportunity to develop your skills and utilise your expertise and knowledge. If you're looking for a rewarding and challenging volunteer role and would like further information, please send us an expression of interest with your contact details to Nicki Berg: Citizens Advice Cheshire West is committed to equality and diversity and welcomes applications from all sections of the community. Citizens Advice Cheshire West treats your personal data collected during the recruitment process in accordance with its data protection policy. Information about how your data is used and processed is provided in our privacy notices found at www.citizensadvicecw.org.uk Appeal for Young Carers Project Volunteer Hours of volunteering: • Monday – Chester 6pm – 7:30pm and 8-9:30pm • Thursday – Ellesmere Port – 5:30-7pm and 7:30-9pm • Thursday – Vale Royal (Rudheath) – 5:30–7pm and 7-8:30pm • Plus quarterly meetings/training As a Young Carers Project volunteer you will be required; 1. To take responsibility for ensuring that activities are safe and enjoyable for the young people in the group 2. To maintain client confidentiality 3. To attend the group(s) on a regular basis 4. To work as part of a team for the benefit of the young people in the group, to support other volunteers and the group leader as appropriate – e.g. in planning trips or activities 5. To work within guidelines on child protection and hold this as the highest priority at all times Skills and Experience • Experience of interpersonal work or youth work would be useful but not essential as the role is to work under the instruction of the group co-coordinator with youth work experience. For further information/to apply please contact: Recruiting Magistrates now Magistrates are volunteer members of the judiciary who make decisions in criminal and family courts. We are all ordinary people. Anyone aged between 18-70 can sit as a magistrate and you don’t need any formal qualifications as full training is provided. Travel and subsistence is paid and if you are employed you are legally entitled to take time off for the role. Could you offer 14 or more days a year? Find out more at: Cheshire Community Development Trust - Buddying and Befriending Scheme Cheshire Community Development Trust (CCDT) is a charity all about community. We are based in Northwich and have a strong track record of delivering services across Cheshire which support and empower people to: • remain independent • reduce social isolation • attain their goals • find a place in society where they can live, work and have a sense of purpose. We are looking for people to join our exciting new Buddying and Befriending Scheme, which aims to reduce loneliness and isolation amongst the over 50s in Cheshire. As a Volunteer Buddy you could be helping someone to gain the confidence to leave the house for the first time, or take part in an activity, join a group, or enjoy trips to the cinema, with the aim of making new friends and connecting with the community around them. This is a shorter-term role for volunteers, usually for around 3-6 months. Our Volunteer Befrienders help create a supportive friendship with people who may not necessarily want to engage with groups or activities, but would like to spend time with another person, maybe just having a cup of tea and a chat or going out for a walk, etc. If you are interested and would like more information then please get in touch with the Volunteer Coordinators, Pete or Holly: Volunteering with St Luke’s Hospice is a great way to learn new skills, meet new people, make friends and have fun! St Luke’s Hospice in Winsford provides care and services for people with life-limiting illnesses and their families in the mid and south Cheshire area. Without the support we receive from our volunteers, we could not provide these services. Are you able to spare a few hours to help? We have a variety of volunteer roles to suit all sorts of interests and skills. You may want to volunteer regularly as a Befriender and help someone feel less isolated, help as a weekend receptionist greeting visitors or join our retail team in the shops and warehouse sorting donations or helping as a cashier. Or you may prefer to help on a more ad hoc basis with the many events we hold throughout the year. Whatever your choice of role or reason for volunteering, we look forward to hearing from you. Current vacancies If you would like to be part of the amazing team of volunteers at St Luke’s Hospice: Citizens Advice Cheshire West Volunteering with Citizens Advice Cheshire West offers you a great experience and the chance to make a real difference to local people by providing valuable advice and support to members of your local community. All sorts of people volunteer with us for many different reasons, but one thing that our volunteers say is that volunteering with Citizens Advice Cheshire West is enjoyable, rewarding, challenging and varied. Citizens Advice Cheshire West is at the heart of your community with offices in Winsford, Ellesmere Port, Northwich and Chester. Volunteering with us not only benefits the local community but also wider society as Citizens Advice influences and informs nationally via social policy and our recognised standing as a trusted and independent voice for our clients. Being a volunteer adviser has many benefits including; improving your employability, helping you get new skills, using and improving your existing skills and experience, enhancing and building your confidence, working with people who have the same values, beliefs and commitments. We currently have opportunities for people to train as face to face and/or telephone advisers. A volunteer adviser’s role is very varied and includes providing information and giving advice by explaining the choices our clients face and helping them understand how those choices will affect them. We provide practical help to clients by completing forms and helping to progress their issues. We work with, and refer our clients to other agencies if they are better placed to help resolve issues and reduce future problems. Volunteer advisers receive full training in the skills needed to help our clients deal with their problems by learning how to find the information the client needs from our extensive resources. Volunteers are fully supported and supervised and will get feedback and development opportunities throughout their time with Citizens Advice Cheshire West. You don’t need specific qualifications or experience to train for the role of volunteer adviser the opportunity is suitable for many people from a variety of backgrounds; The main duties and responsibilities of a volunteer adviser may include: • Interviewing clients, both face-to-face and on the telephone; working with the client to explore their enquiry and helping the client to deal with and set priorities. • Finding, interpreting and communicating the relevant information to clients by exploring options and outcomes in order that they can understand them and make better informed choices and decisions. • Acting, where necessary, on behalf of the client including, negotiating, drafting or writing letters, completing forms and making appropriate referrals. • Completing clear and accurate case records. • Recognising the problems clients face and taking appropriate action to deal with them including using social policy. • Attending team meetings and training sessions. • Citizens Advice Cheshire West provides advice to people on their rights and responsibilities. We value diversity, promote equality and challenge discrimination. We are independent, impartial, confidential and free. • We are looking for people who have: • A commitment to the aims and principles of the Citizens Advice service. • Good listening skills. • Are helpful, open and approachable. • Can communicate clearly both orally and in writing. • The skills to sift through information and extract what is relevant. • Basic mathematical skills. • Respect for views, values and cultures that are different to their own. • An understanding of why confidentiality is important. • Familiarity with using a computer keyboard and searching the internet. • A positive attitude to self-development and assessment. • An ability to work as part of a team. • The understanding to recognise their own limits and boundaries in the role. Volunteer Advisers are needed at all four of our offices: • Citizens Advice Cheshire West; Winsford: Wyvern House, The Drumber, Winsford, Cheshire CW7 1AH • Citizens Advice Cheshire West; Ellesmere Port: 1 Whitby Road, Ellesmere Port Cheshire CH65 8AA • Citizens Advice Cheshire West; Chester: The Blue Coat, Upper Northgate Street, Chester CH1 4EE • Citizens Advice Cheshire West; Northwich: Meadow Court, MeadowStreet, Northwich Cheshire CW9 5FP For more information on becoming a volunteer adviser at Citizens Advice Cheshire West call into any of our offices and speak to a member of our team or: Snow Angels Snow Angels is a local social enterprise based in Cheshire which supports older people to live independently in their own homes through a network of volunteers. We are currently recruiting for volunteers who are able to spend some time supporting local people by carrying out practical tasks. These tasks could include: • Picking up and delivering essential shopping items • Help with dog walking • Help with transport to health appointments or social clubs/groups • Collecting prescriptions You could also be part of our befriending team, going round to a customers house, once a week for a couple of hours for a chat and some company. You can register for a range of different tasks that you are prepared to help with and let us know what your availability is. All volunteers are required to have a full DBS check, are trained and provided with ID and any equipment that may be required. If you are interested and would like more information then please get in touch with the Well-Being Coordinators Emma or Holly Age UK - Money Matters Project Do you have good organisational and listening skills? Would you like to make a massive difference to someone who is having difficulties in organising their Money Matters due to money related issues which they are struggling with? Volunteer - Money Matters Mentors are urgently wanted We are looking for volunteers to visit people aged 55 years and over to provide support to them primarily to reduce their outgoings and maximise their income. Other actions could be to: • Set up a filing systems, organising paperwork • Produce a personalised budget • Help organise payment of household bills, setting up direct debits/standing orders • Manage small debts and arranging payment plans • Identifying and transferring to cheaper service providers • Provide training on basic book keeping to those not used to running a household budget (possibly due to loss of a partner/partner has dementia and they’ve never done the household accounts before) The role of a mentor has no stipulated hours as appointments are made to flexible to fit into our mentors own schedules. Any home visits undertaken are only carried out during normal office working hours (between 9 and 5 Monday to Friday). A full DBS check will be required to undertake the role of a Money Matters Mentor and training providing shadowing opportunities are provided for this role. Out of pocket expenses such as mileage and parking expenses are repaid for this role. If you would like further information about this role please get in touch with either Hazel or Linda: Age UK Cheshire Age UK Cheshire provides a range of care and support services to empower and enable older people to continue to live full and active lives, to participate in community activity, and to remain in good mental and physical health for as long as possible. Our Day Services aim to relieve isolation by promoting independence and integration into social circles. They are ideal for older people who like to get out of the house now and then to join activities and make new friends. We are looking for volunteers to help in our Day Services. Older People’s Activity Volunteer You will be friendly, kind and caring, previous caring experience is not required just an interest in spending time with older people. Patience and listening skills are essential. You will be: • Interested in helping older people • Friendly with a good sense of humour • Approachable • Supportive • Patient • A good listener • A team worker Main tasks for this role are: • Helping with activities and crafts • Playing board / card games with clients • Help serving refreshments • Giving support and friendship to clients The Day Services Activity Sessions run on a Tuesday, Wednesday and Thursday in Ellesmere Port, Chester and Northwich. Opening hours are typically 10am – 3pm. We are grateful for any help between these hours. We are also looking for an Older People’s Activity Group Leader for our Ellesmere Port Service and a Volunteer Minibus Driver working from our Hartford centre. If you would like any more information about these roles please get in touch with Chris Rees, Day Services Development Officer: British Red Cross volunteering opportunites in Winsford Retail eBay Volunteer Learn new skills, CV build or try something new, when you volunteer with our eBay department you will be providing invaluable help in the operation of our eBay centre by photographing, listing and preparing items for delivery. Warehouse - Donation Sorter This is an exciting opportunity for you to get involved by supporting our stock processing centre. There are a variety of activities available, and where we can we will try to tailor the opportunity around you Volunteer drivers needed to support Children's Services A Volunteer Driver Scheme is being run in partnership with Cheshire West and Chester Council to provide essential transport for young people and adults who need support travelling to their place of education/care service. If you are interested in supporting/would like more information about this volunteering opportunity please: Carers Trust 4all CarerLinks - Volunteer Befriender CarerLinks is a lottery funded project that identifies unpaid carers within the community who may benefit from our free service. To compliment the service we are looking for Volunteer Befrienders who can possibly spare a couple of hours on a weekly or fortnightly basis by either: • Visiting carers in their own homes • A weekly telephone call to a carer • A social visit to a café and a cup of tea • Accompanying a carer to a social activity or supporting them with a shared hobby We offer: • A first class induction, training and support along with reimbursement of local travel expenses • A reference to future prospective employers • An opportunity to make a real difference to an individual on a one to one basis • A chance for you to meet some new people and make new friendships To find out more information, contact Rachel Heyhoe: Appeal for volunteers - Stretton Water Mill Stretton Water Mill (part of Cheshire West Museum Service) is appealing for volunteers. Current vacancies include: • Helping to promote the Mill at the Tilston Wakes event on 25 and 26 August 2018 • Meeting and greeting visitors, general maintenance around the Mill , supporting the Millers, assisting or leading with children’s activities (weekends during September) • Help with woodland maintenance in October and help closing down the site and Mill for winter. Watch our three minute video and learn about what museums have to offer: To register your interest or for further information please contact Tony Rigby, Cheshire West Museums: Winsford and Middlewich Sea Cadet unit Join Winsford and Middlewich Sea Cadet unit as an Instructor. Teach young people valuable life skills and receive training to lead cadets in activities such as power boating, sailing, first aid and meteorology. If you can’t commit on a weekly basis we are also looking for volunteers with business skills to become committee members and help with fundraising and events. To find out more about becoming a volunteer, contact: Cheshire Restorative Justice and Mediation Hub Remedi are a charity who provides a restorative justice and mediation service across Cheshire. Restorative Justice is all about helping people to communicate following a crime. It provides victims with a chance to explain the impact of the offence and ask questions and it helps offenders to explain their actions and offer an apology. Involvement in Restorative Justice is voluntary and confidential. Mediation helps those experiencing conflict to communicate and find a way forward to address the individual needs of all parties. Involvement is voluntary and confidential Could you: • Work with victims of crime AND offenders in a none judgmental way • Work with families and communities in conflict in a restorative way • Commit to 100 hours volunteering, this is usually during the day or early evening, Monday – Friday What we need: • People who can listen to others • People who want to help other people • People who are motivated to make a positive change in people’s lives • People who want to use the skills they already have, and build on them • People who want to help us develop the service and raise its profile • Full driving licence and access to a vehicle essential What we can offer you: • Huge degree of satisfaction. You will be helping people • Training • All out of pocket expenses • The opportunity to work within a passionate and committed team For further information, or if you are interested: Catch 22 Catch 22 is recruiting volunteers to support young people across the Cheshire West and Chester area now. Volunteers urgently needed for the following two positions: • Volunteer Drivers to help transport young people to/from group sessions. Volunteers must be willing to travel to sessions across Cheshire West and Chester. • Volunteer Peer Mentors (aged 16-25) to support young people. For further information or to apply please contact Gemma Godfrey, Volunteer Coordinator Catch 22: Cheshire Without Abuse There are a number of roles available with Cheshire Without Abuse: Befriender Support The aim of this role is: To provide supporting role to enable Cheshire Without Abuse to function efficiently and communicate effectively with service users, volunteers, local groups and other external organisations. Role Description: The purpose of the role is to provide social, emotional and practical support to service users to improve their quality of life, promote independence and encourage individuals to access activities within the local community. Volunteers will be matched with a Service User to provide support to help them become more independent. The Volunteer Mentor/Befriender role is designed to meet the specific needs of service users and tailored to the meet the requirements of their individual support plan. Support for individuals may include all or some of the following tasks and activities: • providing emotional support; • assisting with day-to-day activities, ie shopping; • introducing Service Users to the local area; • reducing social isolation; • accompanying to appointments; • providing help with completion of forms, ie housing benefit and applications; • accessing appropriate services. Timescales (hours, days or length of volunteering role) We hope that you will be able to volunteer for: • A minimum of four hours per week, to be mutually agreed. What we are looking for (skills, qualities and experience): • A willingness to develop an understanding of the issues related to Domestic Abuse, with an empathetic approach to Service Users. • Provide a consistent and flexible approach to meeting the needs of the Service User. • A willingness to work with a variety of different people and external agencies. • Good listening, verbal and written communication skills. • Be reliable and arrive on time for meetings. • Adhere to the principles of confidentiality and sharing information “on a need to know” basis. • Adhere to clear boundaries and diversity policies. • Able to contribute to a dynamic team environment. Benefits to you as a volunteer from taking on this role: • Training • Support • New skills and experience • Making a difference to your local community • New friends and colleagues This role requires the volunteer to have a current DBS check for which Cheshire Without Abuse will cover the cost of this. Programme Support The aim of this role is: To support Cheshire Without Abuse in the delivery of the Gateway programme. To quietly observe the group and offer practical and/or emotional support if necessary. It is important that the sessions are centred around the clients and their experiences and that the focus remains on the specific content of each session. The role of the Gateway volunteer is to enhance the service by supporting the facilitator and clients as and when necessary allowing the clients the space they need to work through the programme. Role Description: To carry out the following tasks: • To support attendees to achieve the objectives of each session with practical support such as • To provide emotional support if necessary if clients become upset • To support the facilitator to prepare, manage and properly maintain the session materials. • To liaise with co-facilitators and/or lead as necessary: before, during and at the end of the programme session to ensure that quality needs are met. • To reflect on practice and support self and peer learning. • To complete all administrative activity required in accordance with guidelines. • To ensure that data protection and confidentiality is maintained at all times. • To undertake training and supervision as required. Timescales (hours, days or length of volunteering role) We hope that you will be able to volunteer for: • A minimum of two hours per week, to be mutually agreed. What we are looking for (skills, qualities and experience): • An understanding of the issues related to Domestic Abuse. • A flexible approach to working in a team environment. • A willingness to work with a variety of people. • Empathy and compassion • Attention to detail. • Good communication skills. • A clear understanding of the importance of professional boundaries and confidentiality Benefits to you as a volunteer from taking on this role: • Training • Support • New skills and experience • Making a difference to your local community • New friends and colleagues This role requires the volunteer to have a current DBS. Cheshire Without Abuse will cover the cost of this. Contact Sharon Stowell Volunteer Coordinator Cheshire without Abuse for further information: NeuroMuscular Centre - Fundraising Volunteer The NeuroMuscular Centre is a local charity based in Winsford that provides a unique combination of life enhancing opportunities and support for people and families affected by neuromuscular conditions. As the Centre of Excellence for people with neuromuscular conditions, NMC offers a range of support and services to over 1200 registered patients from all over the North West and beyond. Such beneficial services include physical treatments such as physiotherapy and hydrotherapy, as well as access to our fully accessible gym which is the only one of its kind in Europe. In addition to physical treatments, NMC provides training, employment, and support for people with muscular dystrophy and other neuromuscular conditions, as well as offering projects and community groups for service users, their carers, and families. It costs £1.2million a year to run the Centre, and the majority of this income is generated through fundraising activity. We're looking to recruit enthusiastic volunteers who are willing to help us out at our fundraising collections and events in Northwich and Winsford, either on a one-off basis or through long-term volunteering. For more information: Passion for Learning Would you like to volunteer in a local primary school, helping to make reading and learning fun for children aged between 4-11? Passion for Learning are looking for volunteers who have between one and a half and three hours a week to spare, to help children on a one-to-one basis in a Winsford Primary School. Passion for Learning are a friendly and inclusive organisation who offer all the training, resources and support that you need and want. No prior experience is needed, just the time and enthusiasm to encourage children to become successful learners at school. If you think that this might be something that you would enjoy and want to find out more then please get in touch. Snow Angels volunteers who are able to spend some time supporting local people by carrying out practical tasks. These tasks could include: • Picking up and delivering essential shopping items • Help with dog walking • Help with transport to health appointments or social clubs/groups • Collecting prescriptions You could be part of our befriending team, going round to a customers house, once a week for a couple of hours for a chat and some company. We have also started three new lunch clubs. Greenbank and Sandiway Manor lunch clubs are running every Tuesday 11-2 for the elderly in our community to tackle social isolation and loneliness. And our newest venture is called Happy Mondays, starting at the end of June Happy Mondays is a lunch club that will provide a meal and activities for adults 50+ with learning disabilities. Any help is welcomed for these, including transports or providing support throughout the day. You can register for a range of different tasks that you are prepared to help with and let us know what your availability is. All volunteers are required to have a full DBS check, are trained and provided with ID and any equipment that may be required. If anything here has caught your eye and would like more information then please get in touch with the Well-Being Coordinators Emma or Holly Scope, Northwich shop We currently have vacancies for volunteers in our shop. Volunteering can help boost skills, improve confidence and enhance a CV. We also offer National Vocational Qualifications (NVQs) and placements. Various roles are available including: • Helping customers • Working on the till • Window dressing and displays • Sorting donations and steaming No experience necessary as full training will be given. Please contact the shop for more details. Volunteering at Mere Brow Farm - Permaculture and Forest Garden Project, Weaverham We are a 13.5 acre farm in the heart of Cheshire being developed using permaculture principles. Our aim is to create an ecological system that is fun, educational, productive, diverse and sustainable with a combination of mixed woodland, orchard, hedging and edible forest. This isn’t a project we can do on our own however, so we are looking for like-minded volunteers to help us deliver our vision. We are especially keen to hear from you if you have permaculture experience/interest or general experience in volunteering on horticulture projects. However please don’t be put off if you don’t have experience – you may have a skill set that we need, whether that be woodworking, bee-keeping or just general enthusiasm and energy! We plan all our days to be fun and want it to be just as much fun for our fabulous volunteers! A taste of things you can get involved in are; Greenhouse maintenance, weeding, cutting back of shrubs, clearing ivy from forest areas, collecting leaves, pine needles, mulching, turning of manure, tool maintenance, mowing lawns, slug control, collecting wood from fallen/felled trees, pruning and tree maintenance, building compost bin/treebog/bug hotels/bee hives, pest control management, prepare/build paths, preparing ground for winter tree planting, basic protective fencing. You will need to be 18 or over. 16 -17 year olds are welcome but will need to be accompanied by an adult. No animals are allowed on site without prior agreement. We will consider groups of young people but please contact us in the first instance to discuss in person. We will supply all the equipment you will need unless otherwise communicated to you. However if you have a good pair of gardening gloves it would be helpful to bring those. • Volunteering takes place Monday - Friday from 11am - 4pm For further information: Information, Advice and Support Service We are in need of new volunteers to help us support parents and carers of children with special educational needs and to support young people with special educational needs. Our trained volunteers support parents and carers After the initial training course a volunteer may help a parent/carer or young person with: • viewing schools • completing forms • accessing the assessment procedure for Education Health and Care Plans • accessing Personal Budgets relating to Education Health and Care Plans • preparing for school meetings and annual reviews and helping them to express their concerns during the meetings. • explaining the education system, the structures and roles of professionals and any confusing terminology • signposting to any relevant literature or other organisations that may be able to help A volunteer may also help out at: • parent/ carer information days • administration work in the office. For more information please call 0300 123 7001 or email [email protected] Winsford British Heart Foundation Shop Winsford British Heart Foundation shop is now recruiting volunteers for flexible opportunities, which include Customer Service Volunteer, Volunteer Stock Collection Driver, Stock Generation Volunteer and Sort Room Volunteer. There are lots of benefits to volunteering, such as developing your existing skills, gaining new skills and supporting a cause you care about. Whatever your reason for joining, you can expect to have lots of fun and meet some great people. Coronary heart disease is the UK's single biggest killer but we are leading the fight against it. Our volunteers help our fight for every heartbeat and make a big difference in the local community. As one of our volunteers you will receive a full induction and further training in specific roles. For further information • Telephone: Kirsten (Shop Manager) on 01606 860453 Volunteer for NYAS • Do you want to make a difference to a young person's life? • Do you have 1- 4 hours per month to spare? Why not volunteer as a mentor/befriender for NYAS as an Independent Visitor for children and young people in care. As a volunteer you will: • Have fun • Offer support and a listening ear • Maybe share a hobby, sport or interest • Take young people on outings e.g. cinema • Be a positive influence in a young person's life • Help build self- esteem and confidence You don't need any special qualifications. We are looking for reliable and dependable people from all walks of life. We will: • Provide training and ongoing support • Pay expenses to a set limit NYAS is a charity promoting the rights of children, young people and vulnerable adults. For more information on this rewarding role please contact: You can also find out more in the following places: Beanstalk Beanstalk is a national literacy charity that has vacancies in the Northwich and Winsford area for Volunteers who would like to help children develop a love of books and a passion for reading. Beanstalk provide support for children from the ages of 3 – 11 years old from Nursery through to the end of Primary School. Our Reading Helpers work on a one to one basis giving consistent support to the same three selected children for between one and one and a half hours twice a week. The role of a Reading Helper is to inspire a child’s love of books by improving their reading ability, their confidence and self-esteem and also their ability to understand and discuss what they have read. No experience is required. Just a keen interest in reading and a desire to make a difference in a child’s life. Kate, a Reading Helper from Northwich – ʺI’ve been surprised by how quickly the children start to make progress. Each week you notice them gaining another new word, maintaining focus for just a little longer or being more confident when discussing the stories. It's so wonderful to seeʺ. To find out more information or to apply: Grozone Grozone Community Garden is looking for volunteers. The Garden based in Northwich runs regular sessions with permanent and volunteer staff. All tools, instructions and drinks are provided. Just bring lunch, some old clothes and possibly some wet weather gear if you want to get your hands dirty. Anyone over 14 are welcome to volunteer, but if under 16 will need to bring permission from a parent or guardian and we can supply a form if requested. Grozone is a friendly group and hold regular barbeques, cake days, open days and someone is always getting a brew on (with water heated in a wood burning kettle). No new fangled inventions like electricity here. For more information: Alzheimer's Society The Alzheimer's Society it looking to recruit new volunteers to be a part of a fundraising group in Northwich. Meetings will be held monthly, where new ideas will be discussed in the group and plans set in place to organise fundraising events. No experience is necessary, just plenty of enthusiasm. If you would like more details, please telephone Jo Burton on 07803 115497 or email: [email protected]. Vale Royal Disability Service Give a few hours a week to an organisation that relies on volunteers to deliver many of its services. Shopmobility Northwich and Winsford Shopmobility Northwich urgently requires volunteers to help run the Shopmobility scheme at its Northwich and Winsford sites. (Northwich Shopmobility is located at the Information Centre; Winsford Shopmobility is located at The Dingle Recreation Centre). They welcome volunteers aged 18 or over, with all levels of abilities and from all backgrounds. You can volunteer for as little as one day per week – all that VRDS asks of you is reliability, commitment and enthusiasm. For further information: Get involved with sport Volunteers are key to the success of sports within Cheshire West and Chester and many of the sporting activities in the borough are provided by voluntary lead organisations, groups and clubs. Friends of Anderton and Marbury The Friends of Anderton and Marbury (FoAM) are an active group who get involved in looking after both parks and have a busy programme of walks, talks, conservation tasks and events. Friends of Marshall's Arm The reserve has an active Local Management Group and Friends Society who organise events, practical tasks and training. They are always looking for new members. Home-Start West Cheshire Would you like to make a difference to families with young children by becoming a family support volunteer? Home-Start is a charity offering regular support, friendship and practical help to families who may be struggling to cope with a variety of challenges including, the demands of parenting young children, post natal illness, isolation, disability and multiple births. You would spend two to three hours a week with a family in their home. Training will be given and out of pocket expenses, reimbursed. You will need to have experience of bringing up children. Home-Start West Cheshire (Family Support Charity) Waterside House Navigation Road Northwich CW8 1BE Buzz Youth Group Volunteering The Buzz Youth Group was set up in response to disabled young people in the Cheshire West and Chester area asking for a place to ‘hang out’ with their friends. The group is funded by Children In Need and is run by the members through a steering group. The group runs on a weekly basis across Cheshire West and Chester district and all activities on offer are chosen by the young people who attend. To find out more, please call the Cheshire Centre for Independent Living on 01606 872760. West Cheshire Buddy Scheme for ages 5-18 As a volunteer your role is to support a young person with a disability to enable them to be involved in a leisure activity of their choice. Depending on your own leisure interests and the interests of the young person you will be supporting, you will help him or her to gain access to a mainstream local sport or leisure club or group. Depending on the club and the young person you may need to supervise them only in their chosen activity or get involved to some extent yourself. Rudheath 5-12 Rudheath 5-12 Youth Club is looking for volunteers. Any skills or talents are welcome - but mainly you just need enthusiasm. The Youth Club is open from 6pm-7.30pm on Fridays at Venue, Gadbrook Road, Rudheath, and aims to develop 5-12 year olds through information, education, leisure and fun. If you would like to volunteer for this rewarding role, contact Hazel using the details below: Cheshire Wildlife Trust Cheshire Wildlife Trust is a charity dedicated to preserving Cheshire's plants, animals and wild places for all to enjoy, both now and in the future. Volunteering on the Mid Cheshire Line Stations between Mouldsworth and Navigation Road are managed by Northern Rail (Altrincham is also part managed by Metrolink) and there are always opportunities for volunteers to help at stations. Volunteering mainly means helping to keep stations clean and tidy by litter picking or sweeping but there are usually opportunities for weeding, planting and other gardening tasks. They particularly welcome new volunteers with artistic talents, those who work with young people and people who are knowledgeable about the history of the Line. Waste reduction volunteers If you are passionate about reducing waste, we would like to hear from you. CWAC is on the hunt for volunteers to advise and empower local residents to reduce waste, compost at home and make the most of leftover food. The team of dedicated Waste Reduction Volunteers attend road shows and deliver talks throughout the area, speaking to people about home composting and food waste reduction. If you think you have what it takes to become part of our friendly, enthusiastic team please contact the Volunteer Coordinator on 0300 123 8 123 for an application form or apply online. Save the Family are looking for new Trustees Save the Family provide a safe community environment combined with basic support to homeless and troubled families where safeguarding of both children and vulnerable adults is absolutely paramount. Save the Family are recruiting new Trustees. For more information: Citizens Advice There are over 22,000 volunteers involved in the Citizens Advice service, performing a wide range of roles. There are many roles to choose from including advisers, receptionists, information assistants and many more. Please note, not all volunteer roles will be available in every bureau. To view the full range of roles and descriptions please: St John Ambulance St John Ambulance is the nation’s leading first aid charity. Our volunteers are trained in life saving skills and play a key role in delivering first aid care in the community. If you are energetic, reliable and committed to putting the needs of others first we have opportunities for you now in Winsford. Visit www.sja.org.uk and search for ’volunteer vacancies’ and take the first step to stand out from the crowd. Help us be the difference between lives lost and lives saved. Cheshire West Eating Support Team (C.W.E.S.T) C.W.E.S.T is Cheshire West eating Support Team. We run self help support groups and therefore looking for volunteers to help facilitate the two monthly meetings. One for those with eating disorders and one for their carers, whether they be parents, partners or friends. As a facilitator you may have had an experience with an eating disorder or careered for someone who has. However, this is not a requirement, as it is more important that you mare a good listener, empathetic and patient. If you have a couple of hours a month and would like to support these groups or would like any more information or an informal chat please contact Helen Davies for more information: • Telephone: 07763061307 Sue Ryder's charity shop Sue Ryder's charity shop team in Northwich are looking for enthusiastic and reliable volunteers to help maximise sales which fund our healthcare services. Tasks will vary according to need and may include: • sorting donations • serving customers • pricing goods • cleaning & preparing goods for sale • creating window displays We'll need you to: • be friendly and approachable • have common sense • use your own initiative • work as part of a team. Previous retail experience would be beneficial but is not essential as all training will be provided. If you're interested please: • Telephone: 01606 352805 • Visit: Sue Ryder's charity shop, 46 Witton Street, Northwich Stroke Association - Resolution Run Delamere Forest The Stroke Association Resolution Run returns to Delamere Forest on Sunday 12 March 2017. This annual sponsored run is currently on track to be bigger than it has ever been before, and we need your help to ensure the safety of our runners and smooth running of this event. We’re looking for volunteers to act as route marshals, man our water station, and present medals/water to our runners as they cross the finish line. The Stroke Association believes in life after stroke. That’s why we campaign to improve stroke care and support people to make the best possible recovery, and why we fund research to develop new treatments and ways to prevent stroke. For more details or to register as a volunteer, please: Sunrise Nursery Over Hall Community Enterprises Limited, a Registered Charity and Social Enterprise which runs 3 Children’s nurseries and an after school club in Winsford are seeking volunteer trustees to join our Board. Applications are welcome from all sections of the community, everyone has something they can bring to our Board. These positions would suit people with an interest in improving the outcome for the children of Winsford by providing targeted help to those families/children that need it, in preparation for starting school. No prior knowledge is needed and the time commitment is not onerous, five meetings a year, each lasting approximately one and a half hours with meeting papers circulated beforehand. There is scope for interested trustees to become more involved if they wish ie recruitment, finance sub committees, policy approval etc but this is not necessary. Full training will be given and the positions are subject to enhanced DBS checks. For more information please contact Mrs Jo Hopton, Company Secretary. Mid Cheshire Scouts Mid Cheshire Scouts are looking for adult volunteers. The work would be working with beavers, cubs and scouts in Northwich/Middlewich and Winsford. The roles available are as follows: • Assistant Beaver Leader - Various Groups • Assistant Cub Leader- Various Groups • Assistant Scout Leader - Various Groups • Group Scout Leader - Moulton Scout Group • Beaver Scout Leader - Moulton Scout Group If you are interested please contact Alan Buckley: Vision Support , Northwich Club for the Blind Can you spare one Wednesday afternoon a month to support people with Visual Impairment? The Northwich Club for the Blind need volunteers to support them with their monthly meetings which include, activities, speakers and trips out. For further information please contact Jo Jardine: Changing Lives Changing Lives in Cheshire is a charity and social enterprise based in Winsford. We deliver real environmental, social and community impact. Volunteering at Changing Lives in Cheshire can be for a number of reasons. For some, it’s to meet new people, and to offer something back to the local community or to make a difference to people around them. For others it provides an opportunity to develop new skills or to build upon existing experience and knowledge and further your job prospects. We have a wide range of opportunities available including Reception, Admin, Finance, Marketing, PR, Shop and Online Sales, Warehouse, Driving, Electrical and Wood Workshops. All volunteers receive a comprehensive induction plus travel costs, meals (we provide a set limit for lunches for our all-day volunteers), protective clothing, training and ongoing support from the Volunteer Coordinator For an informal chat: • Telephone: Carol Halpin on Mobile: 07867 356 796 or • Office: 01606 827120 The NeuroMuscular Centre The NeuroMuscular Centre (NMC), based in Winsford, is looking for volunteers to help out with community events, bucket collections, event marshalling, and a host of other fundraising opportunities. The NeuroMuscular Centre is a pioneering charity that supports hundreds of people in the Winsford and Cheshire region who are affected by Muscular Dystrophy. They offer a range of support and services including physiotherapy, supported training and employment opportunities as well as information, support and advice. There is no minimum time commitment, and volunteering opportunities will include evenings and weekends. We welcome applications from people of all abilities, but applicants must be aged 18 or over. For more information, please contact Lisa: Skills and Employment Volunteering Volunteer Employment Mentor Opportunities Volunteers will work out of their local Work Zone providing one to one support to an individual (or individuals) looking to secure employment. They help with such things as job searching, IT, interview tips, overcoming barriers into employment. They work with their mentees to help them to establish an action plan, then support and empower them towards achieving their aims. Training is available, including the possibility to gain a Level 2 qualification in Mentoring. Applicants should be able to provide a long term commitment to this role as mentees are offered a minimum of 30 hours support should they require it. Volunteer IT Support Opportunities Volunteers may be required to support an IT Tutor in the delivery of a computer course in one of the local Work Zones in Ellesmere Port, Chester, Northwich, Winsford. Working with a Tutor, volunteers be working with learners in whole groups, or on a one to one basis. Applicants must be willing to undergo an IT qualification if not already achieved. Volunteer Administration/Reception Opportunities Volunteer Administrators/Receptionists will work out of our busy local Work Zones based in Ellesmere Port, Winsford or Northwich. Each day will be different. Successful applicants would be meeting and greeting visitors and users of the Work Zones, dealing with registration paperwork, signing in sheets, typing letters, updating notice boards, photocopying etc. Good IT skills would be an advantage, but training opportunities will be available, some of which may result in a nationally recognised qualification. Volunteer Learning Support Tutors (maths, English, IT and Family Learning) Volunteers may be required to support a course in one of the local Work Zones, or at a community venue in the Cheshire West area (e.g. Ellesmere Port, Chester, Northwich, Winsford). Working with a Tutor, volunteers will assist in the delivery of courses working with learners in whole groups, or on a one to one basis. Applicants must be willing to undergo an Adult English or maths qualification at level 2 if not already achieved. British Red Cross Emergency Response Co-ordinator Can you keep a cool head in a crisis? As an emergency response volunteer you would help people in need and have a special role to play in supporting the emergency services. You will be providing much-needed practical and emotional support to individuals, as part of an emergency response team, in support of category 1 and 2 responders and other agencies following an emergency or major incident. Volunteers must be able to reach Birchwood Fire Station within 30 minutes of being called out and ideally be a car owner/driver. For more information and to apply: and then select A24 - Emergency Response - Fire and Emergency - (FVS) - Cheshire. Marie Curie Marie Curie is looking to recruit new volunteers to join the Northwich Fundraising Group. The group meet monthly and are looking volunteers to help out in lots of ways, including organising and taking part in supermarket collections to helping support the fundraising group in organising events. If you feel you could help Marie Curie fundraise, then we would love to hear from you. We are recruiting the key role of Treasurer too! If you would like to get involved with the fundraising group or would just like more information please contact Holly Fraser: The Cinnamon Trust The Cinnamon Trust is the national charity for the elderly and terminally ill and their pets. They seek to keep owner and pet together for as long as possible with the help of a national network of volunteers who assist when day to day care poses a problem. Their aim is to relieve the owners of any worry concerning the welfare of their pets both during and after their own lifetime making us unique amongst charities. All volunteers help in the ways that are most appropriate to them. Teams take it in turn to visit housebound owners, to take dogs for walks, volunteers foster pets as one of their family when owners face a spell in hospital, they take pets to the vet, clean cages out. They take any problem posed in day to day care of pets. For more information contact Sally: Cheshire West Citizens Advice Cheshire West Citizens Advice are an advice service that help people resolve a wide range of problems from employment, benefits, housing, immigration and debt amongst others, by providing information and guidance to those in need and by influencing policy makers. The Citizen’s Advice Service has provided free, confidential, impartial advice to anyone on almost any subject since 1939 when it was established as an emergency war service. Cheshire West Citizens Advice would not exist without their fantastic team of volunteers that regularly give their time, dedication and enthusiasm. All of their front line services are delivered by volunteers. Cheshire West Citizens Advice are always looking for more volunteers to continue to support the increasing volume of clients they see on a weekly basis and to be there for the clients across all our various available channels such as telephones, webchat, email and face to face. There are a range of roles available: • Volunteer Support Worker - some of our volunteers have additional needs and need a volunteer support worker to enable them to do parts of their role • Telephone Adviser – these volunteers man our phone lines answering calls from clients on a variety of issues. Again our telephone advisers are highly trained and offer brilliant service to those that cannot visit a centre. • Webchat and Email Adviser - these volunteers respond to online enquiries from people that need our advice services. They are highly trained to be able to break down issues and offer tailored advice • Centre Support Volunteer or Meet and Greet Volunteer – these volunteers manage our waiting rooms making sure clients are comfortable , do admin support for the centre and do initial checks on clients to help the volunteer adviser. If you are interested, or for more information: • Telephone Hailey Wood: 01244 503945 Action Hearing Loss (Formerly known as RNID) is looking for volunteers to support their Cheshire based information officer, getting out and about across the region and providing information on deafness, hearing loss and tinnitus to deaf and hard of hearing people, their families, carers, community groups and professionals, encouraging independence and reducing feelings of isolation. The charity has regular information stands in the libraries across Cheshire West and Chester which would benefit from an extra pair of hands. If you like talking, consider yourself to be friendly and approachable and have an interest in hearing loss and information, come and spend an hour or two with us answering questions from visitors to the stand and handing out leaflets as appropriate. In return you will receive training, reimbursed expenses and a great experience! Location is flexible – we are open to visiting anywhere that would benefit from our information and welcome any feedback and suggestions. The length of each information session can vary too, from a few hours a month, to a full day a week. The level of commitment depends entirely on you. For more information: Cheshire Young Carers Cheshire Young Carers offers support to over 150 young carers across Cheshire. CYC aims to respond to the needs and improve life chances of children and young people providing care to a parent or sibling. This includes parents with mental illness, entrenched substance misuse, physical illness and other conditions and disabilities that may impact on the young person’s wellbeing. Volunteers make a significant contribution to the work and objectives of CYC. At CYC they recognise that there are benefits for a volunteer too, by having the opportunity to pursue an interest and consequently gain new information, develop new skills or enhance existing ones. Their volunteers learn leadership and social skills as they interact with paid staff, young carers and other volunteers. They develop personal pride and satisfaction as they help young carers, and this self-esteem is matched by a recognition by others of their expertise in specific areas such as tutoring, mentoring, coaching etc. For further information: Vale Royal Conservation Volunteers The Vale Royal Conservation Volunteers are a group of volunteers with an interest in working to preserve and enhance the local natural environment and maintain and improve public access to it. They do this by working by arrangement with local charities and organisations who share their interest, and can provide the supervision, tools and insurance necessary to carry out our work. By tradition they operate on Thursdays only, and normally confine their activities to within a ten mile radius of Mid-Cheshire. The way they operate gives their members variety of experience both in work and location, whilst , by meeting weekly, providing an ideal environment in which lasting friendships can be forged. For further information: Brightlife Brightlife has opportunities for Volunteer Community Connectors to work in our social prescribing areas of Winsford, Chester and Malpas. Brightlife is a Big Lottery funded partnership set up to improve the lives of older people across Cheshire West and Chester by reducing social isolation. As a Volunteer Community Connector, you will support the work of team, by providing practical support to the older people we work with. Our Community Connectors choose the ways in which they would like to support our Social Prescribing Co-ordinators, depending on their own interests and skills. The ways in which Community Connectors help include: • Accompanying Co-ordinators on home visits to help individuals set and reach their goals • Transporting an individual to somewhere in the local community • Assisting Social Prescribing Co-ordinators with regular drop-in sessions • Accompanying an older person on their first visit to an activity or service and staying with them • Visiting or making telephone contact with an older person • Being involved in events to promote the social prescribing service • Acting as an ambassador for Brightlife within your local community To find out more information, contact Lynne Humphries: Greyhound Rescue West of England (GRWE) Greyhound Rescue West of England (GRWE) is the leading greyhound rescue charity in England and Wales independent of the greyhound racing industry. They are dedicated to the rescue, rehabilitation and rehoming of greyhounds and lurchers, and re-home around 500 of these special dogs every year. The charity is seeking volunteers across Cheshire to help with dog walking, home visiting, transportation, events and much more! For more information contact Anna Claxton, Volunteer Co-ordinator: Royal Voluntary Service Cheshire The RVS (formerly the WRVS) is a volunteer organisation that enriches the lives of older people across Britain. They are looking to put a team of enthusiastic people together to attend events on their behalf, talking to people about their services and inspiring others to volunteer with them. If you are interested in helping improve the lives of older people in your local community please get in touch. For more details about the RVS and details of opportunities available across Cheshire: Saltscape Saltscape Landscape Partnership works alongside other environmental and wildlife charities to protect enhance and celebrate the unique landscape and character of the Weaver Valley in Cheshire. We have many volunteering opportunities to work on a range of projects and make a difference to an area steeped in natural and industrial heritage. You could get your hands dirty helping to look after your local environment by joining our practical workdays volunteering team or even carry out valuable research into local heritage and join us at events. All our volunteering opportunities are advertised on our website, why not have a look: Vision Support - Social Group Supporter Winsford Could you spare a couple of hours once a month to support a Social Club in Winsford for people with a Vision Impairment? We need a volunteer who is willing to have a coffee and chat with people, who would also enjoy organising small activities. In return Vision Support offers support and training and expenses. For further information please contact Jo Jardine at Chester Office: Cheshire West, Halton and Warrington Youth Offending Service Volunteers wanted to support: • Referral Order Panels • Reparation Projects • Girls and Young Women Mentoring Scheme • Young people who need help accessing and attending ETE (education, training and employment) Enhanced DBS and references required. Formal interview, induction; training and team meetings. If you are interested please contact Christine Dunn: Cultural Ambassador for Brio Leisure If you’re looking to bolster your CV with some interesting and varied volunteer work experience, then you should consider joining our Entertainments team as a Cultural Ambassador! Not only do you get to meet interesting people and help deliver our ever-growing programme of shows and events, you’ll be having fun and helping out in your community too. Cultural Ambassadors are here to help raise awareness of the events and shows that Brio Leisure host, and they play a customer service role during events too. As a Cultural Ambassador, you’ll be: • Meeting and greeting audiences as they arrive at events • Checking and validating parking and helping manage late arrivals • Resolving issues with seating plan and ensuring everyone’s sat in the correct seats • Monitoring the audience to ensure restrictions around cameras and recording equipment are being observed You’ll also get to help with the distribution of flyers, brochures and other printed material in the local area to help make the shows as successful as they can possibly be! In return, you’ll get valuable experience in a customer service environment. It’s also a nice place to work! There’s a good buzz when we’re running events, and you’ll get to meet lots of people, all excited to see the show. You’ll also get to watch any show you’re working on for free, once you’ve helped everyone to their seats! You’ll also be able to save up shifts and “cash them in” for free tickets to shows you’re not working on! So for those that love live music, comedy or theatre productions, becoming a Cultural Ambassador is a great way to indulge your passion without breaking the bank! To apply, send a copy of your cv to: Just So Festival Just So Festival, organised by Wild Rumpus CIC, have several volunteering opportunities available where you can boost or gain hands-on events and tourism experience within an arts setting. For more information and to apply: St Luke's Hospice Shop Vacancies Since 1988, St Luke’s has been providing palliative care to local people, supporting them in ways which go beyond the scope and funding of the NHS. Last year we supported over 1,000 local people with a huge range of support from end of life care on our ward to supporting carers, and from helping children cope with grief to helping patients return to work after an illness. We are a charity and were established following a fundraising campaign in the mid 1980’s which was championed by local people, and all these years later we continue to be supported in this way. In fact, around 85% of our care is funded by donations. Volunteers play a key role in the success of St Luke's and the care we can afford to provide. We have nine charity shops in mid and south Cheshire which raise money for St Luke's, and these are mainly staffed by volunteers. Last year, almost 800 volunteers donated 93,000 hours of their time, saving more than £600,000 in salaries and boosting the Hospice team by the equivalent of 48 full-time members of staff. St Luke's Shop, Witton Street, Northwich As a Retail Assistant you will support our Shop Managers in every aspect of the shop, providing excellent customer service and going the extra mile to ensure that our shops are as successful as possible. Some of the tasks that you may be doing include: • Greeting customers • Using the till • Receiving donations, sorting and preparing stock for sale • Assisting with shop displays • Maintaining a stocked and tidy shop floor • Processing Gift Aid and encouraging new donors We ask that you are free to volunteer with us for as little as four hours each week, usually a morning or an afternoon, but this is flexible depending on your availability. In return, we offer you the opportunity to develop new skills and receive ongoing support and training, as well as having a great time and knowing that you are making an important contribution to St Luke’s. What we are looking for: • Aged 16 and over • Willing to partake in all aspects of the shop and training • Trustworthy and reliable • Good communication and interpersonal skills • Well presented • Able to support the overall aims of St Luke’s and respect polices such as Equal Opportunities and Health and Safety Application Process • Application form • Informal chat • Trial shifts For more information: © 2019 Cheshire West and Chester. All rights reserved.	# Contact Mover ## Description Save time by letting Contact Mover transfer contacts between Exchange, iCloud, Local, and other accounts. ## What’s New Version 2.4.0 Now featuring full support for iOS 9 and 10 and legacy support for iOS 8. Please ensure your device is running a supported version of iOS before purchasing this app. Thanks to everyone for the feedback over the years. Certain things on your device have to be correct for this app to function as expected, and we are constantly adding helpful messages and walkthroughs within the app itself when we determine that your situation requires a few extra steps. As IT professionals, we have done our best to test Contact Mover with various versions of iOS, Exchange servers, and account configurations. We want this to be a foolproof solution for moving contacts quickly, and we need your feedback if something isn’t working. Before leaving negative feedback, please email [email protected] and we will gladly help you. ## Ratings and Reviews Overall: 4.6 out of 5 (10 Ratings) - CGoss2017 Best App For Moving Contacts “As a Mobile Administrator for a large company I can say with confidence that this is by far the easiest way to move contact from exchange to iCloud.” - Stl968 Simple to use, efficient tool “Great” - Theremustbeaway It works “I spend hours with Apple genius and many others from microsoft to figure out how to move my contacts from my work outlook (exchange) to my new personal mac book air. I have a lot of notes in the 'note field' of my thousands of contacts that were very important. No one could sync this so that the fields would match. It would only show the first line and that wasn't acceptable. I needed to see this exactly the way I do in outlook exchange and now I finally can. This is the best app and it happens seamlessly. No duplicates, all perfect. Highly recommend it if you're in the same boat I was.” ## Information - Seller: Immense Networks - Size: 3.3 MB - Category: Business - Compatibility: Requires iOS 8.0 or later. Compatible with iPhone, iPad, and iPod touch. - Languages: English - Age Rating: Rated 4+ - Copyright: © 2011–2016 Immense Networks LLC. - Price: $4.99 - Supports: Family Sharing (Up to six family members) --- # Volunteering It is often the generosity of local people giving their own time and commitment through volunteering that means that many voluntary‐led organisations, groups and clubs are able to deliver projects and hold events and activities that make a real difference in our communities. The following organisations rely on volunteers to exist. Get in touch and use your spare time to support your local area. If you are looking for volunteers, either on an ongoing basis or for a specific event, and would like to promote your group here, please email the details to [email protected]. --- ## SSAFA the Armed Forces Charity Job description Looking at making a real difference in your local Cheshire community? Volunteer Caseworkers are the lifeblood of SSAFA, supporting a growing number of people in need of financial, practical and emotional support. Clients come from all backgrounds and age groups and may have served in WW2 or in a more recent conflict like Iraq or Afghanistan. Our trained volunteers listen without judgement to assess and provide tailored support to help people navigate life in and beyond military service. We need you to join your local SSAFA team to help us achieve this. Skills & Experience - Good listening and communication skills including written and spoken English - Ability to be respectful and non‐judgemental with clients, their family, other agencies and SSAFA colleagues - Ability to send and receive emails – you will receive your own SSAFA email address - Ability to make enquiries on behalf of clients by phone, email, letter or by filling in forms - Willingness to use our online case management system (covered in training) - Reliable attitude, contact clients promptly, keep appointments, update the branch regarding your availability - Ability to maintain confidentiality and keep information safely - Access to public transport or a car to travel to appointments with clients - Able to provide two referees (non‐relatives) - Happy to be DBS checked (paid for by the charity) Why volunteer with SSAFA? - Three‐day all‐expenses‐paid training course for new caseworkers - Short online training modules and a range of e‐learning courses - Local induction and gatherings to meet and share ideas - Reimbursement of out‐of‐pocket expenses - Support people in your community with a military background - Use your skills, knowledge and life experience to benefit others - Experience, training and skills to highlight on your CV and in job interviews - Better physical and mental health – studies show volunteers live longer and experience lower stress Caseworkers visit clients to work out what type of help they need. This might be funds for special equipment, property adaptations or rental deposits. Caseworkers also sign‐post clients to specialist local services for benefits, housing, mental health, debt, finding work etc. If you’re studying to be a social worker, have a background in the military or just want to volunteer some time, we want to hear from you. Apply: Send your contact details to [email protected] --- ## Trustee – Citizens Advice Cheshire West Do you want to help the community where you live, study or work? Could you be interested in being part of the team which runs Citizens Advice Cheshire West? We’re looking for people to help us develop our advice services and secure vital resources. We are seeking trustees, particularly with backgrounds in HR, law, marketing or fundraising, but all skills and experience considered. We have 34 staff, ~120 volunteers, and offices in Chester, Ellesmere Port, Northwich and Winsford. You’ll need to: - Attend at least six evening meetings each year - Work as a team and actively participate in discussions - Act in the interests of Citizens Advice Cheshire West, its staff and clients We welcome applications from all backgrounds and particularly from women and the BAME community. No prior Citizens Advice experience needed. Time commitment: Voluntary, with reasonable expenses reimbursed. To apply: Send an expression of interest with your contact details to Nicki Berg. --- ## Appeal for Young Carers Project Volunteer Hours of volunteering: - Monday – Chester: 6pm–7:30pm and 8–9:30pm - Thursday – Ellesmere Port: 5:30–7pm and 7:30–9pm - Thursday – Vale Royal (Rudheath): 5:30–7pm and 7–8:30pm - Plus quarterly meetings/training Responsibilities: 1. Ensure activities are safe and enjoyable for young people 2. Maintain client confidentiality 3. Attend group(s) regularly 4. Work as part of a team to support planning of trips/activities 5. Work within child protection guidelines Skills & Experience - Interpersonal or youth work experience useful but not essential To apply: Contact the project co‐ordinator (details as advertised by Cheshire West & Chester). --- ## Recruiting Magistrates Magistrates are volunteer members of the judiciary who make decisions in criminal and family courts. Anyone aged 18–70 can apply; no formal qualifications required. Full training provided. Travel and subsistence paid. If employed, you are entitled to time off for the role. Could you offer 14 or more days a year? Find out more at your local magistrates’ court or: --- ## Cheshire Community Development Trust – Buddying & Befriending Scheme CCDT is a charity based in Northwich supporting people to: - Remain independent - Reduce social isolation - Attain goals - Find a sense of purpose Volunteer Buddy: Short‐term role (3–6 months) to help someone gain confidence to leave home, join activities and make friends. Volunteer Befriender: Create a supportive friendship; tea & chat or a walk. To apply: Contact Volunteer Coordinators Pete or Holly. --- ## St Luke’s Hospice St Luke’s provides care and services for people with life‐limiting illnesses in mid/south Cheshire. We rely on volunteers across various roles: - Befriender (regular visits to reduce isolation) - Weekend receptionist - Retail team (sorting donations, cashier) - Event support (ad hoc) To apply: Contact your nearest St Luke’s Hospice shop or visit their website. --- ## Citizens Advice Cheshire West – Volunteer Adviser Provide valuable advice and support to local people. Offices in Winsford, Ellesmere Port, Northwich and Chester. Benefits: - Improve employability and skills - Build confidence - Work with like‐minded people Roles: Face‐to‐face and/or telephone advisers. Full training provided. Responsibilities: - Interviewing clients - Finding, interpreting and communicating relevant information - Acting on behalf of clients (letters, forms, referrals) - Completing case records - Attending team meetings/training Person specification: - Commitment to Citizens Advice principles - Good listening and communication skills - Basic IT and numeracy skills - Respect for confidentiality and diversity - Team player To apply: Call into any office or contact Citizens Advice Cheshire West: - Winsford: Wyvern House, The Drumber, CW7 1AH - Ellesmere Port: 1 Whitby Road, CH65 8AA - Chester: The Blue Coat, Upper Northgate Street, CH1 4EE - Northwich: Meadow Court, Meadow Street, CW9 5FP --- ## Snow Angels A social enterprise supporting older people to live independently via volunteers. Tasks include: - Shopping deliveries - Dog walking - Transport to appointments or social clubs - Prescription collection - Befriending visits (weekly chat & company) New lunch clubs: - Greenbank & Sandiway Manor – Tuesdays, 11am–2pm (50+) - Happy Mondays – Meals & activities for adults 50+ with learning disabilities To apply: Contact Well‐Being Coordinators Emma or Holly. --- ## Age UK – Money Matters Project Role: Money Matters Mentor Support people aged 55+ to reduce outgoings and maximise income by: - Setting up filing systems - Producing budgets - Organising bill payments - Managing small debts - Training on basic bookkeeping Flexible hours; home visits 9am–5pm Mon–Fri. DBS check required; training and expenses reimbursed. For more information: Contact Hazel or Linda at Age UK Cheshire. --- ## Age UK Cheshire – Day Services Volunteer Older People’s Activity Volunteer - Help with crafts, games and refreshments - Provide support and friendship Sessions Tue–Thu, 10am–3pm in Ellesmere Port, Chester and Northwich. Also recruiting: Activity Group Leader (Ellesmere Port) and Minibus Driver (Hartford). Contact: Chris Rees, Day Services Development Officer. --- ## British Red Cross – Volunteering in Winsford - Retail eBay Volunteer: Photograph, list and prepare items for delivery. - Warehouse Donation Sorter: Support stock processing in the eBay centre. To apply: Visit your local British Red Cross shop or website. --- ## Volunteer Drivers – Children’s Services Volunteer Driver Scheme in partnership with Cheshire West & Chester Council to transport young people and adults to education/care services. To learn more: Contact Children’s Services Volunteer Coordinator. --- ## Carers Trust 4all CarerLinks – Volunteer Befriender Support unpaid carers via: - Home visits - Telephone calls - Café meet‐ups - Accompanying to social activities Training, support and expenses reimbursement provided. Contact: Rachel Heyhoe. --- ## Stretton Water Mill Volunteers needed for: - Promoting the Mill at Tilston Wakes (25–26 Aug) - Meet & greet, maintenance, children’s activities (Sept weekends) - Woodland maintenance and winter close‐down (Oct) Contact: Tony Rigby, Cheshire West Museums. --- ## Winsford & Middlewich Sea Cadets Instructor roles: Power boating, sailing, first aid, meteorology. Committee roles: Fundraising and events. Contact: Sea Cadet Unit. --- ## Cheshire Restorative Justice & Mediation Hub (Remedi) Restorative Justice Volunteer (100-hour minimum) - Work with victims and offenders - Full driving licence and vehicle access required Training, expenses and team support provided. For more information: Contact Remedi Volunteer Coordinator. --- ## Catch 22 Volunteers needed: - Driver volunteers for group transport - Peer mentors (aged 16–25) Contact: Gemma Godfrey, Volunteer Coordinator. --- ## Cheshire Without Abuse ### Befriender Support - Provide emotional and practical support to service users - Minimum 4 hours/week - DBS check provided ### Programme Support - Support Gateway programme sessions (2 hours/week) - Observe groups and offer practical/emotional support - DBS check provided Contact: Sharon Stowell, Volunteer Coordinator. --- ## NeuroMuscular Centre – Fundraising Volunteer Help at collections and events in Northwich and Winsford to raise funds for therapy and support services for people with neuromuscular conditions. Contact: NMC Volunteer Coordinator. --- ## Passion for Learning Volunteer in a primary school (Winsford) for 1½–3 hours/week, one‐to‐one reading support for ages 4–11. All training and resources provided. Contact: Passion for Learning team. --- ## Scope – Northwich Shop Volunteer roles: - Customer assistance - Till work - Window dressing - Donation sorting No experience needed; full training, NVQs and placements offered. Contact: Scope Northwich shop. --- ## Mere Brow Farm – Permaculture & Forest Garden Project Volunteers for a 13.5-acre permaculture farm in Weaverham. Activities include weeding, mulching, pruning, composting, tool maintenance and more. When: Mon–Fri, 11am–4pm To apply: Contact Mere Brow Farm. --- ## Information, Advice & Support Service (SEND) Volunteers support parents/carers and young people with Special Educational Needs by: - School visits - Form completion - Preparing for meetings - Explaining terminology - Office administration Contact: [email protected] or 0300 123 7001. --- ## Winsford British Heart Foundation Shop Flexible roles: Customer Service, Stock Collection Driver, Stock Generation, Sort Room. Contact: Kirsten (Shop Manager) on 01606 860453. --- ## NYAS – Independent Visitor Volunteer mentor/befriender for young people in care (1–4 hours/month). Training, support and expense reimbursement provided. Contact: NYAS volunteer team. --- ## Beanstalk One‐to‐one Reading Helpers for children aged 3–11 in Northwich and Winsford. 1–1½ hours, twice a week. No experience required. Contact: Local Beanstalk coordinator. --- ## Grozone Community Garden Volunteers (14+) for gardening sessions in Northwich. All tools and refreshments provided. Under-16s need parental consent. Contact: Grozone project team. --- ## Alzheimer’s Society – Northwich Fundraising Group Monthly group to plan and run fundraising events. No experience necessary—just enthusiasm. Contact: Jo Burton on 07803 115497 or [email protected]. --- ## Vale Royal Disability Service – Shopmobility (Northwich & Winsford) Volunteers to operate Shopmobility schemes at Northwich (Information Centre) and Winsford (Dingle Rec Centre). Flexible days; training provided. Contact: VRDS Shopmobility coordinator. --- ## Get Involved with Sport Volunteers needed for a range of sporting activities across Cheshire West & Chester. Contact your local sports development team. --- ## Friends of Anderton & Marbury Active group caring for both parks. Walks, talks, conservation tasks and events. New members welcome. Contact: FoAM local organiser. --- ## Friends of Marshall’s Arm Local reserve with practical tasks, events and training. Join the Local Management Group or Friends Society. Contact: Marshall’s Arm coordinator. --- ## Home-Start West Cheshire Family support volunteer (2–3 hours/week) for families with young children. Training and expenses provided. Parenting experience required. Contact: Home-Start West Cheshire, Northwich, CW8 1BE. --- ## Buzz Youth Group Weekly sessions for disabled young people, run by members. Activities chosen by attendees. Contact: Cheshire Centre for Independent Living on 01606 872760. --- ## West Cheshire Buddy Scheme (Ages 5–18) Support a young person with a disability to access a leisure activity of their choice by offering 1:1 or group assistance. Contact: West Cheshire Buddy Scheme coordinator. --- ## Rudheath 5–12 Youth Club Fridays, 6pm–7:30pm at Venue, Gadbrook Road, Rudheath. Volunteers needed—enthusiasm essential. Contact: Hazel at the youth club. --- ## Cheshire Wildlife Trust ### Volunteering on the Mid Cheshire Line Stations between Mouldsworth and Navigation Road: litter picking, gardening, artwork, working with young people or local history. Contact: CWT volunteer coordinator. --- ## Waste Reduction Volunteers Advise residents on composting and food‐waste reduction at roadshows and talks across Cheshire West. Training provided. Contact: Volunteer Coordinator on 0300 123 8123. --- ## Save the Family – Trustees Volunteer trustees for a charity supporting homeless and troubled families. Safeguarding paramount. Contact: Save the Family chair. --- ## Citizens Advice – Various Volunteer Roles Roles include advisers, receptionists, information assistants and more. Training provided. Apply: Visit www.citizensadvice.org.uk and search your local bureau. --- ## St John Ambulance – Winsford Volunteer first‐aiders to support community events. Training provided. Apply: Visit www.sja.org.uk, search “volunteer vacancies” and select Cheshire. --- ## Cheshire West Eating Support Team (C.W.E.S.T) Facilitator volunteers for monthly eating‐disorder self‐help groups. Good listening skills, empathy and patience required. Contact: Helen Davies on 07763 061307. --- ## Sue Ryder Charity Shop – Northwich Volunteer retail roles: sorting, till work, pricing, window displays. Friendly, reliable people needed; training provided. Contact: 46 Witton Street, Northwich or 01606 352805. --- ## Stroke Association – Resolution Run (Delamere Forest) Volunteers for route marshals, water station and medal presentations at the sponsored run on Sunday 12 March. To register: Stroke Association volunteer team. --- ## Sunrise Nursery Trustee volunteers for a charity operating nurseries and after‐school clubs in Winsford. Five meetings/year; training provided; DBS check. Contact: Mrs Jo Hopton, Company Secretary. --- ## Mid Cheshire Scouts Adult volunteers for Beavers, Cubs and Scouts in Northwich, Middlewich and Winsford. Roles: Assistant Leaders, Group Scout Leader. Contact: Alan Buckley, District Commissioner. --- ## Vision Support – Northwich Club for the Blind Support monthly social meetings (activities, speakers, trips) for people with visual impairment. One afternoon/month. Contact: Jo Jardine, Chester Office. --- ## Changing Lives in Cheshire Volunteer roles in Reception, Admin, Finance, Marketing, Retail, Warehouse, Driving, Workshops and more. Induction, training, meals and travel expenses provided. Contact: Carol Halpin on 07867 356 796 or 01606 827120. --- ## Skills & Employment Volunteering - Employment Mentor: One‐to‐one support for jobseekers, action plans, training (Level 2 Mentoring). - IT Support: Assist IT tutors in computer courses; qualification provided. - Admin/Reception: Meet & greet, paperwork, IT tasks in Work Zones (Ellesmere Port, Winsford, Northwich). - Learning Support Tutor: Support maths, English, IT and family learning courses; qualifications provided. Contact: Local Work Zone volunteer team. --- ## British Red Cross – Emergency Response Coordinator Support in a crisis, providing practical and emotional help as part of an emergency response team. Must reach Birchwood Fire Station within 30 minutes and ideally be a car owner/driver. To apply: Visit www.redcross.org.uk and select A24 – Emergency Response – Fire and Emergency – Cheshire. --- ## Marie Curie – Northwich Fundraising Group Volunteers and a Treasurer to plan and run fundraising events. Meet monthly; help with supermarket collections and events. Contact: Holly Fraser, Marie Curie. --- ## The Cinnamon Trust Volunteer pet support for elderly and terminally ill pet owners: dog walking, pet fostering, vet visits and more. Contact: Sally at The Cinnamon Trust. --- ## Cheshire West Citizens Advice Ongoing volunteer roles in telephony, webchat, email advising, centre support, meet & greet, and support work. Full training and support provided. Contact: Hailey Wood on 01244 503945. --- ## Action on Hearing Loss Information stand volunteers in libraries across Cheshire West & Chester. Friendly, approachable volunteers to answer questions on deafness, hearing loss and tinnitus. Contact: Action on Hearing Loss local information officer. --- ## Cheshire Young Carers Volunteers to support young carers (mentoring, activities, events). Training and support provided. Contact: Cheshire Young Carers volunteer team. --- ## Vale Royal Conservation Volunteers Weekly Thursday tasks within 10 miles of Mid-Cheshire: habitat management, public access improvements, practical conservation. Contact: VR Conservation Volunteers coordinator. --- ## Brightlife – Volunteer Community Connectors Support social prescribing in Winsford, Chester and Malpas, helping older people to reach community activities and services. Contact: Lynne Humphries, Brightlife. --- ## Greyhound Rescue West of England (GRWE) Volunteer dog walkers, home visitors, transporters and events helpers for greyhound and lurcher rescue and rehoming. Contact: Anna Claxton, Volunteer Coordinator. --- ## Royal Voluntary Service Cheshire Volunteers to attend events, talk to the public about RVS services, and inspire others to volunteer for older people’s services. Contact: RVS Cheshire team. --- ## Saltscape Landscape Partnership Practical workdays, heritage research and events volunteering across the Weaver Valley landscape partnership area. Apply: See www.saltscape.co.uk/volunteer. --- ## Vision Support – Social Group Supporter (Winsford) Monthly social club support for people with a vision impairment: coffee, chats and small activities. Contact: Jo Jardine, Chester Office. --- ## Cheshire West, Halton & Warrington Youth Offending Service Volunteers for: - Referral Order Panels - Reparation Projects - Girls & Young Women Mentoring - ETE access support Enhanced DBS, interview, induction, training and team meetings required. Contact: Christine Dunn, YOS Volunteer Coordinator. --- ## Cultural Ambassador – Brio Leisure Meet & greet audiences at events, validate parking, assist with seating and distribute promotional materials. Free tickets and experience in events and customer service. Apply: Send your CV to Brio Leisure Entertainments team. --- ## Just So Festival Volunteer roles in events and tourism within an arts setting; gain hands-on experience. Apply: See www.wildrumpus.co.uk/volunteer. --- ## St Luke’s Hospice Shops – Winsford & Northwich Retail Assistant roles in St Luke’s shops: - Greeting customers - Till operation - Sorting, pricing and preparing stock - Shop displays - Gift Aid processing Commitment: Minimum 4 hours/week. Training and ongoing support provided. To apply: Contact shop manager (Winsford or Witton Street Northwich). --- End of volunteer opportunities. Thank you for your interest in supporting our communities!	14,062	5,213	-562,811,769,843,157,440	concat	[ "concat_full" ]	0.75	true	null
7,868,484,084,143,332,000	A Placed Called Intelligence-in-the-Cloud 0 342 I was given the pleasure of speaking at one of the U.K.’s leading strategic learning forums on the transformative needs of education in the U.S. and abroad. The title of my message was profoundly simple, yet got the attention of any chief Information officer, or technologist desiring to stay gainfully employed over the long haul. The message was called ‘A Place Called Intelligence-in-the-Cloud.’ The sub-title could also have read ‘The death of analytics as we know them.’ cloud-intelligence Data analytics have been the mystical promise by tech companies for over 15-years. During this 15-year span of time, the reality has set-in that we are an intelligent society driven by a thirst for knowledge and intelligence at the consumer level. Most C-level executives have now reached a point that they no longer believe a promise of receiving intelligence or knowledge only after they purchase and install yet one more analytic tool or application. The good news for leaders who are desperate for instantaneous intelligence is that there is a fairly clear pathway to this intelligence vs. the long winding road of implementations, big data, and more analytics. In fact, the C-level purchases of analytics will suddenly and quickly drop into the shadows of the C-level purchaser. The evidence is becoming clearer that wearable technologies, mobile technologies, and design technologies will soon allow consumers and students to merge these technologies together. The emergence will allow most savvy consumers and students to find and design their own way to success. Most importantly, access to these design technologies are already proven to be stored in cloud-based services, which individual consumers can now purchase. It is critical to note that data analytics will always be needed, but they will no longer be the eye-candy or promise that C-level executives will focus their attention toward. Consumer wearable and smart devices with built in intelligence via the cloud will cause this shift to happen quickly. This futuristic design can be view in concept at: http://bit.ly/2gWGSUl Below are four considerations to validate and test the reality that a “Place Called Intelligence-In-The-Cloud” is a reachable destiny. Consideration #1 – Personal and synchronized intelligence is now available to everyone The reality that wearable technology now allows personal intelligence to be integrated with synchronized intelligence via the Internet of Things (IoT) is truly amazing. Mobile and smart devices can now leverage this intelligence instantaneously with consumers and students via personalized cloud services. This emergence of intelligence illuminates the reality that life, interests, work, education and learning will accelerate all human experience. It also means the taste and desire for pure intelligence, which makes life better for individual consumers will be paramount over analytics. ORU’s Wearable Initiative in the Washington Post. Consideration #2 – The transformation from BYOD to WYOC brings intelligence everywhere BYOD, known as Bring-Your-Own-Device was a strategy that helped sell more consumer parts and devices, while ushering in the era of analytics to understand the buying trends of device owners. Consumers are currently multiplying their personal cloud services such as iCloud, iTunes, etc. and bringing their own ‘cloud services’ to work, school, and play. As the strategy changes and consumers are allowed to ‘Bring-Your-Own-Cloud’ services, they will ultimately design and personalize the experience they need to do life, education, and work. This era of intelligence and design is a new era whereby, technology and applications becomes fluid, and flows like water into the nooks and crannies of life. Whereas, technology was once considered the fabric of our modern society, it will now morph into the liquid-cosmos or fluidity of life. The fluidity will change ‘Bring-Your-Own-Cloud’ to ‘Wear-Your-Own-Cloud.’ Imagine being a company trying to make a living selling analytics on devices and having to quickly change to accommodate the flow of ‘fluidity or water.’ Consideration #3 – The Death of Analytics as we know them – A lesson from the Supercomputing industry The new era with cloud computing no longer will focus on the analytics of devices or network connections by themselves. The need for analytics and big data will shift to the back room, while consumer technology will become the technology that every corporation focuses on. The consumer technology space will downplay the attention that corporations give to their ERP systems, data analytics, business intelligence, workstations, and networks. Even though all these technologies will all be needed, they will no longer be the eye-candy sold to savvy C-level executives who ultimately realizes that the consumer will rule. C-Level decision makers will be closely aligned with the place called intelligence-in-a-cloud. From 1985 to 1996 I worked for Supercomputer Manufacturer, Cray Research. It was an unbelievable time in the history of quantum computing, big data, and analytics that far surpassed the analytics and big data that is finally being talked about today. The issue was that not everyone could afford the multi-million dollar supercomputer. The problem extended even further when the corporate marketplace wanted analytics and big data but could not buy a Cray Supercomputer. The marketplace changed, and it changed quickly. Ironically, the supercomputer market is still very strong from a financial standpoint, and Cray Research is still alive and well. However, it is not the ‘eye-candy’ and ‘must-have’ or even ‘must-need’ technology that it once was. Technology advanced into the hands of thousands of companies who could produce smaller, faster, and more corporate computing systems that allowed a new kind of eye-candy. It wasn’t until 15-years ago when data analytics caught back up with the smaller systems and now everyone is packaging various flavors of data analytics and business intelligence. Unfortunately, just as supercomputers moved to the backroom and were no longer sexy, so will data analytics and big data, as the equivalent power of the supercomputer is now in the wearable and mobile technology consumer space. A few short years ago (2012) I shared a video on the two computing miracles I will witness in my lifetime. One of them happened back in 1996 when the supercomputer moved to the less sexy backroom of society. In this video I also predict the same quickly ‘move-to-the-back’ room of ERP and SIS systems while students begin to wear and carry the same capability on their hands. The video, which can be viewed here, was recorded at the 2012 Global IMS Learning Consortium in Toronto. The time for the second miracle has arrived. Consideration #4 – Why will consumers get to the “Place Called Intelligence” first On one hand, most companies selling software services with all the nice titles of SaaS, IaaS, Cloud-based, managed services, professional services, enterprise software, learning technologies, analytics, and business intelligence, etc. all have two things in common. On the other hand most consumers who invest in personal technology also have two very different things in common. Most company’s hierarchy of needs, or top two things they have in common, include 1). Making a profit, and 2). Helping the companies they sell to, (who help them make a profit) be more competitive against their competition. The profitability for most companies is proportionate to their ability to help each company they sell to — compete against one another. Most consumers’ hierarchy of technology needs includes: 1). Does it make me look or feel ‘Cool’? 2). Does it improve my life, work, play, or education? 3). Is it affordable? The two varying laws of hierarchy are vastly different and will be the reason that consumers will get to the ‘Place-Called-Intelligence-in-the-cloud’ quicker than a tech company. Consumers are far more motivated to improve their life with intelligent use of emergent technology. In a design society the Internet of Things (IOT) will become the Internet of Me (IoM). Summary The current era whereby consumer products come with 1) built-in intelligence, 2) is fun to experiment with, and 3) is cool to wear will motivate consumers and each other to be far more creative than companies can afford to be. In essence, this era would be a classification of ‘Crowd-Sourcing’ with an accelerated engine. Possibly, we may know this era in the future as ‘Consumer-Sourcing’. I actually hope that I am wrong, and that it will be technical companies who arrive at the place called “Intelligence-in-the-Cloud,” and sell out of the box intelligence, rather than mere analytics. Michael L. Mathews Chief Information Officer, Oral Roberts University LEAVE A REPLY Lemon Hotel - Dreux Chartres 7 Rue Des Livraindiaires Dreux, France 28100 View Large Map Phone: +33 2-3762-0822 Commission Rooms Rates - - $34 Hoteliers! Is your information accurate? Update Here Overview • Details • Check in Time: 12:00 PM • Check out Time: 10:00 AM Lemon Hotel - Dreux Chartres Rates & Policies • Rate Policy: Daily in USD • Standard Room: from $34 • Credit Cards: Credit Cards Are Accepted • Reservation Policy: Reservations must be guaranteed with a credit card • Included Meals: No Meals Included Lemon Hotel - Dreux Chartres Room Amenities Amenities are in all rooms unless noted otherwise. • Microwave Oven • Internet Access (Wireless) Lemon Hotel - Dreux Chartres Hotel Services & Facilities • Guest Services • Wheelchair Access to Common/Public Areas JDS Travel News JDS Viewpoints JDS Africa/MI	# A Placed Called Intelligence-in-the-Cloud I was given the pleasure of speaking at one of the U.K.’s leading strategic learning forums on the transformative needs of education in the U.S. and abroad. The title of my message was profoundly simple, yet got the attention of any chief Information officer, or technologist desiring to stay gainfully employed over the long haul. The message was called ‘A Place Called Intelligence-in-the-Cloud.’ The sub-title could also have read ‘The death of analytics as we know them.’ Data analytics have been the mystical promise by tech companies for over 15-years. During this 15-year span of time, the reality has set-in that we are an intelligent society driven by a thirst for knowledge and intelligence at the consumer level. Most C-level executives have now reached a point that they no longer believe a promise of receiving intelligence or knowledge only after they purchase and install yet one more analytic tool or application. The good news for leaders who are desperate for instantaneous intelligence is that there is a fairly clear pathway to this intelligence vs. the long winding road of implementations, big data, and more analytics. In fact, the C-level purchases of analytics will suddenly and quickly drop into the shadows of the C-level purchaser. The evidence is becoming clearer that wearable technologies, mobile technologies, and design technologies will soon allow consumers and students to merge these technologies together. The emergence will allow most savvy consumers and students to find and design their own way to success. Most importantly, access to these design technologies are already proven to be stored in cloud-based services, which individual consumers can now purchase. It is critical to note that data analytics will always be needed, but they will no longer be the eye-candy or promise that C-level executives will focus their attention toward. Consumer wearable and smart devices with built in intelligence via the cloud will cause this shift to happen quickly. This futuristic design can be viewed in concept at [http://bit.ly/2gWGSUl](http://bit.ly/2gWGSUl) Below are four considerations to validate and test the reality that a “Place Called Intelligence-In-The-Cloud” is a reachable destiny. --- ## Consideration #1 – Personal and synchronized intelligence is now available to everyone The reality that wearable technology now allows personal intelligence to be integrated with synchronized intelligence via the Internet of Things (IoT) is truly amazing. Mobile and smart devices can now leverage this intelligence instantaneously with consumers and students via personalized cloud services. This emergence of intelligence illuminates the reality that life, interests, work, education and learning will accelerate all human experience. It also means the taste and desire for pure intelligence, which makes life better for individual consumers will be paramount over analytics. ORU’s Wearable Initiative in the Washington Post. ## Consideration #2 – The transformation from BYOD to WYOC brings intelligence everywhere BYOD, known as Bring-Your-Own-Device was a strategy that helped sell more consumer parts and devices, while ushering in the era of analytics to understand the buying trends of device owners. Consumers are currently multiplying their personal cloud services such as iCloud, iTunes, etc. and bringing their own ‘cloud services’ to work, school, and play. As the strategy changes and consumers are allowed to ‘Bring-Your-Own-Cloud’ services, they will ultimately design and personalize the experience they need to do life, education, and work. This era of intelligence and design is a new era whereby, technology and applications becomes fluid, and flows like water into the nooks and crannies of life. Whereas, technology was once considered the fabric of our modern society, it will now morph into the liquid-cosmos or fluidity of life. The fluidity will change ‘Bring-Your-Own-Cloud’ to ‘Wear-Your-Own-Cloud.’ Imagine being a company trying to make a living selling analytics on devices and having to quickly change to accommodate the flow of ‘fluidity or water.’ ## Consideration #3 – The Death of Analytics as we know them – A lesson from the Supercomputing industry The new era with cloud computing no longer will focus on the analytics of devices or network connections by themselves. The need for analytics and big data will shift to the back room, while consumer technology will become the technology that every corporation focuses on. The consumer technology space will downplay the attention that corporations give to their ERP systems, data analytics, business intelligence, workstations, and networks. Even though all these technologies will all be needed, they will no longer be the eye-candy sold to savvy C-level executives who ultimately realizes that the consumer will rule. C-Level decision makers will be closely aligned with the place called intelligence-in-a-cloud. From 1985 to 1996 I worked for Supercomputer Manufacturer, Cray Research. It was an unbelievable time in the history of quantum computing, big data, and analytics that far surpassed the analytics and big data that is finally being talked about today. The issue was that not everyone could afford the multi-million dollar supercomputer. The problem extended even further when the corporate marketplace wanted analytics and big data but could not buy a Cray Supercomputer. The marketplace changed, and it changed quickly. Ironically, the supercomputer market is still very strong from a financial standpoint, and Cray Research is still alive and well. However, it is not the ‘eye-candy’ and ‘must-have’ or even ‘must-need’ technology that it once was. Technology advanced into the hands of thousands of companies who could produce smaller, faster, and more corporate computing systems that allowed a new kind of eye-candy. It wasn’t until 15-years ago when data analytics caught back up with the smaller systems and now everyone is packaging various flavors of data analytics and business intelligence. Unfortunately, just as supercomputers moved to the backroom and were no longer sexy, so will data analytics and big data, as the equivalent power of the supercomputer is now in the wearable and mobile technology consumer space. A few short years ago (2012) I shared a video on the two computing miracles I will witness in my lifetime. One of them happened back in 1996 when the supercomputer moved to the less sexy backroom of society. In this video I also predict the same quickly ‘move-to-the-back’ room of ERP and SIS systems while students begin to wear and carry the same capability on their hands. The video, which can be viewed here, was recorded at the 2012 Global IMS Learning Consortium in Toronto. The time for the second miracle has arrived. ## Consideration #4 – Why will consumers get to the “Place Called Intelligence” first On one hand, most companies selling software services with all the nice titles of SaaS, IaaS, Cloud-based, managed services, professional services, enterprise software, learning technologies, analytics, and business intelligence, etc. all have two things in common. On the other hand most consumers who invest in personal technology also have two very different things in common. Most company’s hierarchy of needs, or top two things they have in common, include 1. Making a profit, and 2. Helping the companies they sell to, (who help them make a profit) be more competitive against their competition. The profitability for most companies is proportionate to their ability to help each company they sell to — compete against one another. Most consumers’ hierarchy of technology needs includes: 1. Does it make me look or feel ‘Cool’? 2. Does it improve my life, work, play, or education? 3. Is it affordable? The two varying laws of hierarchy are vastly different and will be the reason that consumers will get to the ‘Place-Called-Intelligence-in-the-cloud’ quicker than a tech company. Consumers are far more motivated to improve their life with intelligent use of emergent technology. In a design society the Internet of Things (IOT) will become the Internet of Me (IoM). --- ## Summary The current era whereby consumer products come with 1. built-in intelligence, 2. is fun to experiment with, and 3. is cool to wear will motivate consumers and each other to be far more creative than companies can afford to be. In essence, this era would be a classification of ‘Crowd-Sourcing’ with an accelerated engine. Possibly, we may know this era in the future as ‘Consumer-Sourcing’. I actually hope that I am wrong, and that it will be technical companies who arrive at the place called “Intelligence-in-the-Cloud,” and sell out of the box intelligence, rather than mere analytics. Michael L. Mathews Chief Information Officer, Oral Roberts University --- # Lemon Hotel – Dreux Chartres Address 7 Rue Des Livraindiaires Dreux, France 28100 Phone: +33 2-3762-0822 ## Overview - Check-in Time: 12:00 PM - Check-out Time: 10:00 AM ## Rates & Policies - Rate Policy: Daily in USD - Standard Room: from \$34 - Credit Cards Are Accepted - Reservations must be guaranteed with a credit card - No Meals Included ## Room Amenities - Microwave Oven - Internet Access (Wireless) ## Hotel Services & Facilities - Guest Services - Wheelchair Access to Common/Public Areas	2,001	1,919	7,868,484,084,143,332,000	concat	[ "concat_full" ]	0.75	true	null
5,494,978,040,745,035,000	Page 1 of 1 1 Topic Options #1223564 - Wed May 24 2017 10:22 PM Roger Moore dies aged 89 Lothar of The Hill People Offline brother from another mother Registered: Sun Feb 10 2002 Posts: 19098 Loc: Way back in the woods. http://www.bbc.com/news/entertainment-arts-40018422 Quote: Actor Sir Roger Moore, best known for playing James Bond, has died aged 89, his family has announced. He played the famous spy in seven Bond films including Live and Let Die and A View to a Kill. Sir Roger's family confirmed the news on Twitter, saying he had died after "a short but brave battle with cancer". The statement, from his children, read: "Thank you Pops for being you, and being so very special to so many people." "With the heaviest of hearts, we must share the awful news that our father, Sir Roger Moore, passed away today. We are all devastated," they said in a Twitter post. The actor took the character of James Bond in a more humorous direction than his predecessor Sean Connery. Sir Roger is survived by his three children and wife Kristina Tholstrup Sir Roger's Bond was calm and suave - a smooth operator who could seemingly get himself out of a tricky situation with ease. The veteran star, who died in Switzerland, will have a private funeral in Monaco in accordance with his wishes, his children said. Good. Glad he's dead. Hated that guy. \:\( Don't make old people mad.We don't like being old in the first place so it doesn't take much to piss us off! "Well,whenever I'm confused,I just check my underwear. It holds most answers to life's questions." Abe Simpson I can tell by the position of the sun in the sky, that is time for us to go. Until next time, I am Lothar of the Hill People! Top #1223579 - Fri May 26 2017 01:00 AM Re: Roger Moore dies aged 89 [Re: Lothar of The Hill People] Lothar of The Hill People Offline brother from another mother Registered: Sun Feb 10 2002 Posts: 19098 Loc: Way back in the woods. G,Roger deserves a spot on the portal page. the tag line could be Moore,Roger Moore dead at 89. Top #1223581 - Fri May 26 2017 05:47 AM Re: Roger Moore dies aged 89 [Re: Lothar of The Hill People] Wonder Boy Online content brutally Kamphausened Registered: Wed Sep 12 2001 Posts: 20173 Loc: A glorious bold new America My first Bond movie I saw in the theatre was Live and Let Die, released in 1973. With Jane Seymour as the Bond girl, and a Paul McCartney theme song, how could you possibly go wrong? Up until Raiders of the Lost Ark, it was the most outstandingly great action movie I'd ever seen. Roger Moore for me is my favorite Bond, the snobbish British gentleman. I later worked my way backward to appreciate Sean Connery in the role as well, more rugged and athletic, but for me Moore was the most effective Bond. I read somewhere that Ian Fleming liked Moore best in the role as well, that he came closest to the character Fleming portrayed in his novels. I also see (after the false start of Timothy Dalton replacing Moore for a few movies) the selection of Pierce Brosnan for the role as a return to the template established by Roger Moore. Sorry to see him go. At least he left us a lot of great movies as his legacy. Top #1223583 - Fri May 26 2017 01:06 PM Re: Roger Moore dies aged 89 [Re: Wonder Boy] K-nutreturns Offline Kneel! Registered: Wed May 25 2005 Posts: 12911 Loc: Wherever posting gods hangout My least favorite Bond but I still enjoyed a few of his outings like The spy who loved me. Class act and he will be missed big_pimp_tim-made it cool to roll in the first damn place! Mon Jun 11 2007 09:27 PM-harley finally rolled with me "I'm working with him...he's young but, there is much potential. He can apprentice with me and then he's yours for final training. He will remember the face of his father... Some day, Knutreturns just may be the greatest of us all...."-THE bastard Top #1223585 - Fri May 26 2017 03:41 PM Re: Roger Moore dies aged 89 [Re: Lothar of The Hill People] the G-man Offline Officially "too old for this shit" Registered: Fri May 16 2003 Posts: 43552 Loc: the right Originally Posted By: Lothar of The Hill People G,Roger deserves a spot on the portal page.... Top #1223586 - Fri May 26 2017 10:53 PM Re: Roger Moore dies aged 89 [Re: the G-man] Lothar of The Hill People Offline brother from another mother Registered: Sun Feb 10 2002 Posts: 19098 Loc: Way back in the woods. LOL! You ornery fucker! Top #1223590 - Sat May 27 2017 10:40 AM Re: Roger Moore dies aged 89 [Re: Lothar of The Hill People] Wonder Boy Online content brutally Kamphausened Registered: Wed Sep 12 2001 Posts: 20173 Loc: A glorious bold new America \:lol\: Top #1224896 - Mon Jan 15 2018 10:39 PM Re: Roger Moore dies aged 89 [Re: Wonder Boy] Wonder Boy Online content brutally Kamphausened Registered: Wed Sep 12 2001 Posts: 20173 Loc: A glorious bold new America From the end of Moonraker, Bond and the girl cuddle affectionately floating in zero gravity in their spaceship, returning to Earth. Floating naked, except for a sheet that discreetly drifts in zero gravity to cover anything that would exceed a PG rating. From the ground at MI-6 headquarters, "M" and other higher-ups of British intelligence watch them on a monitor camera. BRITISH INTELLIGENCE OFFICER: "I say, what is he doing?" 2nd INTELLIGENCE OFFICER: "I think he's attempting re-entry!" Top Page 1 of 1 1 Hop to: October Su M Tu W Th F Sa 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 Forum Stats 3019 Members 14 Forums 65669 Topics 1189804 Posts Max Online: 1242 @ Thu Mar 31 2016 02:41 PM New Topics Elijah Cummings , dead at 68 by Wonder Boy Fort Worth officer shoots woman, quits, and is immediately arrested by Wonder Boy New Ghost Rider series by Lothar of The Hill People Donald Trump is Isis's employee of the month by Matter-eater Man Contagion by Lothar of The Hill People Impeaching Trump by Matter-eater Man Canadian comic books, writers, artists, and stories by Wonder Boy Marvel Graphic Novel series, 1981-1992 by Wonder Boy Comics fighting Nazis, and comics where Adolf Hitler gets killed off by Wonder Boy Trump's idea to purchase Greenland from Denmark. No, seriously. by Wonder Boy Level credit card processing requirements işler Filtre Son aramalarım Şuna göre filtrele: Bütçe ile ile ile Tür Beceri Diller İş Durumu 375,139 level credit card processing requirements iş bulundu, ücretlendirmeleri EUR If you love to write and can write grammatically correct native level English do ping back with few samples. I pay $0.7 CAD per 100 words. Long term work possible. Commitment to quality and deadlines a must, please. Different niche, from simple tech to marijuana! NO PLAGIARIZING and Commitment to deadlines is a must. €3 / hr (Avg Bid) €3 / hr Ortalama Teklif 8 teklifler Need A web developer 6 gün left ONAYLI I need an expert web developer to build a new website for me based on my existing wordpress website. The website is a news website and also membership website for both paid and free members. It also embedded affiliate program where members were commission for referring new members. There is payment integration on registration page for paid members. Paid members can also use coupon instead of card ... €506 (Avg Bid) €506 Ortalama Teklif 109 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Trophy icon Design a Logo 6 gün left I need a logo designed for a company called Dr. Spice. I really want the logo I have attached to be elevated to the next level. The logo needs to be bold and speak to the audience. We represent and promote health, bold flavor, for the general public and fitness community. The starting logo was originally drawn as a pepper with glasses to symbolize education and the logo in cursive to represent the... €91 (Avg Bid) Garantili €91 99 girdi Website with database 6 gün left ONAYLI RFP For Website Deadline: the basic of the site need to be done by November 15th. The rest of the site needs to be done by December 1st. This is a financial business so the website needs to look professional and easy to navigate. All info will need to be able to be exported in an excel file and also automatically backed up periodically. The website will also need to be mobile ... €682 (Avg Bid) €682 Ortalama Teklif 78 teklifler I have a logo for my womens football team in Austin TX, and the original art file (i.e. only art file I have) is a very low resolution. It's so old vendor are no longer accepting it! I want to be clear - i do NOT want to change the logo - I just need it duplicated, but with a much higher and more modern level of resolution. Additionally, my team is celebrating it's 20th season this year ... €45 (Avg Bid) Garantili Mühürlü €45 5 girdi Copy Typing 6 gün left • This is a Sample Project to help you understand the concept of the work. • You are required to type the exact text from the left box to the blank box at the right. • The size of the text should be 8-10 and theme should be ‘Arial’ or ‘Times New Roman’. • The accuracy level to be maintained is >90%. Payment per page depends on the plan chosen. • ... €9 / hr (Avg Bid) €9 / hr Ortalama Teklif 84 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Requirements: Ability to work with word processing (Microsoft Word) Literacy Attentiveness Experience in writing texts of different subjects would be a plus In your responsibilities will include: writing and processing of the material (using a text editor) any subject with format jpg files. and png. (Ie, images) in the .docx format. €316 (Avg Bid) €316 Ortalama Teklif 40 teklifler IT Service Quality Manager \| Digital Inspirational and life enhancing company vision Join a hands-on, collaborative, customer-focused leadership tea Prior experience in ITSM and ITIL certified essential About the Business Impressive digital transformation trajectory with a strong customer-service focus; and The role reports to the Chief Digital Officer. Duties Develop and embed a Centre of Exce... €36 / hr (Avg Bid) €36 / hr Ortalama Teklif 8 teklifler Cafe business/coffee cards We need a card created which will have 2 sides to it. On the front we need a logo created with the cafe name “Agora On Pitt” we would like the focus to be on “Agora” and “On Pitt” written smaller underneath. On the back we would like a coffee loyalty card created with our cafe details written small somewhere as well. We would like t... €92 (Avg Bid) €92 65 girdi This project is system admin and data processing . I need someone who can help me and have many experience in this field. data amount is big, it needs fast speed up for data processing €121 (Avg Bid) €121 Ortalama Teklif 12 teklifler Seeking a self-motivated individual who can provide a high-level of assistance. Candidate must possess cognitive thinking skills and ability to retain process and information Must be self-starter who is able to toggle back and forth from systems and tasks. Candidate must have a positive attitude and willingness to learn. €30 / hr (Avg Bid) €30 / hr Ortalama Teklif 22 teklifler Seeking a self-motivated individual who can provide a high-level of assistance. Candidate must possess cognitive thinking skills and ability to retain process and information Must be self-starter who is able to toggle back and forth from systems and tasks. Candidate must have a positive attitude and willingness to learn. Job tasks include but are not limited to €17 / hr (Avg Bid) €17 / hr Ortalama Teklif 29 teklifler Seeking a self-motivated individual who can provide a high-level of assistance. Candidate must possess cognitive thinking skills and ability to retain process and information Must be self-starter who is able to toggle back and forth from systems and tasks. Candidate must have a positive attitude and willingness to learn. Job tasks include but are not limited to: €18 / hr (Avg Bid) €18 / hr Ortalama Teklif 27 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Small project and report 6 gün left ONAYLI I want an expert in service-oriented software engineering and business process modeling. The expert must be a professional English writer and able to investigate the research on this field . The expert must be familiar with the concept Busniess Processing Modeling and Notation (BPMN). €69 (Avg Bid) €69 Ortalama Teklif 35 teklifler Prepare a File to send to ZOO Printers, for Fold-Over-Business Cards I've designed/laid-out. Need PS proficient Pixel-Pusher, along with InDesign to Add Typography to finish . Older version/as an example/of my previous Fold-Over Business Card.... [URL'yi görüntülemek için giriş yapın] & [URL'yi görüntülemek için giriş yapın] €17 / hr (Avg Bid) €17 / hr Ortalama Teklif 25 teklifler Data Entry rep 6 gün left We'er seeking a self-motivated individual who can provide a high-level of assistance. Its important that you have a good understanding about technology companies and can quickly identify what they are, and what they do. Must be self-starter who is able to toggle back and forth from systems and tasks. Candidate must have a positive attitude and willingness to learn. Job tasks include but a... €393 (Avg Bid) €393 Ortalama Teklif 26 teklifler Looking for someone who is skilled in the language Python and can help complete a few functions for me. The code must not be super advanced. Try to keep the the code at entry level code €23 (Avg Bid) €23 Ortalama Teklif 12 teklifler Subscription develope 6 gün left ONAYLI Make payment reoccurring monthly payments with a cancellation of 30 days. Monthly payment processing. Recapatcha to be added to both contact form and registration form. Sandbox should be linked to main email account. Simple project. €13 (Avg Bid) €13 Ortalama Teklif 7 teklifler Pull up banners 6 gün left ONAYLI We have 3 products that we want to advertise via Pull up banner ... These banners has to be festive season themed, using our products. 1. Cinema App 2. Cinema Vouchers 3. Movie Money Card (MMC) These pull up banners will be advertised during Diwali and Christmas season, so its needs to be a generic festive advertising. €74 (Avg Bid) €74 Ortalama Teklif 55 teklifler I need a business card Detroit for a collision shop I have existing cards but need to change a few things I want a nice design something different would like to incorporate the city of Detroit in the background I have some sample of my original cards. It is a professional business so I want a professional design please!! The name needs to be changed to “all American collision experts &ldqu... €63 (Avg Bid) €63 Ortalama Teklif 49 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler Creatick household is in need of a virtual assistant to represent and work virtually for the gallery in handling customers services,invoice,data entry and also data processing .Biding freelancers should have an excellent customer service and must be outcome-oriented. The gallery needs an assistant that will help manage its data entry,customer,Ed services,reply to emails,handle data processin... €272 (Avg Bid) €272 Ortalama Teklif 1 teklifler You will need to be familiar with wordpress, stripe integration and recurring payments. We have a project that involves a wordpress dashboard and stripe processes payments and provides all merchant onboarding and credit card transactions. The frontend is wordpress that allows merchants to create a campaign to collect payments and see who has made payments on a wordpress dashboard. The problem w... €190 (Avg Bid) €190 Ortalama Teklif 32 teklifler Hello [URL'yi görüntülemek için giriş yapın], I'm a tunisian engineering student, I found your profile on Freelancer.com and I wanted to ask your about the procedure on how to make a freelancer account, how to handle the payment in Tunisia and which credit cards are accepted ?Thank you sir. €227 (Avg Bid) €227 Ortalama Teklif 1 teklifler small Android app 6 gün left ONAYLI The task is creating Android app of a slight, educational game. requirements : -Pleasant, clear, intuitive and convenient UI -Localization for Hebrew and English languages -Using XML shapes -Multiple screens and transferring information -Animation and music -Using the right-context menus (to ease the use) -Using custom layouts -List-view to save the record table -Any action that requires p... €267 (Avg Bid) €267 Ortalama Teklif 29 teklifler RESEARCH PAYMENT GATEWAY 6 gün left ONAYLI i need any one can find me payment gateway to start accepting money trough credit card on my eCommerce store using magento by the way my store selling replica items so that is not allowed to provide this service from many payment gateway company. €384 (Avg Bid) €384 Ortalama Teklif 30 teklifler Hello, I require a payment plugin to be created for [URL'yi görüntülemek için giriş yapın] for the PHP Billing Script aMember ( [URL'yi görüntülemek için giriş yapın]) I can provide FTP/Mysql Login details to allow you to create and develop the script. (If necessary, I would prefer not to this however) Requirements of my plugin - To accept... €190 (Avg Bid) €190 Ortalama Teklif 19 teklifler DESCRIPTION: We have an immediate need for a long-term data entry specialist. Data will be entered between midnight and 7:00AM CST. Data is sourced from specific website and pdf documents. Extraction and input methodology are flexible however python-based scraping and nlp are preferred. See candidate requirements below REQUIREMENTS: • Self-starter • Detail oriented (99% accuracy is requ... €30 / hr (Avg Bid) €30 / hr Ortalama Teklif 15 teklifler our developer is able to integrate stripe with application written in .net mvc. we are able to add new credit card and get token as well. even buy through stripe is also working on local but after deplyoyment it not works and give object reference no found. €58 (Avg Bid) €58 Ortalama Teklif 14 teklifler We would like to make several videos: promotional and informational for facebook/youtube ads for our company, which is a company for educating and training next level ice hockey goalies (Goal tenders). Looking for local Canadian talent in Ontario ideally. $12 - $18 CAD per hour depending on several factors such as skill level etc. (removed by site admin) €19 / hr (Avg Bid) Yerel €19 / hr Ortalama Teklif 1 teklifler Hi there regard my website seo need SEO optimized landing pages for improve level in google €106 (Avg Bid) €106 Ortalama Teklif 89 teklifler I need an android app that is identical to one of my iOS apps, In order to work on this project you need to know: 1) How to develop simple video creation related apps (without the usage of FFmpeg library!) 2) How to work with In App Billings 3) How to work with Images 4) How to create android ui designs based on already made iOS design 5) Good Java expertise, Please send a proof of a good code of ... €256 (Avg Bid) €256 Ortalama Teklif 32 teklifler This is a type of data entry whereby you will be required to have basic entry level task conducted €29 / hr (Avg Bid) €29 / hr Ortalama Teklif 60 teklifler	# Roger Moore dies aged 89 Thread started by Lothar of The Hill People on Wed May 24 2017 10:22 PM > Actor Sir Roger Moore, best known for playing James Bond, has died aged 89, his family has announced. > > He played the famous spy in seven Bond films including Live and Let Die and A View to a Kill. > > Sir Roger's family confirmed the news on Twitter, saying he had died after "a short but brave battle with cancer". > > The statement, from his children, read: "Thank you Pops for being you, and being so very special to so many people." > "With the heaviest of hearts, we must share the awful news that our father, Sir Roger Moore, passed away today. We are all devastated," they said in a Twitter post. > > The actor took the character of James Bond in a more humorous direction than his predecessor Sean Connery. > > Sir Roger is survived by his three children and wife Kristina Tholstrup. > > Sir Roger's Bond was calm and suave—a smooth operator who could seemingly get himself out of a tricky situation with ease. > > The veteran star, who died in Switzerland, will have a private funeral in Monaco in accordance with his wishes, his children said. Good. Glad he's dead. Hated that guy. :( “Don't make old people mad. We don't like being old in the first place so it doesn't take much to piss us off!” “Well, whenever I'm confused, I just check my underwear. It holds most answers to life's questions.” — Abe Simpson I can tell by the position of the sun in the sky, that is time for us to go. Until next time, I am Lothar of the Hill People! --- ### Lothar of The Hill People Fri May 26 2017 01:00 AM G, Roger deserves a spot on the portal page. the tag line could be Moore, Roger Moore dead at 89. --- ### Wonder Boy Fri May 26 2017 05:47 AM My first Bond movie I saw in the theatre was Live and Let Die, released in 1973. With Jane Seymour as the Bond girl, and a Paul McCartney theme song, how could you possibly go wrong? Up until Raiders of the Lost Ark, it was the most outstandingly great action movie I'd ever seen. Roger Moore for me is my favorite Bond, the snobbish British gentleman. I later worked my way backward to appreciate Sean Connery in the role as well, more rugged and athletic, but for me Moore was the most effective Bond. I read somewhere that Ian Fleming liked Moore best in the role as well, that he came closest to the character Fleming portrayed in his novels. I also see (after the false start of Timothy Dalton replacing Moore for a few movies) the selection of Pierce Brosnan for the role as a return to the template established by Roger Moore. Sorry to see him go. At least he left us a lot of great movies as his legacy. --- ### K-nutreturns Fri May 26 2017 01:06 PM My least favorite Bond but I still enjoyed a few of his outings like The Spy Who Loved Me. Class act and he will be missed. --- ### the G-man Fri May 26 2017 03:41 PM > G, Roger deserves a spot on the portal page…. --- ### Lothar of The Hill People Fri May 26 2017 10:53 PM LOL! You ornery fucker! --- ### Wonder Boy Sat May 27 2017 10:40 AM \:lol\: --- ### Wonder Boy Mon Jan 15 2018 10:39 PM From the end of Moonraker, Bond and the girl cuddle affectionately floating in zero gravity in their spaceship, returning to Earth. Floating naked, except for a sheet that discreetly drifts in zero gravity to cover anything that would exceed a PG rating. From the ground at MI-6 headquarters, “M” and other higher-ups of British intelligence watch them on a monitor camera. BRITISH INTELLIGENCE OFFICER: “I say, what is he doing?” 2nd INTELLIGENCE OFFICER: “I think he's attempting re-entry!” --- # Level credit card processing requirements işler ## If you love to write and can write grammatically correct native level English Do ping back with few samples. I pay \$0.7 CAD per 100 words. Long term work possible. Commitment to quality and deadlines a must. Different niche, from simple tech to marijuana! NO PLAGIARIZING and commitment to deadlines is a must. --- ## Need a web developer I need an expert web developer to build a new website for me based on my existing WordPress website. The website is a news site and a membership site (free & paid). It also embeds an affiliate program where members earn commission for referrals. Payment integration on the registration page for paid members; paid members can also use coupons. --- ## Virtual assistant for Creatick household Creatick household needs a virtual assistant to handle customer service, invoices, data entry, and data processing for an art gallery. Excellent customer-service skills and an outcome-oriented mindset required. Responsibilities include managing data entry, customer inquiries, emails, and data processing. --- ## Trophy icon: Design a Logo Design a bold, eye-catching logo for “Dr. Spice.” The original concept is a pepper with glasses (education) and cursive text. The brand promotes health and bold flavor to the general public and fitness community. --- ## Website with database RFP: professional, easy-to-navigate financial website. - Basic site by Nov 15; full site by Dec 1 - Exportable to Excel & automated backups - Mobile-friendly --- ## Logo duplication: Women’s football team Original low-res logo needs reproduction at high resolution. No design changes—just vectorize/modernize. The team in Austin TX celebrates its 20th season. --- ## Copy Typing Sample project: type exact text from left box into right box using Arial or Times New Roman (size 8–10). Accuracy > 90%. Payment per page based on plan chosen. --- ## Writing & processing material Requirements: Microsoft Word, attention to detail, literacy. Responsibilities: convert JPG/PNG images into .docx text on any subject. Experience across niches is a plus. --- ## IT Service Quality Manager Join a hands-on, collaborative leadership team. Customer-focused, ITSM experience, ITIL certification required. Report to Chief Digital Officer. Duties: develop & embed a Centre of Excellence. --- ## Cafe business / Coffee cards Design a two-sided card: - Front: logo for “Agora On Pitt” (emphasize “Agora”) - Back: coffee loyalty card + cafe details --- ## System admin & data processing Large-scale data processing project. Requires strong system-admin skills and fast turnaround. --- ## Self-motivated virtual assistant High-level assistance for tech-company research. Must toggle between systems, retain complex info, and have a positive attitude. Tasks vary. --- ## Small project & report Require expert in service-oriented software engineering and Business Process Modeling and Notation (BPMN). Must be a professional English writer familiar with BPMN research. --- ## Fold-Over Business Cards prep Prepare print-ready files (Photoshop & InDesign) for fold-over business cards for ZOO Printers. Add typography to existing layouts. --- ## Data Entry rep Understand technology companies quickly. Toggle between systems and tasks. Positive attitude and willingness to learn. Provide high-level administrative assistance. --- ## Python functions Looking for someone skilled in Python to implement a few entry-level functions. --- ## Subscription developer Implement recurring monthly payments with 30-day cancellation. Add reCAPTCHA to contact & registration forms. Sandbox linked to main email. Simple project. --- ## Pull-up banners Create 3 festive-themed pull-up banners for Diwali & Christmas: 1. Cinema App 2. Cinema Vouchers 3. Movie Money Card (MMC) --- ## Business card design: Detroit collision shop Redesign a professional business card for “All American Collision Experts.” Incorporate Detroit skyline in the background. --- ## WordPress + Stripe integration issue A WordPress dashboard uses Stripe for merchant onboarding & recurring payments. Works locally but fails on deployment (“object reference not found”). --- ## Magento payment gateway research Find a payment gateway compatible with Magento that accepts replica‐item sales via credit card. --- ## Payment plugin for aMember Develop a payment plugin for aMember (PHP billing script) to accept credit-card payments. FTP/MySQL access can be provided. --- ## Data entry specialist (night shift) Long-term data entry (midnight–7 AM CST) from websites & PDFs. Python scraping & NLP experience preferred. --- ## Stripe integration in .NET MVC Local Stripe integration works (add cards, tokens, purchases). Post-deployment, it errors with “object reference not found.” --- ## Video production: ice-hockey goalie training Produce promotional & informational videos for Facebook/YouTube ads. Content for next-level ice hockey goalie training. Local Ontario, Canada talent preferred. \$12–18 CAD/hr. --- ## SEO optimized landing pages Need SEO-optimized landing pages to improve Google ranking. --- ## Android app port from iOS Recreate an iOS video-creation app in Android without FFmpeg. - In-app billing - Image handling - UI matching existing iOS design - XML shapes, custom layouts, list-view record table - Animation & music - Hebrew & English localization --- ## General data-entry tasks Basic entry-level data-entry work.	6,185	2,049	5,494,978,040,745,035,000	concat	[ "concat_full" ]	0.75	true	null
4,284,250,323,441,054,000	Indie game storeFree gamesFun gamesHorror games Game developmentAssetsComics SalesBundles Jobs Filter Results (Clear) Tags Animals Includes or is about animals Suggest updated description Top rated$15 or less with color-blind support tagged Animals (1 result) Explore games with color-blind support tagged Animals on itch.io · Sell your games with color-blind support on itch.io to have them show up here. Break Ya Claws - A head to head crab fighting game! (1) Fighting 2015 21st Century Automotive Challenge Overall Scoring Cory Rideout Vectrix EV Motorcycle 1st Place PLL1-2 830 Ken Barbour Nissan LEAF 1st Place PLH3-5 830 Methacton HS Lomax EV 1st Place ILL1-2 795 Dan Monroe Nissan LEAF 2nd Place PLH3-5 787 Jurgen Balitzky Tesla Model S 60 3rd Place PLH3-5 776 Jonathan Bartlett VW Beetle Biodiesel 1st Place ILH3-5 772 Penn College Pontiac Fiero EV 2nd Place ILL1-2 714 Alan Arrison Chevy S-10 EV 1st Place ILH1-2 689 Denny Stichter Ford Ranger EV 3rd Place ILL1-2 682 Ed Kreibick VW Jetta Biodiesel 2nd Place ILH3-5 639 James Natale Toyota Prius V-AT PLH3-5 600 Denys Kelly Toyota Prius c PLH3-5 570 Paul Kydd F-150 Hybrid 1st Place ILL3-5 430 Denys, the Kreibecks, Cory & Jim at the Nittany Lion & the garage. Local Errands Jonathan's biodiesel Beetle Dan & Ken's LEAFs & Al's S-10 Denys' Prius c at CPI Jim's 2010 Prius V-AT at CPI Methacton's Lorax at CPI Electric bus charging at Larson Test Track Eastern Electric Vehicle Club 2015 EEVC Top Guns Ken Barbour 2015 Eugene Lemieux Award Ken Barbour Autocross Jurgen Balitzky Best EV Range James Natale Best non-EV Range Paul Kydd Most Cargo Please Click the links above 2015 21st Century Automotive Challenge Autocross Results Gasoline Best Time Penn State Formula SAE 50.603 Tim BMW 54.304 Penn State Subaru WRX 55.008 Electric Ken 2015 Nissan LEAF 57.805 Dan Nissan LEAF 59.191 Al Chevrolet S-10 62.371 Penn College Pontiac Fiero 65.160 Jurgen Tesla Model S 67.397 Cory Vectrix 73.743 Methacton Lorax 92.642 Biodiesel Jonathan Volkswagen Beetle 54.186 Ed Volkswagen Jetta 66.416 Gas-electric Hybrid Jesse Toyota Prius 73.608 Jim 2010 Toyota Prius V-AT 74.451 Denys Toyota Prius c 77.991 Dan, the Stichters, Al & Ken at the garage The Road Home Dan & Denys--Did Dan hit up Meyer's Dairy for an ice cream CONE? Jim & his Prius Autocross A visiting member's Insight or this is what happens when you put a Prius in a dryer Tour de Thor Errand--Meyer's Dairy On display at the Morning Star home Denys, the Kreibecks & Jim at Fisherman's Paradise Jurgen's Model S hanging with the liquid fuelled The line up at the Morning Star Home Ken's LEAF on display	# Filter Results Tags - Animals: Includes or is about animals Results (1) - Break Ya Claws – A head to head crab fighting game! Genre: Fighting --- # 2015 21st Century Automotive Challenge ## Overall Scoring \| Competitor \| Vehicle \| Place \| Class \| Score \| \|----------------------\|-----------------------------\|------------\|---------\|------:\| \| Cory Rideout \| Vectrix EV Motorcycle \| 1st Place \| PLL1-2 \| 830 \| \| Ken Barbour \| Nissan LEAF \| 1st Place \| PLH3-5 \| 830 \| \| Methacton HS \| Lomax EV \| 1st Place \| ILL1-2 \| 795 \| \| Dan Monroe \| Nissan LEAF \| 2nd Place \| PLH3-5 \| 787 \| \| Jurgen Balitzky \| Tesla Model S 60 \| 3rd Place \| PLH3-5 \| 776 \| \| Jonathan Bartlett \| VW Beetle Biodiesel \| 1st Place \| ILH3-5 \| 772 \| \| Penn College \| Pontiac Fiero EV \| 2nd Place \| ILL1-2 \| 714 \| \| Alan Arrison \| Chevy S-10 EV \| 1st Place \| ILH1-2 \| 689 \| \| Denny Stichter \| Ford Ranger EV \| 3rd Place \| ILL1-2 \| 682 \| \| Ed Kreibick \| VW Jetta Biodiesel \| 2nd Place \| ILH3-5 \| 639 \| \| James Natale \| Toyota Prius V-AT \| \| PLH3-5 \| 600 \| \| Denys Kelly \| Toyota Prius c \| \| PLH3-5 \| 570 \| \| Paul Kydd \| F-150 Hybrid \| 1st Place \| ILL3-5 \| 430 \| --- ## EEVC Top Guns Awards - Ken Barbour – 2015 Eugene Lemieux Award - Ken Barbour – Autocross - Jurgen Balitzky – Best EV Range - James Natale – Best non-EV Range - Paul Kydd – Most Cargo --- ## Autocross Results ### Gasoline \| Entrant \| Best Time (s) \| \|---------------------------------\|--------------:\| \| Penn State Formula SAE \| 50.603 \| \| Tim – BMW \| 54.304 \| \| Penn State Subaru WRX \| 55.008 \| ### Electric \| Entrant \| Best Time (s) \| \|---------------------------------\|--------------:\| \| Ken – 2015 Nissan LEAF \| 57.805 \| \| Dan – Nissan LEAF \| 59.191 \| \| Al – Chevrolet S-10 \| 62.371 \| \| Penn College – Pontiac Fiero \| 65.160 \| \| Jurgen – Tesla Model S \| 67.397 \| \| Cory – Vectrix \| 73.743 \| \| Methacton – Lorax \| 92.642 \| ### Biodiesel \| Entrant \| Best Time (s) \| \|---------------------------------\|--------------:\| \| Jonathan – Volkswagen Beetle \| 54.186 \| \| Ed – Volkswagen Jetta \| 66.416 \| ### Gas-electric Hybrid \| Entrant \| Best Time (s) \| \|---------------------------------\|--------------:\| \| Jesse – Toyota Prius \| 73.608 \| \| Jim – 2010 Toyota Prius V-AT \| 74.451 \| \| Denys – Toyota Prius c \| 77.991 \|	981	739	4,284,250,323,441,054,000	concat	[ "concat_full" ]	0.75	true	null
-3,353,505,723,183,011,000	This site will work and look better in a browser that supports web standards, but it is accessible to any browser or Internet device. Whedonesque - a community weblog about Joss Whedon "Pain. Death. Apocalypse. None of it fun." 11976 members \| you are not logged in \| 17 October 2019 Tweet AnonymousAnimus's profile Member since: 17 February 2010 AnonymousAnimus has posted 31 links and 125 comments to WHEDONesque. Nickname: AnonymousAnimus Name: Logan Gray Email: Recent comments by AnonymousAnimus posted on... in reply to... 26/04/2013 18:08 CET 30884. How Agent Coulson returns from the dead? 17/04/2013 21:46 CET 30820. Jane Espenson thinks Amy Acker could play the Doctor. 09/04/2013 14:07 CET 30766. Will Black Panther join The Avengers? 07/04/2013 03:11 CET 30755. S.H.I.E.L.D. pilot kept under lock and key. 06/04/2013 14:40 CET 30751. S.H.I.E.L.D. gets new title, synopsis. 19/03/2013 03:09 CET 30641. Jean-Claude Van Damme wants to star in Avengers 2. 16/03/2013 13:24 CET 30622. Much Ado About Nothing panel at this month's WonderCon. 13/03/2013 14:19 CET 30606. Jeremy Jahns reviews Firefly. 11/03/2013 06:56 CET 30584. Joss Whedon's Shakespearean road trip for 'Much Ado'. 09/03/2013 17:48 CET 30578. Joss Whedon tells SXSW crowd how he'll bring Coulson back from the dead. 09/03/2013 17:43 CET 30578. Joss Whedon tells SXSW crowd how he'll bring Coulson back from the dead. 07/03/2013 18:49 CET 30565. 'Much Ado About Nothing' looks like a pretty fun party at Joss Whedon's place. 05/03/2013 16:02 CET 30546. Sam Raimi on Joss Whedon. 05/02/2013 09:23 CET 30398. R.I.P. Robin Sachs. 30/01/2013 17:44 CET 30367. How I Met Your Mother will end next season. 29/01/2013 03:25 CET 30356. Joss Whedon to receive honorary degree from Wesleyan University . 17/01/2013 15:31 CET 30301. The Trio, together again! 15/01/2013 18:07 CET 30284. Neil Patrick Harris gets abducted 14/01/2013 19:22 CET 30282. Joss Whedon nominated in the YOUreviewers Awards 01/01/2013 15:22 CET 30207. Japanese poster for The Cabin in the Woods. joss speaks back home back home back home back home back home All posts tagged: art artist Camille Allen I love miniatures. I love looking into dollhouses and seeing teeny tiny things. I am a nurse but originally went for dental hygiene. As odd as it may seem, I wanted to be a dental hygienist so I could work with those tools in a small space like the mouth. I’ve asked my dentist for old scalers so I can have them at home. (Tim uses them for sculpting). They were sterilized, by the way! I have one in the junk drawer and I love having to take it out because I need to get into some tiny area or crevice. Another odd thing is that I have had dreams since as far back as I can remember and still to this day about having miniature people and animals. I liked Gulliver’s Travels and The Indian in the Cupboard very much. I also love detail. I love Alice in Wonderland because there was so much to look at and think about. This artist, Camille Allen, sculpts these teeny tiny baby “dolls” which, to me, are … Artist Bruce Metcalf Bruce Metclaf is a jewlery maker/metal artist/writer. The following are some of his works form the 90’s. Go to his website (below) for more recent work. I like this style the best. I think his work is curious, quirky and maybe a little disturbing. I like small artwork for some reason, miniatures, or scenes with a lot of different things going on. I believe all of these are brooches. website: http://www.brucemetcalf.com/index.htmlblog: blog: http://www.brucemetcalf.com/blog/index.php Pewter Peanut with box. Souther Salazar Do You know the work of Souther Salazar? I love his tiny sculptures the best. I love his creativity and imaganation. I imagine him having fun creating these characters with detailed stories to go with each piece. Enjoy! FeeFee Slurpy Mixed media 2 1/2 x 1 1/2 x 1 1/2 inches Lightbulb Balloon (orange) Mixed media 6 x 3 x 2 inches The Day We Escaped Mixed media 3 1/2 x 3 x 6 inches Bartholomew Mixed media 4 x 3 x 3 inches A Retired Cleaner of Attics Mixed media 3 x 5 x 2 inches images from here: http://jonathanlevinegallery.com/?method=Exhibit.OpeningPhotoDetail&ExhibitID=01B23A1C-115B-5562-AAFB8563997BB1AE&idx=16 Memory of a Giant Mixed media and collage on panel 5 x 4 feet Images of Salazar is his studio from here: http://alexnoriegasketchblog.blogspot.com/2007_09_01_archive.html Salazar’s MySpace page: http://www.myspace.com/southersalazar Interview with Salazar: http://www.fecalface.com/SF/index.php?option=com_content&task=view&id=301&Itemid=92 I think this might be my favorite Salazar painting. Lastly, flickr images- these were done for the magazine Juxtapoz. T gets this magazine. It is so cool. http://www.flickr.com/photos/aliciajrose/sets/72157603991422001/ More pics of our bedroom Dressers Bed T’s artwork above our bed. (He installed the lights!) Sinks Bathroom View from my side of the bed Our recently organized closet! TV area – to either side is where we park our work bags and jackets. T’s stuff is on the left and mine is on the right My newly started nature collection that sits on top our dresser. I already had the bird feather. It is from the pigeon we raised named Paul. When we found Paul he could barely hold his head up. He was a juvenile here- He wouldn’t fly away yet. Still to come- my makeup table. I took some pictures today of our living room and dining room for another post! T’s Gift How is your Saturday going? It is in the 80’s today! T and T2 both have to work today. :( T has an art show for his students. He had an inservice yesterday. His school had an artist by the name of Junya Shao come in to talk and give a demonstration. She specializes in making tea pots. She gave each of the teachers a wonderful gift! This is the teacup made by one of her students that T received. I love the lid. Junya Shao is a famous international ceramic artist. She uses the Zisha clay (Purple clay)which is a natural product, traditional tools and slab technique to handmake her teapots. She transforms a thin paddled slab into a perfectly symmetrical form. The roots of this ancient technique date back 1000 years to the Song Dynasty. Working from the foundation, her works are contemporary expressions of own ideas about color and form. She also like to make some teapots that emulate objects of nature, creating a space for contemplation during the drinking of tea, to original purity and simplicity, to rediscover …	# Whedonesque – a community weblog about Joss Whedon “Pain. Death. Apocalypse. None of it fun.” --- ## AnonymousAnimus’s Profile - Nickname: AnonymousAnimus - Name: Logan Gray - Member since: 17 February 2010 - Activity: 31 links, 125 comments --- ## Recent Comments by AnonymousAnimus - 26/04/2013 18:08 CET – 30884. How Agent Coulson returns from the dead? - 17/04/2013 21:46 CET – 30820. Jane Espenson thinks Amy Acker could play the Doctor. - 09/04/2013 14:07 CET – 30766. Will Black Panther join The Avengers? - 07/04/2013 03:11 CET – 30755. S.H.I.E.L.D. pilot kept under lock and key. - 06/04/2013 14:40 CET – 30751. S.H.I.E.L.D. gets new title, synopsis. - 19/03/2013 03:09 CET – 30641. Jean-Claude Van Damme wants to star in Avengers 2. - 16/03/2013 13:24 CET – 30622. Much Ado About Nothing panel at this month’s WonderCon. - 13/03/2013 14:19 CET – 30606. Jeremy Jahns reviews Firefly. - 11/03/2013 06:56 CET – 30584. Joss Whedon’s Shakespearean road trip for ‘Much Ado’. - 09/03/2013 17:48 CET – 30578. Joss Whedon tells SXSW crowd how he’ll bring Coulson back from the dead. - 07/03/2013 18:49 CET – 30565. ‘Much Ado About Nothing’ looks like a pretty fun party at Joss Whedon’s place. - 05/03/2013 16:02 CET – 30546. Sam Raimi on Joss Whedon. - 05/02/2013 09:23 CET – 30398. R.I.P. Robin Sachs. - 30/01/2013 17:44 CET – 30367. How I Met Your Mother will end next season. - 29/01/2013 03:25 CET – 30356. Joss Whedon to receive honorary degree from Wesleyan University. - 17/01/2013 15:31 CET – 30301. The Trio, together again! - 15/01/2013 18:07 CET – 30284. Neil Patrick Harris gets abducted. - 14/01/2013 19:22 CET – 30282. Joss Whedon nominated in the YOUreviewers Awards. - 01/01/2013 15:22 CET – 30207. Japanese poster for The Cabin in the Woods. --- # All posts tagged: art ## Artist Camille Allen I love miniatures. I love looking into dollhouses and seeing teeny tiny things. I am a nurse but originally went for dental hygiene. As odd as it may seem, I wanted to be a dental hygienist so I could work with those tools in a small space like the mouth. I’ve asked my dentist for old scalers so I can have them at home. (Tim uses them for sculpting). They were sterilized, by the way! I have one in the junk drawer and I love having to take it out because I need to get into some tiny area or crevice. Another odd thing is that I have had dreams since as far back as I can remember and still to this day about having miniature people and animals. I liked Gulliver’s Travels and The Indian in the Cupboard very much. I also love detail. I love Alice in Wonderland because there was so much to look at and think about. This artist, Camille Allen, sculpts these teeny tiny baby “dolls” which, to me, are … --- ## Artist Bruce Metcalf Bruce Metcalf is a jewelry maker/metal artist/writer. The following are some of his works from the 90’s. Go to his website (below) for more recent work. I like this style the best. I think his work is curious, quirky and maybe a little disturbing. I like small artwork for some reason, miniatures, or scenes with a lot of different things going on. I believe all of these are brooches. - Website: http://www.brucemetcalf.com/index.html - Blog: http://www.brucemetcalf.com/blog/index.php Pewter Peanut with box. --- ## Souther Salazar Do you know the work of Souther Salazar? I love his tiny sculptures the best. I love his creativity and imagination. I imagine him having fun creating these characters with detailed stories to go with each piece. Enjoy! Works: - FeeFee Slurpy Mixed media, 2 1/2 × 1 1/2 × 1 1/2 inches - Lightbulb Balloon (orange) Mixed media, 6 × 3 × 2 inches - The Day We Escaped Mixed media, 3 1/2 × 3 × 6 inches - Bartholomew Mixed media, 4 × 3 × 3 inches - A Retired Cleaner of Attics Mixed media, 3 × 5 × 2 inches Images from here: http://jonathanlevinegallery.com/?method=Exhibit.OpeningPhotoDetail&ExhibitID=01B23A1C-115B-5562-AAFB8563997BB1AE&idx=16 Memory of a Giant Mixed media and collage on panel, 5 × 4 feet Studio images: http://alexnoriegasketchblog.blogspot.com/2007_09_01_archive.html Salazar’s MySpace page: http://www.myspace.com/southersalazar Interview with Salazar: http://www.fecalface.com/SF/index.php?option=com_content&task=view&id=301&Itemid=92 Flickr images (for Juxtapoz magazine): http://www.flickr.com/photos/aliciajrose/sets/72157603991422001/ --- ## T’s Gift This is the teacup made by one of her students that T received. I love the lid. Junya Shao is a famous international ceramic artist. She uses the Zisha clay (Purple clay) which is a natural product, traditional tools and slab technique to handmake her teapots. She transforms a thin paddled slab into a perfectly symmetrical form. The roots of this ancient technique date back 1000 years to the Song Dynasty. Working from the foundation, her works are contemporary expressions of own ideas about color and form. She also like to make some teapots that emulate objects of nature, creating a space for contemplation during the drinking of tea, to original purity and simplicity, to rediscover …	1,897	1,553	-3,353,505,723,183,011,000	concat	[ "concat_full" ]	0.75	true	null
8,382,605,156,011,771,000	OneUp Components ISCG 05 Chainguide Chain Accessories DESCRIPTION • Install without removing your crank • Single tool install and adjustment (4mm hex) • Boost compatible • Oval Compatible • Patent Pending adjustment system MTBR Newsletter Get the latest mountain bike reviews, news, race results, and much more by signing up for the MTBR Newsletter THE SITE ABOUT MTBR VISIT US AT © Copyright 2019 VerticalScope Inc. All rights reserved. Shop Info • Contact seller E-mail : [email protected] • Address 60 - 96 Wonhyoro 2(i)-ga, Yongsan-gu, Seoul Gmaru-Entertainment,103,141,SaeChang-Lo • Return address Shipping • • Major shipping company : Qxpress • • Shipping rate : Shipping rate can differ from item to item. Please see individual item page. Refund/Return • • If you want to get refund or return item you received, please contact us. Return address :60 - 96 Wonhyoro 2(i)-ga, Yongsan-gu, Seoul Gmaru-Entertainment,103,141,SaeChang-Lo • • We don’t accept the cases below : - Over 7days from receiving item - If items are open/used or damaged - Sending item without prior contact	# OneUp Components ISCG 05 Chainguide Chain Accessories ## Description - Install without removing your crank - Single tool install and adjustment (4mm hex) - Boost compatible - Oval compatible - Patent Pending adjustment system --- ## Shop Info Contact Seller E-mail: [email protected] Address 60-96 Wonhyoro 2(i)-ga, Yongsan-gu, Seoul Gmaru-Entertainment, 103,141, SaeChang-Lo Return Address 60-96 Wonhyoro 2(i)-ga, Yongsan-gu, Seoul Gmaru-Entertainment, 103,141, SaeChang-Lo ## Shipping Major Shipping Company: Qxpress Shipping Rate: Varies by item (see individual item page) ## Refund / Return If you want a refund or to return an item you received, please contact us. Return Address: 60-96 Wonhyoro 2(i)-ga, Yongsan-gu, Seoul Gmaru-Entertainment, 103,141, SaeChang-Lo We don’t accept the following cases: - Over 7 days from receiving the item - Items that are opened, used, or damaged - Sending items without prior contact	292	276	8,382,605,156,011,771,000	concat	[ "concat_full" ]	0.75	true	null
-626,394,248,784,827,100	Under Nav - Cyber Monday Preview BMSM Mobile Under Nav - Cyber Monday Preview SHARE Gavin Rossdale Bush Music Signed Autographed Acoustic Guitar Description Gavin Rossdale Bush Music Signed Autographed Acoustic Guitar Comes fully certified with Certificate of Authenticity and tamper-evident hologram. Also backed by HollywoodMemorabilia.com's Authenticity Guarantee. LOADING . . . Gavin Rossdale Bush Music Signed Autographed Acoustic Guitar ( View all Gavin Rossdale ) PID: 7292418 Sale: $578.54 Regular: $608.99 You Save: $30.45 PID: 7292418 Free Shipping This item usually ships in 5-7 business days. Item ships FREE. This item usually ships in 5-7 business days. LAST ONE Add To Cart Description The HollywoodMemorabilia.com Advantage Questions? Get help from a Memorabilia Expert 800.576.7252 Live Chat Let Us Help You • us/canada 800-576-7252 • Contact Us Worry Free Shopping Information Follow Us ©2019, SportsMem, Inc. All rights reserved ©2019, SportsMem, Inc. All rights reserved. Mskcc Human Resources Office Human Resources Jobs in Mifflinburg area (+250 miles): Urgent Hiring For HR Executive in New York City, Human Resources Generalist in New York City, Talent Acquisition Sourcing Specialist in Philadelphia, Recruiter Technology in Reston, Recruiter in Allentown. By working together and pushing forward with innovation and discovery, we're driving excellence and improving outcomes. Masanori Okaniwa, PhD, formerly of UCSF, and Vanessa S. For routine matters regarding your health, telephone or e-mail the nurse in your doctor's office by using the "Compose Message" option on the "Messages" section of MyMSK. 4118 or email matchinggift@mskcc. There are 90+ professionals named Rachel Siegel, who use LinkedIn to exchange information, ideas, and opportunities. Internship Opportunities. Please call us at 1-888-663-3488 and a patient services specialist can assist you with scheduling or click on one of the links below to fill out our convenient online form. See insights on Memorial Sloan Kettering Cancer Center including office locations, competitors, revenue, financials, executives, subsidiaries and more at Craft. A new bill introduced in the City Council on Wednesday would set up an Office of the Patient Advocate with the goal of producing data that could be used as the city and the state regulate local. Or, you can reach us by phone or mail using the information below. Bernards Township Parents for Exceptional Children; Progress Report Information; Special Events Calendar; Photos; Superintendent's Office; Technology Department; World. The Harvard Department of Stem Cell and Regenerative Biology and Harvard Stem Cell Institute advance the understanding of human development and disease, support the discovery of stem cell-based therapies and cures for diseases, create collaborations across traditional institutional and disciplinary boundaries, and teach and train the next. Joel indique 2 postes sur son profil. Resources, tools and helpful How-To guides for researchers. Now is a great time to understand what is offered - think about taking advantage of any opportunities to save and invest for the future. Send us a secure message online or contact us by mail or telephone. honor of in memory. 5 million pledge from the Los Angeles-based Iris and B. For additional facility locations, please contact the Human Resources Department at 1-844-482-9200. For any medical emergencies, please immediately contact your doctor's office by phone. Your professional education and corporate training can do more for you than just improve your business knowledge—it can also help you earn a University of Phoenix degree. over the phone call, then a interview with human resource assistant then two human resources managers then a interview with two doctors. The average salary for Memorial Sloan Kettering Cancer Center employees is $77,057 per year. all by Vocera. 8 Memorial Sloan Kettering Physician Office Assistant II interview questions and 7 interview reviews. To withdraw consent, contact the Registrarâ€™s Office, you will need to come to campus during normal business hours to conduct college business in-person. desription. Current openings along with titles for which NJDOT will accept applications to create a resume bank and instructions on how to apply are provided on this web site. Eligibility rules for public benefits haven't changed! Concerned about "Public Charge"? It does not apply to everyone. For more information: 617-632-3029. He is a member of Memorial Sloan-Kettering’s senior leadership team with a multi-dimensional role. Please browse all of our available job and career opportunities. " Horrible HR and housing management " Human resources is not helpful. For a better experience, click the icon above to turn off Compatibility Mode, which is only for viewing older websites. Quail's research program is focused on the role of the tumour. Brides who 'say yes' to purchasing a dress at Kleinfeld will contribute to raising an estimated $100,000 towards Memorial Sloan Kettering breast cancer research. : 1st Floor, TTC Building, No. Find 96338+ best results for "mskcc human resources" web-references, pdf, doc, ppt, xls, rtf and txt files. Read employee reviews and ratings on Glassdoor to decide if Memorial Sloan Kettering is right for you. Memorial Sloan-Kettering Cancer Center requires that all suppliers doing business with our hospital register their company information within our system. For any medical emergencies, please immediately contact your doctor's office by phone. External Link Disclaimer: By clicking on the links above you will leave the Department of Veterans Affairs Website. Office Research program Memorial Sloan Kettering Cancer Center North Shore University Hospital Human Resources" Name Type Affiliations. Human Resources Jobs in Mifflinburg area (+250 miles): Urgent Hiring For HR Executive in New York City, Human Resources Generalist in New York City, Talent Acquisition Sourcing Specialist in Philadelphia, Recruiter Technology in Reston, Recruiter in Allentown. Human Resources for the University of Oklahoma. Remote his mskcc keyword after analyzing the system lists the list of keywords related and the list of websites with related content, in addition you can see which keywords most interested customers on the this website. Doing so ensures that we have accurate data, and at the same time meet industry regulations, mandates and oversight. Memorial Sloan Kettering "cost of living" Reviews \| Glassdoor. Nurse Recruiter at Memorial Sloan Kettering Cancer Center VNSNY Human Resources. Memorial Sloan-Kettering Cancer Center Bladder SPORE: Population Science Resources. Tara Texiera, manager of human resources information systems (HRIS), oversees the University's Oracle/PeopleSoft HR system (HCM), including HR Self Service, and is a custodian of the HR Information Warehouse. edu: Madonna De Mesa HR Coordinator Employee: WCMC-Q: mmm2020@qatar-med. Fast & Free job site: Free Haiphong job posting site - Jobs Haiphong Vietnam, work for English speakers, IT jobs in Haiphong for foreigners, expats, Americans. Corporate Shopping Company is a shopping powerhouse that operates a leading employee discount program with exclusive employee discounts at top national retailers. Simply request and complete a matching gifts form from your human resources office. NYU is a global network of places and people, academic resources and research projects, offering real-life professional and personal experiences in the world’s most dynamic cities. Memorial Sloan Kettering offers an array of services to support and educate patients, families, and caregivers during and after cancer treatment. 3 billion, 750,000-square-foot outpatient medical facility to be known as the David H. Fax: (212) 557-0531. Stony Brook also has leave options for postdoc employees who need to take leave for family illness, with support from FMLA and New York State Paid Family Leave Program. For guidance on leave options available to you, you can also contact the Time and Attendance unit in Human Resources. Join Ladders to find the latest jobs at Memorial Sloan Kettering Cancer Center such as Strategic Sourcing Manager, Technologist. Apply now for jobs hiring near you. over the phone call, then a interview with human resource assistant then two human resources managers then a interview with two doctors. From top quality in the nation, to compassionate cancer care, to state-of-the-art technology like cardiac stereotaxis, we're committed to the health and wellness of our community. ca Research Area: Tumor microenvironment Research Description: Dr. Eureka Therapeutics Announces Exclusive License Agreement between Memorial Sloan Kettering Cancer Center and Juno Therapeutics for Use of a Novel, Fully-Human MUC16 Binder in CAR T Cell Immunotherapy. Dowdell is currently Vice President of Human Resources and Chief Human Resources Officer at Memorial Sloan-Kettering Cancer Center in New York City. If you are an individual with a disability, or an individual who requires accommodation due to another characteristic protected under applicable law, and you need assistance with our employment application process, please contact the Human Resources Department at (212) 450-2000 or send an email to taleo@nfl. Under Review by Human Resources: Your application has been received by Human Resources and is awaiting completion of the initial review and screening processes. Associate Compensation Analyst Memorial Sloan Kettering Cancer Center oktober 2018 – heden 11 maanden. Browse 79051 Human Resources jobs on our job search engine. The average salary for an Office Coordinator at Memorial Sloan Kettering Cancer Center is $48,000. Memorial Sloan-Kettering Cancer Center in New York, NY is nationally ranked in 5 adult specialties and 1 pediatric specialty and rated high performing in 1 adult specialty and 2 procedures and. More than 10,000 customers around the globe depend on Accruent to manage their physical resources and gain the visibility to deliver on their mission. Margie tiene 1 empleo en su perfil. Welcome to Memorial Sloan-Kettering Cancer Center's Vendor Portal. Memorial Sloan Kettering Cancer Center SW is recognized by the New York State Education Department's State Board for Social Work as an approved provider of continuing education for licensed social workers #0228. Outside of work, Doreen loves to listen to different genres music, eat amazing foods, and explore new places and activities. Human Resources/Talent Acquisition Access Staffing August 2015 - June 2017 1 year 11 months. Office of Research, Business and Industry Collaborations, Research Areas, Research Tools, Student Research, Technology Licensing and Commercialization Emergency alert message Ohio State nav bar. If you're checking for LexisNexis email addresses, these are also available on Lead411 with the @lexisnexis. Memorial Sloan Kettering Physician Office Assistant Reviews \| Glassdoor. The Human Research Protection Program is responsible for all Ohio State research involving human subjects. Department of Health and Human Services. MSK is an equal opportunity and affirmative action employer committed to diversity and inclusion in all aspects of recruiting and employment. Greater New York City Area. View Mari Moriarty’s profile on LinkedIn, the world's largest professional community. If you are on the Empire PPO, you should evaluate whether the less-expensive EPO option would work for you. What would you like the power to do? For you and your family, your business and your community. Ariela Noy since early July, was admitted to Memorial Hospital for what turned out to be his final admission. Search 38 Memorial Sloan Kettering Cancer Center jobs at Ladders. A free inside look at company reviews and salaries posted anonymously by employees. ParentJobNet is seeking part-time interns/volunteers to help us continue our mission of helping public school parents. HSS is ranked the #1 hospital in the US for orthopedics, #3 for rheumatology and is top-ranked in neurology and pediatrics \| Outpatient locations in NY, NJ, CT. Dr Vikram received his medical degree from the University of Delhi and trained in radiation oncology at Memorial Sloan-Kettering Cancer Center in New York City. Memorial Sloan Kettering Physician Office Assistant Reviews \| Glassdoor. 5 million pledge from the Los Angeles-based Iris and B. HOPP recruits outstanding physician-scientists across clinical disciplines in a single program to foster translational oncology. Eligibility rules for public benefits haven't changed! Concerned about "Public Charge"? It does not apply to everyone. The Mission of the Morris ~ Somerset Regional Chronic Disease Coalition is to prevent premature death and disability from chronic diseases such as cancer,. , the Chair of the Department of Biophysics at UT Southwestern Medical Center. The donations represent the profits of Taylor's CAS (Creativity, Action, Service) project as part of her IB Diploma requirements but it also represents a heartfelt labor of love - Candles for a Cure. Welcome from Michael S. Corporate Recruiter Hudson's Bay Company May 2016 – August 2017 1 year 4 months. The Harvard Department of Stem Cell and Regenerative Biology and Harvard Stem Cell Institute advance the understanding of human development and disease, support the discovery of stem cell-based therapies and cures for diseases, create collaborations across traditional institutional and disciplinary boundaries, and teach and train the next. o Conduct intake meetings and partner with hiring managers to fill positions timely, while maintaining fair hiring practices. (SRI) is an international, ISO 9001:2015 Certified, CMMI Level 3 Rated full-service provider with more than 30 years experience in the Federal, military, and commercial marketplaces. Birkhead’s profile on LinkedIn, the world's largest professional community. If you are an individual with a disability, or an individual who requires accommodation due to another characteristic protected under applicable law, and you need assistance with our employment application process, please contact the Human Resources Department at (212) 450-2000 or send an email to taleo@nfl. 5 million pledge from the Los Angeles-based Iris and B. Learn more at Insurance & Billing. We are part of Penn Medicine, an integrated organization that includes the University of Pennsylvania Perelman School of Medicine and the University of Pennsylvania Health System. Memorial Sloan-Kettering Cancer Center requires that all suppliers doing business with our hospital register their company information within our system. View Kerry Bessey's professional profile on Relationship Science, the database of decision makers. AUTHORIZATION FOR RELEASE OF INFORMATION Memorial Sloan Kettering Cancer Center 633 Third Avenue, 11th Floor. Our flagship hospital, Kettering Medical Center, stands proudly in Kettering, Ohio. Emily tiene 5 empleos en su perfil. Human Resources/Talent Acquisition Access Staffing August 2015 – Juni 2017 1 Jahr 11 Monate. Nicolas has 4 jobs listed on their profile. Psychiatric, or psychosocial, palliative care has transformed palliative medicine. Federal Judicial Center The Federal Judicial Center provides training and research for the federal judiciary. Founded in 1884 as the New York Cancer Hospital, Memorial Sloan-Kettering Cancer Center (MSKCC) is one of the oldest cancer centers in the country. A global Human Resources professional with more than 15 years international experience. Get access to major magazines and journals to read on your smartphone, tablet, or PC. Memorial Sloan Kettering Cancer Center (MSK or MSKCC) is a cancer treatment and research institution in New York City, founded in 1884 as the New York Cancer Hospital. For the 28th year, MSK has been named a top hospital for cancer by U. I just don't love the hospital environment that much, and night shift is to draining. Human Subjects. Head Office. Or, you can reach us by phone or mail using the information below. For additional facility locations, please contact the Human Resources Department at 1-844-482-9200. Greater New York City Area-Utilized search tools to source candidates for various levels and skills sets with office support areas. Shop online, see ExtraCare deals, find MinuteClinic locations and more. Dermatopathology Fellowship at Memorial Sloan Kettering Cancer Center, New York City, New York Hematopathology Fellowship at University of Michigan, Ann Arbor, Michigan; Bone and Soft Tissue Pathology Fellowship at Mayo Clinic, Rochester, Minnesota. View Mari Moriarty’s profile on LinkedIn, the world's largest professional community. The incumbent will enhance the faculty members' grant applications and academic efforts through editing, grant coordination, and project. The Benefits department within Human Resources at Memorial Sloan Kettering Cancer Center. Join Ladders to find the latest jobs at Memorial Sloan Kettering Cancer Center such as Senior Editorial Manager, Senior. A primary responsibility of the Administrative Office is to provide staff support and counsel to the Judicial Conference and its committees. employees must see for treatment. Eligibility rules for public benefits haven't changed! Concerned about “Public Charge”? It does not apply to everyone. 14 Memorial Sloan Kettering Registered Nurse interview questions and 10 interview reviews. MSKCC HUMAN RESOURCES. I worked at Memorial Sloan Kettering full-time for more than a year. For more than 30 years, my family and I have literally put our lives in its hands. The Senior Administrative Assistant will spend equal time performing office management functions and working on communication projects. The Assistant Editor/Grant Writer will be a member of the Department of Surgery's large editorial group. We are always interested in hearing your questions, comments and concerns. At New York Cares, we believe that regular people who care deeply about their city can spark real change. : 1st Floor, TTC Building, No. the head of my department, the second and third highest roles, and a large. AUTHORIZATION FOR RELEASE OF INFORMATION Memorial Sloan Kettering Cancer Center 633 Third Avenue, 11th Floor. Resources, tools and helpful How-To guides for researchers. Human Resources. We recognize the emotional and logistical challenges that cancer poses, and hope that members of this community find the site to be a helpful resource. About Us Forms Library Job Opportunities Professional Non-Exempt Opportunities Administrative Opportunities Clerical Opportunities Maintenance Opportunities Non-Benefited Professional/Clerical Opportunities Benefits Health and Well-Being Financial Benefits Time Off Leave and Disability Management Vendor Contacts. Human Resources Jobs in Mifflinburg area (+250 miles): Urgent Hiring For HR Executive in New York City, Human Resources Generalist in New York City, Talent Acquisition Sourcing Specialist in Philadelphia, Recruiter Technology in Reston, Recruiter in Allentown. All Patient Care Education & Training Research Faculty Departments & Centers Newsroom Events. over the phone call, then a interview with human resource assistant then two human resources managers then a interview with two doctors. AI (a developer of artificial intelligence for pathology) shows how academic pathology laboratories might accomplish this goal and serve a similar gatekeeper role in research and development using the decades of cases in their archives. If your company participates, please follow the instructions given or contact your human resources or philanthropy department for the appropriate paperwork. Please use this page to view current job openings across NYU and to apply for positions online. 2018 Lymphoma Expert Dr. Memorial Hospital for Cancer and Allied Diseases provides patient care. Schwabach v. local 17 Benny Steward, Chuck Percy, Ralph Abernathy, Ben Branch, Muhammad Ali, Leonore Cartwright, Wallace Muhammad, Renault Robinson, Dick Gregory, discolored y3 62. If your company matches gifts, please follow the instructions your employer provides, or contact your Human Resources department for the appropriate form. Free interview details posted anonymously by Memorial Sloan Kettering interview candidates. Their Lead411 profile is categorized under the Hospitals/clinics industry. 25 Memorial Sloan Kettering Office coordinator jobs, including salaries, reviews, and other job information posted anonymously by Memorial Sloan Kettering Office coordinator employees. Cancer Stem Cell News. , the Chair of the Department of Biophysics at UT Southwestern Medical Center. 15 Memorial Sloan Kettering reviews. His current research interests are focused on molecular, genetic and cellular determinants of. Ve el perfil completo en LinkedIn y descubre los contactos y empleos de Emily en empresas similares. Join Ladders to find the latest jobs at Memorial Sloan Kettering Cancer Center such as Senior Editorial Manager, Senior. Get access to major magazines and journals to read on your smartphone, tablet, or PC. We are always interested in hearing your questions, comments and concerns. For routine matters regarding your health, telephone or e-mail the nurse in your doctor's office by using the "Compose Message" option on the "Messages" section of MyMSK. We invite you to join our team of dedicated and compassionate professionals who deliver the utmost quality care in the communities we serve throughout Long Island. Memorial Sloan-Kettering Cancer Center (MSKCC), New York, New York; Dietary Supplements Center for Food Safety and Applied Nutrition (CFSAN), U. Memorial Sloan Kettering Cancer Center \| Memorial Hospital for Cancer and Allied Diseases \| Sloan Kettering Institute Gerstner Sloan Kettering Graduate School of Biomedical Sciences Patients & Caregivers. Learn more about Michael Rosen, Ph. ’s connections and jobs at similar companies. Doctoral-Level Biostatistician, Department of Epidemiology and Biostatistics Memorial Sloan Kettering Cancer Center Memorial Sloan Kettering Cancer Center (MSK) is one of the world’s premier cancer centers, committed to exceptional patient care, leading-edge research, and superb educational programs. You don’t have to quit your day job to make a difference in your community. Memorial Sloan Kettering Cancer Center On the Monday after… A Tribute to Memorial Hospital Memorial Sloan Kettering Cancer Center On the Monday after Thanksgiving, my husband who was being treated for lymphoma and was a patient of Dr. Memorial Sloan-Kettering Cancer Center in New York, NY is nationally ranked in 5 adult specialties and 1 pediatric specialty and rated high performing in 1 adult specialty and 2 procedures and. Under Review by the Hiring Department : Your applicant and supplemental documents have been received by the appropriate search committee and are awaiting completion of the initial review and screening processes. With a legacy of putting patients first, Weill Cornell Medicine is committed to providing exemplary and individualized clinical care, making groundbreaking biomedical discoveries, and educating generations of exceptional doctors and scientists. The company has earned recognition for undertaking large, complex projects, fostering innovation, embracing emerging technologies, and making a difference for their clients, employees and community. Office of Research, Syracuse University. Prior to FY 2016, expenditures for natural resources and conservation, materials science, anthropology, and industrial and manufacturing engineering were not collected separately. Leadership will come from the imaging scientists (Drs. Human Resources Business Partner Employee: WCMC +1 646 962 3628: lgs2001@med. Our affiliate site, SPUH, JSUMC, & MSKCC have a local Residency office and staff to address your needs while rotating at that site. Recent additions – View all Outcomes after transarterial embolization of neuroendocrine tumor liver metastases using spherical particles of different sizes. Please call us at 1-888-663-3488 and a patient services specialist can assist you with scheduling or click on one of the links below to fill out our convenient online form. A free inside look at company reviews and salaries posted anonymously by employees. It was one of the first cancer centers to receive the NCI designation in 1971. Animal studies of novel cancer therapeutics, while imperfect as a treatment model, have utility, both in studying therapeutic efficacy and toxicity. Staff; Middle School Programs; Resources; High School. Memorial Sloan-Kettering Cancer Center in New York, NY is nationally ranked in 5 adult specialties and 1 pediatric specialty and rated high performing in 1 adult specialty and 2 procedures and. Safe Zone LGBT Allies 'Safe Zone' is a program designed to increase the overall campus community's understanding of and capacity to address issues faced by Lesbian, Gay, Bisexual, and Transgender (LGBT) persons. Incoming Calls. Research at Memorial Sloan-Kettering Cancer Center is focused on cancer diagnosis and enhancing responses of tumor to treatment with a goal of curing cancer. Consultez le profil complet sur LinkedIn et découvrez les relations de Jessie-Rose, ainsi que des emplois dans des entreprises similaires. Call 311 & say "Public Charge" or visit NYC. If your company matches gifts, please follow the instructions your employer provides, or contact your Human Resources department for the appropriate form. Saks Fifth Avenue, The Society of MSKCC Raise Over $1. We will be also be hosting a panel of current employees who hold or have once held these positions to share with you a little about what it is like to work at MSKCC and examples of growth opportunities that are available. Memorial Hospital for Cancer and Allied Diseases provides patient care. We coordinate postgraduate residents and fellows, for training, in over 96 ACGME-accredited residency and fellowship programs sponsored by Montefiore Medical Center. Memorial Sloan-Kettering Cancer Center Latest News State Of The Art Cancer Center Set To Open In East Harlem The East Harlem center will combine the medical expertise of Memorial Sloan Kettering Cancer Center, Montefiore Health System and Mount Sinai Health System, three of the top medical institutions. This web resource is designed to enhance access to and understanding of Cornell's benefits, services, and human resource policies. Ariela Noy since early July, was admitted to Memorial Hospital for what turned out to be his final admission. July 25, 2000). Also as a backup I have expertise on Human Resources Depto (employee benefits) training new employees orientation day , preparing letters and other paperwork including union labor. Average Memorial Sloan Kettering Office Assistant yearly pay in the United States is approximately $42,010, which is 31% above the national average. The agenda includes lectures, panel discussions, and experiential sessions - the combination of which introduces key themes of resilience and self-care for healthcare professionals. + Resources & Tools. Memorial Sloan Kettering Physician Office Assistant Reviews \| Glassdoor. Eureka Therapeutics Announces Exclusive License Agreement between Memorial Sloan Kettering Cancer Center and Juno Therapeutics for Use of a Novel, Fully-Human MUC16 Binder in CAR T Cell Immunotherapy. Co-sponsored by MSK’s: Employee Health & Wellness Services Psycho-Oncology Education & Training Institute (POETI) Target Audience This conference is intended for professional caregivers of patients with life-threatening illness as well as healthcare leaders (including chief medical officers, and, directors of. For general information about insurance coverage and billing for treatment at Memorial Sloan Kettering, call 646-497-9176. " Horrible HR and housing management " Human resources is not helpful. HSS is ranked the #1 hospital in the US for orthopedics, #3 for rheumatology and is top-ranked in neurology and pediatrics \| Outpatient locations in NY, NJ, CT. We are seeking a Senior Benefits/Communications Assistant to provide administrative support to the benefits team. edu: Maritza Samuel Recruiting Support Specialist Employee: WCMC. Memorial Sloan Kettering Cancer Center (MSK), the world’s oldest and largest private cancer center, has devoted more than 130 years to exceptional patient care, leading-edge research, and superb educational programs. org credit card type credit card number expiration date (mm/yy) signature i have remembered msk in my will, retirement account, or other long-term plans. Please note that all matching gifts to Fred's Team must be submitted under Memorial Sloan Kettering Cancer Center using the address below. He oversees a portfolio of grants that includes all aspects of clinical physics in radiation oncology, novel medical devices, new treatment modalities such as ion beam therapy, on-line imaging techniques as well as the emerging fields of AI applications in radiotherapy, Big Data. Your professional education and corporate training can do more for you than just improve your business knowledge—it can also help you earn a University of Phoenix degree. If your company matches gifts, please follow the instructions your employer provides, or contact your Human Resources department for the appropriate form. Assistant Laboratory Member, Immunology Program, Sloan-Kettering Institute for Cancer Research and Memorial Sloan-Kettering Cancer Center, 2002-2008; Assistant Professor, Department of Pathology & Laboratory Animal Medicine, Weill Medical College of Cornell University, 2003-2008. I trusted Memorial Sloan Kettering Cancer Center and believed in it. Memorial Sloan Kettering's Department of Surgery is a hub of translational and clinical research. Step 3: Send Forms Mail completed forms to MSK’s Matching Gifts department, or submit the necessary information through your company’s online portal (if available). Browse 79051 Human Resources jobs on our job search engine. We are part of Penn Medicine, an integrated organization that includes the University of Pennsylvania Perelman School of Medicine and the University of Pennsylvania Health System. For assistance contact the Help Desk at 646-227-3337. Breitbart, a renowned clinician, researcher, and educator, is the chairman and incumbent of the Jimmie C Holland Chair in Psychiatric Oncology, as well as Chief of the Psychiatry Service, Department of Psychiatry and Behavioral Sciences, Memorial Sloan-Kettering Cancer Center (New York, NY), He is a Professor of Clinical Psychiatry at Weill. Find your yodel. The team includes experienced nurses, social workers, and MSK Care Advisors who will help you navigate every step of your cancer experience, from diagnosis and treatment, to recovery and life beyond cancer. Under Review by Human Resources: Your application has been received by Human Resources and is awaiting completion of the initial review and screening processes. Join Ladders to find the latest jobs at Memorial Sloan Kettering Cancer Center such as Senior Editorial Manager, Senior. Research Office. Strategic Resources, Inc. Welcome from Michael S. The Prostate Cancer Foundation (PCF) is the world’s leading philanthropic organization dedicated to funding life-saving cancer research. At Bank of America, our purpose is to help make financial lives better through the power of every connection. Memorial Sloan Kettering Cancer Center has announced a $150 million commitment — the largest in its history — from board member David H. , mental health, human resources, marketing, forensic psychology, neuropsychology, child development, geriatrics, health psychology, school psychology and animal-assisted therapy. Memorial Sloan Kettering Cancer Center \| Memorial Hospital for Cancer and Allied Diseases \| Sloan Kettering Institute Gerstner Sloan Kettering Graduate School of Biomedical Sciences Patients & Caregivers. Their Lead411 profile is categorized under the Hospitals/clinics industry. If you need to schedule an outpatient procedure, please call (937) 384-4510. I interviewed at Memorial Sloan Kettering (New York, NY (US)) in March 2014. MSK is an equal opportunity and affirmative action employer committed to diversity and inclusion in all aspects of recruiting and employment. Senior Human Resources Assistant at City of Las Cruces Las Cruces, New Mexico Government Administration. If your company matches gifts, please follow the instructions your employer provides, or contact your Human Resources department for the appropriate form. Koutcher, Blasberg and Larson) and also from the molecular pharmacology group who will meet monthly along with a Technology Committee, to decide which problems are important and appropriate to be addressed by imaging technology. If you require a reasonable accommodation for any part of the application and/or hiring process, please notify Human Resources by calling 212-327-8300 or emailing hris@rockefeller. Memorial Sloan-Kettering Cancer Center on The 200 Economy Emerging Markets Equities Options Finance Human Resources Law & Taxation Sales & Marketing Management Technology General's Office. Bernards Township Parents for Exceptional Children; Progress Report Information; Special Events Calendar; Photos; Superintendent's Office; Technology Department; World. He also holds an appointment as professor of surgery at Weill-Cornell Medical College. Memorial Sloan-Kettering Cancer Center, No. 5 million pledge from the Los Angeles-based Iris and B. Call 311 & say "Public Charge" or visit NYC. We are always interested in hearing your questions, comments and concerns. The Mission of the Morris ~ Somerset Regional Chronic Disease Coalition is to prevent premature death and disability from chronic diseases such as cancer,. Their Lead411 profile is categorized under the Technology consulting/services industry. At Memorial Sloan Kettering (MSK), we're not only changing the way we treat cancer, but also the way the world thinks about it. One employee said the woman’s diploma had been knocked down and that some figurines in her office had been broken. If you are an individual with a disability, or an individual who requires accommodation due to another characteristic protected under applicable law, and you need assistance with our employment application process, please contact the Human Resources Department at (212) 450-2000 or send an email to taleo@nfl. Join Ladders to find the latest jobs at Memorial Sloan Kettering Cancer Center such as Senior Editorial Manager, Senior. Service at Memorial Sloan Kettering Cancer Center is currently recruiting dynamic research and community outreach assistants for its Taxi Network and South Asian Health Initiative programs. Leadership will come from the imaging scientists (Drs. A free inside look at company reviews and salaries posted anonymously by employees. Call 311 & say “Public Charge” or visit NYC. Along with conducting outreach to alumni, individual donors, members of the Board of Overseers, and institutional funders, the Office builds. Memorial Sloan Kettering Response September 16, 2016 – Talent Community Manager Thank you for sharing your feedback and we're happy to hear that you have felt welcomed at MSK and have enjoyed the management in your department, including your direct supervisor. Ceferino Obcemea. Learn about all the MSK locations in New York City, New Jersey, and Westchester, and on Long Island. Unfortunately, MSKCC showed far less compassion and concern when one of its employees, Plaintiff Marie Andre, came to MSKCCs management and. All faculty and administrators will have the choice of either Empire Blue cross plan: the PPO or EPO. Resources, tools and helpful How-To guides for researchers. Rodrik-Outmezguine, PhD, and Zhan Yao, PhD, of Memorial Sloan Kettering Cancer Center were co-lead authors of the new research. Call 311 & say "Public Charge" or visit NYC. Find our Senior Administrative Assistant, Learning and Organization Development job description for Memorial Sloan Kettering Cancer Center located in New York, NY, as well as other career opportunities that the company is hiring for. Each of the WCM Core Facilities provide the resources and equipment necessary for our research community, enabling them to make important advances in diagnosing and treating human diseases. We serve greater Houston with 13 hospitals, a network of affiliated doctors and many specialty programs. Consultez le profil complet sur LinkedIn et découvrez les relations de Jessie-Rose, ainsi que des emplois dans des entreprises similaires. 882 reviews from current and former Memorial Sloan Kettering employees about Memorial Sloan Kettering culture, salaries, benefits, work-life balance, management, job security, and more. Our flagship hospital, Kettering Medical Center, stands proudly in Kettering, Ohio. German, III, MD Department of Pathology Beth Israel Hospital Memorial Sloan-Kettering Cancer Ctr: Melanoma:. The 2018 Employee Benefits Survey, administered by the Society for Human Resource Management (SHRM) in February and March 2018, assessed the prevalence of more than 300. Average Memorial Sloan Kettering Office Assistant yearly pay in the United States is approximately $41,495, which is 34% above the national average. Location and hours; After-Hours Clinic; Not feeling well? Get the care you need quickly so you can return to work sooner. Branch Chief, CROB. Investigator Resources. Federal Judicial Center The Federal Judicial Center provides training and research for the federal judiciary. The laudable mission of Memorial Sloan Kettering Cancer Center (MSKCC or the Center) one of the worlds most well-respected healthcare facilities is to provide exceptional care for its patients. The City of Kettering provides a comprehensive, balanced and competitive benefits package as part of a total compensation package. Environmental Service Aide, Memorial Sloan Kettering Monmouth (Middletown) Position Summary At Memorial Sloan Kettering (MSK), we're not only changing the way we treat cancer, but also the way the world thinks about it. News & World Report. Step 3: Send Forms Mail completed forms to MSK's Matching Gifts department, or submit the necessary information through your company's online portal (if available). over the phone call, then a interview with human resource assistant then two human resources managers then a interview with two doctors. Box 27106 New York, NY 10087-7106. See the complete profile on LinkedIn and discover Lerie’s connections and jobs at similar companies. We recognize the emotional and logistical challenges that cancer poses, and hope that members of this community find the site to be a helpful resource. honor of in memory. Koch Center for Cancer Care. He received his MD degree from the University of Texas Medical School in Houston, completed his general surgery residency at Vanderbilt University Medical Center in Nashville, and completed surgical oncology and colorectal surgical oncology fellowships at Memorial Sloan-Kettering Cancer Center. Gift Information in memory of About You Please mail this completed form with payment to: Memorial Sloan-Kettering Cancer Center P. Expertise on payable revising all received merchandise and checking discrepancies on pricing to avoid overpaying for products. Find the latest information about cancer treatments, research and prevention as well as how to become a patient at MD Anderson Cancer Center. at the Sonoma County Fairgrounds, Finley Hall Building. A wiki site for currently enrolled students that contains information, resources and a growing list of 150+ internship sites; Varied placement opportunities e. New York, NY 10017. AUTHORIZATION FOR RELEASE OF INFORMATION Memorial Sloan Kettering Cancer Center 633 Third Avenue, 11th Floor. Reviews, salaries, maternity leave benefits and more -- posted by Memorial Sloan Kettering Cancer Center employees. Internship Opportunities. The Office of Development and Alumni Relations cultivates key relationships that advance the School's mission and builds robust relationships with funders. quail@mcgill. Find our Senior Administrative Assistant, Learning and Organization Development job description for Memorial Sloan Kettering Cancer Center located in New York, NY, as well as other career opportunities that the company is hiring for. has held international positions of increasing responsibility in pharmaceuticals and biotechnology companies over the past 15 years, including PAION AG, Accentia Biopharmaceuticals, BioVest International, Analytica International, Anavex Life Sciences. Greater New York City Area-Utilized search tools to source candidates for various levels and skills sets with office support areas. Tara Texiera, manager of human resources information systems (HRIS), oversees the University's Oracle/PeopleSoft HR system (HCM), including HR Self Service, and is a custodian of the HR Information Warehouse. Learn more at Insurance & Billing. Proin tempor aliquam risus ac fringilla! Nulla varius quam eros, vel massa nunc. : 72 HUMAN RESOURCES Seventy-Two :- job-interview frequently asked questions & answers (Best references for jobs). Browse 79051 Human Resources jobs on our job search engine. For general information, call 212-639-2000, 24 hours a day, seven days a week. Prior to FY 2016, expenditures for natural resources and conservation, materials science, anthropology, and industrial and manufacturing engineering were not collected separately. If your company matches gifts, please follow the instructions your employer provides, or contact your Human Resources department for the appropriate form. The Assistant Editor/Grant Writer will be a member of the Department of Surgery's large editorial group. This is an excellent opportunity to join a dedicated team working on reducing health disparities in immigrant populations in NYC. Send us a secure message online or contact us by mail or telephone. Metropolitan Hospital Center is a full service community hospital that provides state-of-the-art care and leading edge technology in a modern environment. Leadership will come from the imaging scientists (Drs. Probationary Period Policy - New York, District of Columbia, and California (PDF) Statement of Policy. Member, Department of Dermatology, Memorial Sloan-Kettering Cancer Center, New York, NY Residency , Dermatology Division, Department of Medicine: Cornell Medical Center, New York, NY Certifications: American Academy of Dermatology and National Board of Medical Examiners. The Senior Administrative Assistant will spend equal time performing office management functions and working on communication projects. Our affiliate site, SPUH, JSUMC, & MSKCC have a local Residency office and staff to address your needs while rotating at that site. Read employee reviews and ratings on Glassdoor to decide if Memorial Sloan Kettering is right for you. Please make check or money order payable to: Memorial Sloan-Kettering Cancer Center Matching Gifts Does your employer have a matching gift program? If so, you can potentially multiply the size of your gift to MSKCC. House Staff Office Montefiore Medical Center is committed to supporting our House Staff and enhancing their experience through training initiatives. Graduates of the Department of Urology residency program go on to advance their careers in a variety of areas, from additional fellowship training to academic medicine to private practice. Welcome to HR. Fast & Free job site: Free Haiphong job posting site - Jobs Haiphong Vietnam, work for English speakers, IT jobs in Haiphong for foreigners, expats, Americans. Our mission is to support the university's strategic imperatives by anticipating and meeting the needs of a changing community through high-quality, innovative services designed to advance student success and cutting edge research. Apply to any positions you believe you are a fit for and contact us today!. The University provides reasonable accommodations to qualified individuals with disabilities who can perform the essential functions for the position. The agenda includes lectures, panel discussions, and experiential sessions - the combination of which introduces key themes of resilience and self-care for healthcare professionals. Leach is an attending physician and the director of pancreatic cancer research at Memorial-Sloan Kettering Cancer Center, a position he has held since 2014. Employee Discount Programs.	# Gavin Rossdale Bush Music Signed Autographed Acoustic Guitar PID: 7292418 Sale Price: $578.54 Regular Price: $608.99 You Save: $30.45 Availability: Last One Shipping: Free (usually ships in 5–7 business days) --- ## Description Gavin Rossdale Bush Music Signed Autographed Acoustic Guitar comes fully certified with Certificate of Authenticity and tamper-evident hologram. Also backed by HollywoodMemorabilia.com’s Authenticity Guarantee. --- # MSKCC Human Resources Office ## Human Resources Jobs (Mifflinburg area +250 miles) - Urgent Hiring For HR Executive in New York City - Human Resources Generalist in New York City - Talent Acquisition Sourcing Specialist in Philadelphia - Recruiter Technology in Reston - Recruiter in Allentown ## Contact Information - Phone (general inquiries): 1-888-663-3488 - HR Department (facility locations): 1-844-482-9200 - Fax: (212) 557-0531 - Email (matching gifts): [email protected] - Compose a Message (MyMSK): Use the “Messages” → “Compose Message” option to reach your nurse for routine health matters. - Emergencies: Immediately contact your doctor’s office by phone. > External Link Disclaimer: > By clicking on the links above you will leave the Department of Veterans Affairs Website. ## Patient Scheduling Please call 1-888-663-3488 and a Patient Services Specialist can assist you, or click one of the online scheduling links in MyMSK. ## Employee Benefits & Matching Gifts - If your employer has a matching gift program, follow your company’s instructions or contact your HR department for the appropriate form. - To submit a matching gift for MSKCC’s Fred’s Team, use: Memorial Sloan Kettering Cancer Center P.O. Box 27106 New York, NY 10087-7106 ## Application Status Definitions - Under Review by Human Resources: Your application has been received and is awaiting the initial HR review and screening. - Under Review by Hiring Department: Your application and documents are with the search committee, pending their review and screening. --- Memorial Sloan Kettering Cancer Center is an equal opportunity and affirmative action employer committed to diversity and inclusion in all aspects of recruiting and employment.	8,679	536	-626,394,248,784,827,100	concat	[ "concat_full" ]	0.75	false	null
-9,107,226,852,288,020,000	Printemps arabe: L’Egypte vote à nouveau pour Noël (Like turkeys voting for Christmas) https://i0.wp.com/www.frontrowgrunt.co.za/wp-content/uploads/turkeys-UKIP-VOTING-FOR-CHRISTMAS.jpgFeminists, Christians, Professors for Academic Freedom and Gays have only one country in the middle east that recognizes their human rights and respects their right to live openly as the people they are. That country is Israel.: Dry Bones cartoon.The Arab Spring was an exercise in irony, nowhere more so than in Egypt. On the surface, it appeared to be the Arab equivalent of 1989 in Eastern Europe. There, the Soviet occupation suppressed a broad, if not universal desire for constitutional democracy modeled on Western Europe. The year 1989 shaped a generation’s thinking in the West, and when they saw the crowds in the Arab streets, they assumed that they were seeing Eastern Europe once again. There were certainly constitutional democrats in the Arab streets in 2011, but they were not the main thrust. Looking back on the Arab Spring, it is striking how few personalities were replaced, how few regimes fell, and how much chaos was left in its wake. The uprising in Libya resulted in a Western military intervention that deposed former leader Moammar Gadhafi and replaced him with massive uncertainty. The uprising in Syria has not replaced Syrian President Bashar al Assad but instead sparked a war between him and an Islamist-dominated opposition. Elsewhere, revolts have been contained with relative ease. The irony of the Arab Spring was that in opening the door for popular discontent, it demonstrated that while the discontent was real, it was neither decisive nor clearly inclined toward constitutional democracy. The Egyptian uprising has always been the most ambiguous even while being cited as the most decisive. It is true that former President Hosni Mubarak fell in 2011. It is also true that elections were held in 2012, when a leader of the Muslim Brotherhood’s election as president highlighted the reality that a democratic election is not guaranteed to produce a liberal democratic result. (…) But the real issue in Egypt has always been something else. Though a general was forced out of office in 2011, it was not clear that the military regime did not remain, if not in power, then certainly the ultimate arbiter of power in Egyptian politics. Over the past year, so long as Morsi remained the elected president, the argument could be made that the military had lost its power. But just as we argued that the fall of Hosni Mubarak had been engineered by the military in order to force a succession that the aging Mubarak resisted, we can also argue that while the military had faded into the background, it remained the decisive force in Egypt. Stratfor It’s a sign of how atrophied U.S. influence in Egypt has become under Mr. Obama that his views count for so little—assuming he has views at all. For the rest of us, the lesson from Egypt is that democracy may be a blessing for people capable of self-government, but it’s a curse for those who are not. There is a reason that Egypt has been governed by pharaohs, caliphs, pashas and strongmen for 6,000 years. The best outcome for Egypt would be early elections, leading to the Brotherhood’s defeat at the hands of a reformist, technocratic government with military support. The second-best outcome would be a bloodless military coup, followed by the installment of a reformist government. The chances for either outcome are slight. But the Brotherhood will not go quietly. Get ready for a bloody road ahead. Bret Stephens For all his magnificent indignation against modern-day anti-Semitism, Mr. Nasr dismisses Israel as a colonialist error—an uncharacteristic concession to fashionable opinion on his part. But it is hard to see how a Muslim liberalism can advance without arriving at a deeper and more sympathetic understanding of Jewish history and Zionism. Political theory is another weak point: Mr. Nasr counts himself a libertarian and never explains why. This sort of thing, the offhand quality of Mr. Nasr’s opinions, may be OK for a blogger, and doubly OK for a student. But what will happen if, as Mr. Nasr expects, the Arab Spring arrives at still another phase, and liberals like him are given another chance? I hope they will be prepared. Paul Berman Sadly, Egypt has been here before, in 1952. Political order had given way, the political parties of the constitutional monarchy were riddled with corruption, and the Muslim Brotherhood stood ready to feed on the chaos. In January of that year, mobs set to the torch much of modern Cairo. The army stepped in, « reluctantly » of course, to offer a reprieve. Egyptians had looked to the army for redemption and got dictatorship in return. It was to rule for six decades. More recently, in the aftermath of the 2011 fall of the Mubarak dictatorship, the Supreme Council of the Armed Forces had the run of the country for 16 months. Its reign was an unhappy one, and the protesters who took to Tahrir Square wanted them back in their barracks. Liberals later gave Mr. Morsi, elected to the presidency in June 2012, no small measure of credit for reining in the power of the officer corps and for sacking Field Marshal Mohamed Hussein Tantawi, the de facto strongman of the transitional period. In a note of supreme irony, the secular crowd now proclaims that « the people and the army and the police are one hand. » Yet the revolt that swept the old order in early 2011 had been motivated by a consuming hatred of the police. The police under Mubarak had been lawless, cruel and corrupt. They were seen by secularists and Islamists alike as thugs in uniform; torture and perversity ran rampant in their detention centers. Yet unlike its approach with the military, the Morsi government chose not to take on the police. Indeed, it gave them new weapons and financial concessions in the hope of pacifying them. They did not return the favor: Policemen have been out in the streets demonstrating against the government, and they have steadfastly refused to maintain public order. It is not a pretty bargain that the secularists strike with the army—and the police. The assumption is that this cynicism is warranted if it gets rid of the Muslim Brotherhood. But a larger price will be paid down the road. Fouad Ajami L’Egypte serait-elle condamnée, à l’instar de la proverbiale dinde, à voter pour Noël ? A l’heure, en ce 237e anniversaire de la démocratie américaine, où la place Tahrir s’enthousiasme à nouveau pour la mise au pas, par l’armée jusque là tant honnie, de sa première expérience démocratique … Et où, de la Tunisie à la Libye et à la Syrie sans parler du Yémen et du Bahrein et le tout attisé par les frères ennemis qataris, saoudiens ou iraniens, le tant célébré « printemps arabe » tourne à l’hiver islamique voire au cauchemar … Pendant qu’en Occident nos propres pères Noël nous refont le coup de la surprise devant l’échec largement prévisible du mariage de la carpe islamiste aussi tyrannique qu’incompétente et du lapin démocrate aussi dénué de programme que de leaders … Et qu’à l’instar de nos féministes, universitaires ou artistes qui n’ont que le boycott à la bouche, nos militants pro-homosexuels dénoncent pour cause de pinkwashing la « capitale homosexuelle du Moyen-Orient » Comment ne pas voir, de coups d’état en dictatures avec ou sans uniforme à la pakistanaise, la réalité d’un pouvoir qui, depuis 60 ans, n’a finalement cessé de dépendre de la force militaire ? Egypt on the Brink—With No Clear Way Back It is not a pretty bargain that the secularists have struck with the military. Fouad Ajami The WSJ In the mythology of Egypt, the Nile was the steady river, one that gave life but also one to be watched carefully. Too little water and the earth is scorched, the crops perish and civic order is undone. Too much water and havoc ensues, the granaries are destroyed and the people lose faith in their deities. The myth of a stable « hydraulic society » where the rulers were deities is at a great variance with the history of a land that has known ferocious rebellions, and that has so often fallen short of its expectations of deliverance. There is no deliverance within sight for the untold numbers out in Egypt’s public squares today. The « street » shall not deliver order, adjudicate fundamental struggles between Egyptians keen to live in a secular state and those who have been biding their time to impose an Islamic order. The world beyond the Nile River Valley is witnessing a standoff in the latest battle for the soul of the Arab Spring: the secularists, the modernists, call them what you will, who have flooded Cairo’s Tahrir Square, arrayed against the throngs gathered in support of the Muslim Brotherhood in the shadow of Rab’ah al-Adawiyah Mosque in Cairo’s Nasr district. The mayadin (the squares) can’t say how Egypt ought to be ruled, yet this is what the country is left with. Coups, assassinations and the 30-year dictatorship of Hosni Mubarak robbed the country of the political vitality, and parliamentary practice, it had known for 30 years beginning in 1922 under a functioning constitutional monarchy. In the decades since the military coup of 1952, the country has been served an antimodernist fare by corrupt and nepotistic rulers. Egypt fell behind in the race of nations, grew poorer, more embittered, its ideas of its own specialness battered by harsh economic and social verdicts. It is hard to remember now that this country was once on the Grand Tour, sought by travelers and literati the world over. The green spaces in its cities were eaten up by sprawl and numbers. That great Cairene, the Nobel laureate in literature, Naguib Mahfouz, once spoke of his city as though describing some place from antiquity: He had been born in 1911, Cairo had 700,000 inhabitants, Egypt as a whole less than 11 million people. No one is quite sure of the numbers now, the figure of 90 million is thrown around, and what grace Cairo once had can only by glimpsed in the newsreels and old movies of decades past. Egyptians pride themselves on their country’s civility and good manners. Egypt is not Syria, they say, it is not riven by sectarian fault-lines and hatreds, its armed forces are not killer brigades fighting for a barbarous ruler. Nor is it Libya or Iraq. Egyptians console themselves that slaughter is not part of the nation’s tradition. They point to the final days of Mubarak, brought to court on a stretcher, and contrast it with the gruesome end of Moammar Gadhafi next door in Libya. There is no end to the consolations. Egypt is not Iran, or the Wahhabi realm in the Arabian Peninsula: Faith is light and forgiving here, it was said. Islam came to an ancient country and had to reach an accommodation with a Coptic church indigenous to the land. Pharaonic, Coptic, Greco- Roman, and Islamic ideas and loyalties mixed in a country at the crossroads of continents. All of this is true, but the country is bereft, and may have exhausted its myths. The turn to the army as a deus ex machina for a great, secular-Islamist split is the desperate recourse of a population in trouble. The Egyptian army’s proclamation on Monday that it would give President Mohammed Morsi 48 hours to « meet the demands » of the people would have been laughable had Egypt’s public life at the moment allowed for humor. On Tuesday, Mr. Morsi and his allies in the Muslim Brotherhood’s Freedom and Justice Party rejected the military’s ultimatum. Senior Brotherhood leader Muhammad al-Biltaji called on supporters to defend Mr. Morsi’s « legitimacy, » saying a coup would only succeed « over our dead bodies. » Sadly, Egypt has been here before, in 1952. Political order had given way, the political parties of the constitutional monarchy were riddled with corruption, and the Muslim Brotherhood stood ready to feed on the chaos. In January of that year, mobs set to the torch much of modern Cairo. The army stepped in, « reluctantly » of course, to offer a reprieve. Egyptians had looked to the army for redemption and got dictatorship in return. It was to rule for six decades. More recently, in the aftermath of the 2011 fall of the Mubarak dictatorship, the Supreme Council of the Armed Forces had the run of the country for 16 months. Its reign was an unhappy one, and the protesters who took to Tahrir Square wanted them back in their barracks. Liberals later gave Mr. Morsi, elected to the presidency in June 2012, no small measure of credit for reining in the power of the officer corps and for sacking Field Marshal Mohamed Hussein Tantawi, the de facto strongman of the transitional period. In a note of supreme irony, the secular crowd now proclaims that « the people and the army and the police are one hand. » Yet the revolt that swept the old order in early 2011 had been motivated by a consuming hatred of the police. The police under Mubarak had been lawless, cruel and corrupt. They were seen by secularists and Islamists alike as thugs in uniform; torture and perversity ran rampant in their detention centers. Yet unlike its approach with the military, the Morsi government chose not to take on the police. Indeed, it gave them new weapons and financial concessions in the hope of pacifying them. They did not return the favor: Policemen have been out in the streets demonstrating against the government, and they have steadfastly refused to maintain public order. It is not a pretty bargain that the secularists strike with the army—and the police. The assumption is that this cynicism is warranted if it gets rid of the Muslim Brotherhood. But a larger price will be paid down the road. A young Egyptian engineer trained in Canada, a lyricist about his homeland, wrote to me a few days ago from Cairo about the standoff in the streets. He had gone to see the Tahrir Square crowd, and then the adherents of the Muslim Brotherhood. Tahrir Square, he wrote, was « technically weaker but had the momentum. » He sensed no fear there. The Muslim Brotherhood crowd had the power, but was nervous. « I guess we have reached the worst situation possible, two parties sure of winning. » There is no iron law of stability and social peace in this former land of pharaohs. Pressed to the limit by an economy struggling to keep afloat, the Egyptian people have reached a reckoning. The chronicles telling of their country’s knack for survival, and for pulling back from the brink, will have to be read with caution. E.M. Forster once memorably wrote of Egypt as a country accustomed to harmonizing contending assertions. In the days to come, and in the battle of the mayadin, that proposition will meet an unforgiving test. Mr. Ajami is a senior fellow at Stanford’s Hoover Institution and the author most recently of « The Syrian Rebellion » (Hoover Press, 2012) Voir aussi: Ozymandias Returns Will Mohammed Morsi join the pharaohs, caliphs, pashas and strongmen that came before him? Bret Stephens The WSJ July 1, 2013 On Sunday millions of Egyptians poured into the squares and streets of Cairo, Alexandria and other cities to register intense dissatisfaction with their first freely elected government and demand President Mohammed Morsi’s resignation. On Monday the Egyptian military gave Mr. Morsi 48 hours to clean up his act, or else. Democracy in Egypt has not been fun while it’s lasted. Where do things go from here? The good news is that the political bloom is off the Islamist rose. The Muslim Brotherhood, so sure-footed when it came to seizing power, proved surprisingly ham-fisted when it came to consolidating it. Islam is the answer, goes the Brotherhood’s famous slogan—but not, as Egyptians are learning with each passing day, to the questions of how to shorten gas lines, or maintain public security, or attract foreign investment, or build foreign-exchange reserves. There’s also good news in that the army remains a willing and viable check on the Brotherhood’s political power and street muscle. There were reasons to wonder about that after the military squandered much of its support with its long interregnum (and constitutional shenanigans) following Hosni Mubarak’s downfall, and then again after Mr. Morsi sacked Mubarak-era Defense Minister Mohamed Tantawi and replaced him with Abdel Fattah Al Sisi. Yet Gen. Sisi proved he was his own man on Monday when he issued the ultimatum to his presumptive boss, warning that « if the people’s demands are not met [by Wednesday], the armed forces will announce a road map for the future and take a set of procedures and . . . oversee its implementation with the participation of all political forces. » Sounds lovely. But then, as Napoleon told one of his generals, « if you start to take Vienna, take Vienna. » On Monday a spokesman for Gen. Sisi insisted the army was not threatening a coup, but what happens if Mr. Morsi calls his bluff? In fact, Mr. Morsi must call the general’s bluff if he’s to retain the prerogatives of his office. And Gen. Sisi must make good on his threat—or else go to prison for gross insubordination. Perhaps there’s a face-saving compromise, like calling for a referendum on whether to hold early elections. But that would take months to arrange, and Egyptians are a people who have run out of patience. One side or the other will have to back down, humiliated, or there will be a confrontation. If it’s the latter, it could be along the lines of Algeria’s savage civil war in the 1990s, also the result of a military coup after an Islamist electoral victory. Egypt today is awash in small arms, mainly from Libya and Sudan. The conscript army is not well-disciplined, as it showed in its brutal assault on Coptic protesters in Cairo in October 2011. Police forces are a power unto themselves. And the Brotherhood, willful and accustomed to operating as a secret organization, can call on the support of millions of Egyptians. Nobody should want this outcome: The blood orgies of Syria are agony enough for the Middle East. What about the other choices? There will be a temptation in the West to support Mr. Morsi on grounds that, for all of his political misjudgments, he is a legitimately elected leader trying to stand his ground against street mobs abetted by army generals. So far Mr. Obama has said little more about Egypt than to call for « restraint » on both sides. But he had flattering things to say about Mr. Morsi during last November’s Gaza crisis, and the default position in American diplomacy is always to support whoever is in power. Then again, to support Mr. Morsi is to repeat the mistake Mr. Obama made in the first two years of his presidency, when U.S. policy amounted to flattering Hosni Mubarak. (Hillary Clinton, genius diplomat, went so far as to call the dictator a family friend in 2009.) At least the Mubarak regime could be described as secular and pro-American, and reasonably committed to peace with Israel. That doesn’t exactly describe Mr. Morsi, who showed he had all of Mr. Mubarak’s contempt for civil liberties with none of his talents for governance. It’s a sign of how atrophied U.S. influence in Egypt has become under Mr. Obama that his views count for so little—assuming he has views at all. For the rest of us, the lesson from Egypt is that democracy may be a blessing for people capable of self-government, but it’s a curse for those who are not. There is a reason that Egypt has been governed by pharaohs, caliphs, pashas and strongmen for 6,000 years. The best outcome for Egypt would be early elections, leading to the Brotherhood’s defeat at the hands of a reformist, technocratic government with military support. The second-best outcome would be a bloodless military coup, followed by the installment of a reformist government. The chances for either outcome are slight. But the Brotherhood will not go quietly. Get ready for a bloody road ahead. Voir également: The Next Phase of the Arab Spring Analysis Stratfor July 3, 2013 The Arab Spring was an exercise in irony, nowhere more so than in Egypt. On the surface, it appeared to be the Arab equivalent of 1989 in Eastern Europe. There, the Soviet occupation suppressed a broad, if not universal desire for constitutional democracy modeled on Western Europe. The year 1989 shaped a generation’s thinking in the West, and when they saw the crowds in the Arab streets, they assumed that they were seeing Eastern Europe once again. There were certainly constitutional democrats in the Arab streets in 2011, but they were not the main thrust. Looking back on the Arab Spring, it is striking how few personalities were replaced, how few regimes fell, and how much chaos was left in its wake. The uprising in Libya resulted in a Western military intervention that deposed former leader Moammar Gadhafi and replaced him with massive uncertainty. The uprising in Syria has not replaced Syrian President Bashar al Assad but instead sparked a war between him and an Islamist-dominated opposition. Elsewhere, revolts have been contained with relative ease. The irony of the Arab Spring was that in opening the door for popular discontent, it demonstrated that while the discontent was real, it was neither decisive nor clearly inclined toward constitutional democracy. This is what makes Egypt so interesting. The Egyptian uprising has always been the most ambiguous even while being cited as the most decisive. It is true that former President Hosni Mubarak fell in 2011. It is also true that elections were held in 2012, when a leader of the Muslim Brotherhood’s election as president highlighted the reality that a democratic election is not guaranteed to produce a liberal democratic result. In any case, the now-deposed president, Mohammed Morsi, won by only a slim margin and he was severely constrained as to what he could do. But the real issue in Egypt has always been something else. Though a general was forced out of office in 2011, it was not clear that the military regime did not remain, if not in power, then certainly the ultimate arbiter of power in Egyptian politics. Over the past year, so long as Morsi remained the elected president, the argument could be made that the military had lost its power. But just as we argued that the fall of Hosni Mubarak had been engineered by the military in order to force a succession that the aging Mubarak resisted, we can also argue that while the military had faded into the background, it remained the decisive force in Egypt. Modern Egypt was founded in 1952 in a military coup by Col. Gamal Abdel Nasser. Nasser was committed to modernizing Egypt, and he saw the army as the only real instrument of modernization. He was a secularist committed to the idea that Arab nations ought to be united, but not Islamist by any means. He was a socialist, but not a communist. Above all else, he was an Egyptian army officer committed to the principle that the military guaranteed the stability of the Egyptian nation. When the uprisings of the Arab Spring came, Nasser’s successors used the unrest to force Mubarak out, and then they stepped back. It is interesting to consider whether they would have been content to retain their institutional position under a Muslim Brotherhood-led government. However, Morsi never really took control of the machinery of government, partly because he was politically weak, partly because the Muslim Brotherhood was not ready to govern, and partly because the military never quite let go. This dynamic culminated in the demonstrations of this « Egyptian Summer. » The opposition leadership appears to support constitutional democracy. Whether the masses in the streets do as well or whether they simply dislike the Muslim Brotherhood is difficult to tell, but we suspect their interests are about food and jobs more than about the principles of liberalism. Still, there was an uprising, and once again the military put it to use. In part, the military did not want to see chaos, and it saw itself as responsible for averting it. In part, the military distrusted the Muslim Brotherhood and was happy to see it forced out of office. As in 2011, the army acted overtly to maintain order and simultaneously to shape the Egyptian political order. They deposed Morsi, effectively replacing him with a more secular and overtly liberal leadership. But what must be kept in mind is that, just as in 2011, when the military was willing to pave the way for Morsi, so too is it now paving the way for his opposition. And this is the crucial point — while Egypt is increasingly unstable, the army is shaping what order might come out of it. The military is less interested in the ideology of the government than in containing chaos. Given this mission, it does not see itself as doing more than stepping back. It does not see itself as letting go. The irony of the Egyptian Arab Spring is that while it brought forth new players, it has not changed the regime or the fundamental architecture of Egyptian politics. The military remains the dominant force, and while it is prepared to shape Egypt cleverly, what matters is that it will continue to shape Egypt. Therefore, while it is legitimate to discuss a military coup, it is barely legitimate to do so. What is going on is that there is broad unhappiness in Egypt that is now free to announce its presence. This unhappiness takes many ideological paths, as well as many that have nothing to do with ideology. Standing on stage with the unhappiness is the military, manipulating, managing and containing it. Everyone else, all of the politicians, come and go, playing a short role and moving on — the military and the crowd caught in a long, complex and barely comprehensible dance. Voir encore: From Islamist to Freethinker At age 19, Amir Ahmad Nasr was perched awkwardly between a politicized religious culture and modern skeptical rationalism. Paul Berman The WSJ July 1, 2013 Amir Ahmad Nasr was born in 1986 in Sudan, but when he was still a little child his father’s career brought the family to Qatar and Kuala Lumpur, Malaysia, and young Mr. Nasr began his education at Islamic schools in those places. Memorization of the Quran was the core curriculum. His teachers taught him that Jews drink the blood of children and conspire against Islam. On Fridays he said « amen » to prayers calling for the destruction of the Jews. He dreamed of heroism: « I wished I could die and martyr myself for Islam and occupied Palestine. » He also learned English and, as a teenager in Kuala Lumpur, he took to roaming the Internet, where he came across blogs by liberal-minded young Muslims a few years older than himself. His Internet explorations offered an alternative education, which meant that, after a while, he hardly knew where he stood in regard to Islam, the Jews, the U.S. and the world in general. Nor did he know what culture was his own. In a vivid passage in his coming-of-age memoir, « My Isl@m, » he confesses to a friend that he is losing faith in Islam, to which the friend responds: « I understand you’ve got your issues with all those idiotic bearded monkeys who belong in a zoo. Even I hate them and think they’re giving Islam a bad name, but what about the Book, dude? » The Book is the Quran, and the dialogue makes it clear that Mr. Nasr and his friend, while pondering theology in Malaysia, have adopted personalities drawn from American popular culture, and they are dude and dude, or bro and bro, and life is a rap song. By the age of 19, Mr. Nasr was, in short, a young man perched awkwardly on the world’s largest tectonic fault line, which is the conflict between a traditional and sometimes politicized religious culture and the modern culture of skeptical rationalism, fatefully tinged with American ideas and American slang. Mr. Nasr came up with a brilliant way of coping with the awkward circumstance. He started a blog of his own, called « The Sudanese Thinker, » which allowed him to conduct his interior debate in public. « I ventured into the virtual desert to contemplate some truths and discuss the meaning of things, » he writes. My Isl@m By Amir Ahmad Nasr (St. Martin’s, 322 pages, $26.99) His memoir records the stages of his contemplation—his worried thoughts about Islam and anti-Semitism; his excited discovery of contemporary British and American atheist authors, especially Sam Harris; his resentful indignation at the hostility to Islam that seemed to him endemic on right-wing American blogs; his discovery of still other American writers who argued for flexible interpretations of religion, including his own religion; his joy at discovering a liberal philosophical school among the august thinkers of Sudanese Islam; and his resolve to make his own future contributions to a modernized and science-friendly Islam. He looks into Sufi Islam, which, for all its spirit of tolerance, seems to him « nowhere near intellectually satisfying as I had hoped it would be, » not to mention marred by « blind guru-worship. » And then, upon further reflection, he finds himself thinking, « The Sufis, Islam’s mystics, were right. They were right! »—though he still doesn’t go for the guru-worship. Meanwhile, as « The Sudanese Thinker, » he chatted with readers around the world and participated in online activist campaigns. Fame brought him invitations to Washington, D.C., Beirut and other glamorous places, where he met, as he says, « the crème de la crème of the Arab blogosphere. » And then, early in 2011, the Arab Spring went into bloom across the Middle East and North Africa, and, in the glorious early phase of the uprisings, his own little posse of sharp-tongued liberal bloggers turned out to be the revolutionary vanguard. From Malaysia, he even managed to play a useful role. The old Egyptian dictatorship of Hosni Mubarak tried to fend off the revolution by turning off the Internet. Mr. Nasr responded: « I loaded up my Internet browser, and readied my humble digital tools. » And the digital tools allowed him to circumvent the censorship. As for the Arab Spring’s subsequent, less glorious phases—the rise of anti-liberal Islamist parties across much of the region—well, he takes a long view of revolutions, which I think is wise. He figures that today’s Muslim Brotherhood-dominated era won’t last forever. « Yes, there are challenges, but I think the fear barrier has been broken and that’s why we should be optimistic. » « My Isl@m » displays the charm of a good blog—irreverent, nonchalant, open to fresh ideas, generous to other writers, ostentatiously unpretentious and secretly grandiose. Mr. Nasr appears to be convinced that his own intellectual trajectory—from medieval-style Quran-memorizing to thoughtful dude, digitally loquacious—reflects a deep trend in world history, with the Internet as prime mover. He never openly states this conviction. And yet it animates the book, and the possibility that he may be right imparts to his pages an electric glow, as if from an LCD screen. Then again, a blogger’s frenetic life doesn’t lend itself to mastering the best which has been thought and said. Mr. Nasr’s ruminations on science and religion have led him to a pro-Darwin Christian evangelist in the U.S. named Michael Dowd, whose help he graciously acknowledges. Only, I wonder if Mr. Nasr is aware of how vast and profound is the literature on science-and-religion themes, and how varied are its currents. For all his magnificent indignation against modern-day anti-Semitism, Mr. Nasr dismisses Israel as a colonialist error—an uncharacteristic concession to fashionable opinion on his part. But it is hard to see how a Muslim liberalism can advance without arriving at a deeper and more sympathetic understanding of Jewish history and Zionism. Political theory is another weak point: Mr. Nasr counts himself a libertarian and never explains why. This sort of thing, the offhand quality of Mr. Nasr’s opinions, may be OK for a blogger, and doubly OK for a student. But what will happen if, as Mr. Nasr expects, the Arab Spring arrives at still another phase, and liberals like him are given another chance? I hope they will be prepared. Mr. Berman is a senior editor of the New Republic and the author, most recently, of « The Flight of the Intellectuals. » Voir par ailleurs: Tamarod, la rébellion qui veut chasser les Frères musulmans du pouvoir Sophie Anmuth Slate Afrique 25/06/2013 La campagne cherche à faire démissionner le président islamiste Morsi à l’occasion des manifestations prévues le 30 juin prochain. Elle se vante d’avoir recueilli 15 millions de signatures pour demander le démission du président Mohamed Morsi. Autrement dit plus que le total des voix qui a permis la victoire du candidat des Frères musulmans. La campagne «Tamarod» ( rébellion) appelle les Egyptiens à «retirer leur confiance» au président issu des Frères musulmans, Mohamed Morsi, et à le forcer ainsi à démissionner, comme si le peuple était le parlement et pouvait voter contre le chef de l’Etat. La campagne reproche aux Frères musulmans d’avoir «augmenté le nombre des martyrs du peuple égyptien»: en effet depuis l’élection de Morsi des dizaines de personnes ont trouvé la mort dans des manifestations ou affrontements de nature politique ou sociale. Indépendance Elle les accuse aussi essayer d’intimider les figures de l’opposition avec des procès ou des campagnes dans les médias (contre par exemple Baradei ou Bassem Youssef). D’autres accusations sont plus tendancieuses, comme celle qui reproche au gouvernement de chercher à vendre l’Egypte à ses protecteurs (ici c’est le Qatar et son aide généreuse qui sont visés – sans davantage de preuves, il faut bien le dire). La campagne «Tamarod» (Rébellion) a reçu le soutien du Front de Salut national, qui est une coalition de partis et figures de l’opposition, du parti du Dostour, par exemple (parti de l’ancien directeur de l’Agence internationale pour l’énergie atomique et opposant à Moubarak, Mohamed El Baradei), du groupe d’activistes du 6 avril (fondé en 2008), mais aussi des salafistes. La Gamaa islamiya, elle, a lancé une contre-initative, incitant à l’«impartialité» et à la stabilité. «Tamarod» reçoit ces soutiens politiques plusieurs semaines après le début de ses activités, et se déclare indépendante de toute tendance politique. Al’occasion de l’anniversaire de l’investiture de Mohamed Morsi, «Rébellion» a l’intention d’organiser une marche sur le palais présidentiel et de soumettre la pétition au procureur-général, afin d’exiger la démission du président. Des élections présidentielles anticipées —un an seulement après l’élection de Mohamed Morsi— pourraient alors avoir lieu. Ecueils Juridiquement, l’initiative n’est pourtant pas très viable. Les porte-paroles du parti des Frères musulmans, Liberté et Justice, nient toute importance à cette pétition et rappellent que seule vaut la légitimité des élections. Le 16 mai dernier, une plainte a été déposée contre les organisateurs de la campagne: ils chercheraient à faire plonger le pays dans le chaos, détruire l’unité nationale. Un peu d’exagération. L’autre chef d’accusation, par contre, ne semble pas illégitime: chercher à renverser le gouvernement. Des campagnes de désobéissance civile ont été lancées régulièrement dans plusieurs villes d’Egypte notamment celles du Canal de Suez. Ici c’est à l’échelle nationale que le mouvement essaie de prendre forme. Voir enfin: Les Occidentaux pris de court par les évènements en Égypte Renaud Girard 03/07/2013 Personne en Europe et aux États-Unis n’avait prévu la chute de Moubarak et la victoire électorale des Frères musulmans. Leur chute est également une surprise, compliquant encore les stratégies diplomatiques au Moyen-Orient. Quand l’Égypte passa, dans les années 1950, d’un régime monarchique bon enfant à une dictature militaire nationaliste, les Occidentaux eurent déjà le plus grand mal à bien gérer le tournant. Comme s’il y avait une malédiction diplomatique propre au delta du Nil, soixante ans plus tard, les puissances occidentales sont à nouveau prises de court par les événements du Caire. En 2011, personne, dans les Chancelleries et dans les universités américaines et européennes, n’avait prévu la chute de Moubarak, dans une révolution de rue que l’armée laissait faire. Ensuite, personne n’avait prévu une victoire électorale aussi massive des Frères musulmans, lesquels, après tout, n’avaient pris qu’en route la révolution. Enfin, à peine l’Amérique s’était-elle persuadée que les Frères musulmans, islamistes mais procapitalistes, étaient la bonne solution pour le monde arabo-musulman, à peine Washington avait-il persuadé ses alliés qu’il fallait partout au Moyen-Orient soutenir les Frères sunnites contre l’axe chiite présidé par l’Iran, que ce modèle se mettait à s’effriter dangereusement, en Tunisie d’abord, puis en Turquie, et maintenant en Égypte. Quand les tentatives de prospective des ministères, des think-tanks et des médias se trouvent régulièrement démenties par les faits, le pilotage stratégique devient extrêmement difficile au Moyen-Orient, même si les Occidentaux ont renoncé au rêve néoconservateur d’y imposer l’État de droit par la force. L’armée égyptienne formée, équipée et financée par les Américains Ils ne manquent pas pour autant de leviers. Le premier est celui de l’armée égyptienne, formée, équipée et financée par les Américains, qui lui conseillent la modération et le «maintien d’une dynamique démocratique» dans le pays. Le secrétaire d’État John Kerry suit personnellement le dossier, lui qui a décidé de consacrer sa mandature à «l’arc de crise» en général et au Levant en particulier. Quand le Quai d’Orsay appelle de ses vœux un «signe démocratique fort» venant du Caire, il est en plein accord avec le département d’État américain et le Foreign Office britannique. Il s’agit de constituer un gouvernement d’union nationale, où entreraient des technocrates compétents et des personnalités de l’opposition anti-islamiste. L’opposition n’a ni leader, ni programme Les Occidentaux ne peuvent aller plus loin dans leurs initiatives, car ils ont constaté l’aporie devant laquelle se trouve l’opposition. Cette dernière est la simple addition des anti-islamistes classiques et des déçus de Morsi, qui avaient cru aux promesses de restauration économique et sociale du président Frère musulman. Les foules sont nombreuses dans la rue, mais l’opposition n’a ni leader, ni programme, ni ciment idéologique. Les Occidentaux le regrettent, mais elle n’est pas pour le moment une solution de remplacement! Paris, Londres et Washington ne veulent pas d’élections immédiates dans une atmosphère aussi chaude. Mais ils sont conscients qu’il est devenu presque impossible à Morsi de finir tranquillement son mandat. 3 Responses to Printemps arabe: L’Egypte vote à nouveau pour Noël (Like turkeys voting for Christmas) 1. […] ne pas voir, avec le politologue libano-américain Fouad Ajami, la réalité d’un pouvoir qui, depuis 60 ans, n’a toujours finalement dépendu que de la force militaire […] J'aime 2. […] Printemps arabe: L’Egypte vote à nouveau pour Noël (Like turkeys voting for Christmas) (jcdurbant.wordpress.com) […] J'aime 3. […] Printemps arabe: L’Egypte vote à nouveau pour Noël (Like turkeys voting for Christmas) […] J'aime Répondre Entrez vos coordonnées ci-dessous ou cliquez sur une icône pour vous connecter: Logo WordPress.com Vous commentez à l'aide de votre compte WordPress.com. Déconnexion / Changer ) Photo Google Vous commentez à l'aide de votre compte Google. Déconnexion / Changer ) Image Twitter Vous commentez à l'aide de votre compte Twitter. Déconnexion / Changer ) Photo Facebook Vous commentez à l'aide de votre compte Facebook. Déconnexion / Changer ) Connexion à %s Ce site utilise Akismet pour réduire les indésirables. En savoir plus sur la façon dont les données de vos commentaires sont traitées. %d blogueurs aiment cette page : South Jordan Wedding Florists Wedding florists create beautiful arrangements to set the mood for your big day. A wedding florist will help determine your style and design bouquets, centerpieces, and more to decorate your venue. We recommend hiring a wedding florist in South Jordan about 10 months before your big day to ensure you have plenty of time to turn your dreams into reality. 2 results: • Wedding Florists • Utah • Salt Lake City • South Jordan • Clear all • List • Images • Map Sweet William Floral & Design Sweet William Floral & Design 8 reviews · Wedding Florists · South Jordan, UT Sweet William Floral & Design is a full-service florist shop located in South Jordan, Utah that provides custom, exceptional floral designs for weddings and other events. We understand that each couple is unique and we belive that your flowers should reflect that individuality. Our expert florists... (Wedding Florists South Jordan) Typical Price $950 Poppy & Bloom Floristry Poppy & Bloom Floristry 1 review · Wedding Florists · South Jordan, UT Poppy & Bloom Floristry is a wedding florist located in South Jordan, Utah. They specialize in providing gorgeous and unforgettable arrangements to couples across all of Salt Lake City and Northern Utah. Poppy & Bloom Floristry is passionate about what they do and they aim to deliver stunning... (Wedding Florists South Jordan) Typical Price $1,500 Beehive Floral Co. Beehive Floral Co. 55 reviews · Wedding Florists \| 13.6 miles from South Jordan, UT Every arrangement I create begins with a journey. From an early morning foraging trip along a river, gathering hidden blooms and watching the morning birds swoop by to the bounty of my own carefully curated cut flower garden to truckloads of blooms from nearby flower farms committed to sustainable... (Wedding Florists Salt Lake City) Apiana Blooms Apiana Blooms 2 reviews · Wedding Florists \| 13.8 miles from South Jordan, UT Apiana Blooms is a farm-to-bouquet wedding florist located near the Cottonwood Canyons in Salt Lake City, Utah. They pride themselves on their beautiful, local flowers that are sustainably grown on their farm. Their goal is to bring your unique vision to life through their unforgettable... (Wedding Florists Salt Lake City) Lei Away Lei Away Wedding Florists \| 13.8 miles from South Jordan, UT Lei Away is a wedding florist business based in Orem, Utah, which also serves the Salt Lake City area. Here, couples will find the perfect complement to a tropical or island-inspired wedding. The florists can create leis for not only the bride and groom, but also the entire wedding party. Whether... (Wedding Florists Orem) Urban Chateau Floral Urban Chateau Floral 5 reviews · Wedding Florists \| 14.3 miles from South Jordan, UT We are excited to hear from you and to start planning your upcoming wedding with our expertise. We are inspired by the up and coming trends and have been designing for fifteen years now. Overall we love a lush, romantic, mountain vibe and create that by sourcing the freshest flowers locally and... (Wedding Florists Salt Lake City) Flower Imagination Flower Imagination Wedding Florists \| 14.6 miles from South Jordan, UT Flower Imagination is a flower design studio located in the heart of Salt Lake City at 481 E. South Temple and is specializing in wedding and event decorations. Our designers hail from some of the world's top floral design schools. Our specialty is ground in the rich history of European floral... (Wedding Florists Salt Lake City) Florette Florette 12 reviews · Wedding Florists \| 25.7 miles from South Jordan, UT A floral design company in Park City, Utah, Florette specializes in imaginative and innovative wedding blooms. They love telling a couple’s story through their arrangements, focusing on mood, imagination, and the celebration of beauty. Accommodating both intimate weddings and grand, formal... (Wedding Florists Park City) Expand Your Search for South Jordan Wedding Florists WeddingWire celebrates love Learn more	# Printemps arabe: L’Egypte vote à nouveau pour Noël (Like turkeys voting for Christmas) ![Turkeys voting for Christmas](https://i0.wp.com/www.frontrowgrunt.co.za/wp-content/uploads/turkeys-UKIP-VOTING-FOR-CHRISTMAS.jpg) Feminists, Christians, Professors for Academic Freedom and Gays have only one country in the middle east that recognizes their human rights and respects their right to live openly as the people they are. That country is Israel. (Dry Bones cartoon.) --- ## The Next Phase of the Arab Spring Stratfor, July 3, 2013 The Arab Spring was an exercise in irony, nowhere more so than in Egypt. On the surface, it appeared to be the Arab equivalent of 1989 in Eastern Europe. There, the Soviet occupation suppressed a broad, if not universal desire for constitutional democracy modeled on Western Europe. The year 1989 shaped a generation’s thinking in the West, and when they saw the crowds in the Arab streets, they assumed that they were seeing Eastern Europe once again. There were certainly constitutional democrats in the Arab streets in 2011, but they were not the main thrust. Looking back on the Arab Spring, it is striking how few personalities were replaced, how few regimes fell, and how much chaos was left in its wake. The uprising in Libya resulted in a Western military intervention that deposed former leader Moammar Gadhafi and replaced him with massive uncertainty. The uprising in Syria has not replaced Syrian President Bashar al Assad but instead sparked a war between him and an Islamist-dominated opposition. Elsewhere, revolts have been contained with relative ease. The irony of the Arab Spring was that in opening the door for popular discontent, it demonstrated that while the discontent was real, it was neither decisive nor clearly inclined toward constitutional democracy. This is what makes Egypt so interesting. The Egyptian uprising has always been the most ambiguous even while being cited as the most decisive. It is true that former President Hosni Mubarak fell in 2011. It is also true that elections were held in 2012, when a leader of the Muslim Brotherhood’s election as president highlighted the reality that a democratic election is not guaranteed to produce a liberal democratic result. In any case, the now-deposed president, Mohammed Morsi, won by only a slim margin and he was severely constrained as to what he could do. But the real issue in Egypt has always been something else. Though a general was forced out of office in 2011, it was not clear that the military regime did not remain, if not in power, then certainly the ultimate arbiter of power in Egyptian politics. Over the past year, so long as Morsi remained the elected president, the argument could be made that the military had lost its power. But just as we argued that the fall of Hosni Mubarak had been engineered by the military in order to force a succession that the aging Mubarak resisted, we can also argue that while the military had faded into the background, it remained the decisive force in Egypt. Modern Egypt was founded in 1952 in a military coup by Col. Gamal Abdel Nasser. Nasser was committed to modernizing Egypt, and he saw the army as the only real instrument of modernization. He was a secularist committed to the idea that Arab nations ought to be united, but not Islamist by any means. He was a socialist, but not a communist. Above all else, he was an Egyptian army officer committed to the principle that the military guaranteed the stability of the Egyptian nation. When the uprisings of the Arab Spring came, Nasser’s successors used the unrest to force Mubarak out, and then they stepped back. It is interesting to consider whether they would have been content to retain their institutional position under a Muslim Brotherhood–led government. However, Morsi never really took control of the machinery of government, partly because he was politically weak, partly because the Muslim Brotherhood was not ready to govern, and partly because the military never quite let go. This dynamic culminated in the demonstrations of this “Egyptian Summer.” The opposition leadership appears to support constitutional democracy. Whether the masses in the streets do as well or whether they simply dislike the Muslim Brotherhood is difficult to tell, but we suspect their interests are about food and jobs more than about the principles of liberalism. Still, there was an uprising, and once again the military put it to use. In part, the military did not want to see chaos, and it saw itself as responsible for averting it. In part, the military distrusted the Muslim Brotherhood and was happy to see it forced out of office. As in 2011, the army acted overtly to maintain order and simultaneously to shape the Egyptian political order. They deposed Morsi, effectively replacing him with a more secular and overtly liberal leadership. But what must be kept in mind is that, just as in 2011, when the military was willing to pave the way for Morsi, so too is it now paving the way for his opposition. And this is the crucial point — while Egypt is increasingly unstable, the army is shaping what order might come out of it. The military is less interested in the ideology of the government than in containing chaos. Given this mission, it does not see itself as doing more than stepping back. It does not see itself as letting go. The irony of the Egyptian Arab Spring is that while it brought forth new players, it has not changed the regime or the fundamental architecture of Egyptian politics. The military remains the dominant force, and while it is prepared to shape Egypt cleverly, what matters is that it will continue to shape Egypt. Therefore, while it is legitimate to discuss a military coup, it is barely legitimate to do so. What is going on is that there is broad unhappiness in Egypt that is now free to announce its presence. This unhappiness takes many ideological paths, as well as many that have nothing to do with ideology. Standing on stage with the unhappiness is the military, manipulating, managing and containing it. Everyone else, all of the politicians, come and go, playing a short role and moving on — the military and the crowd caught in a long, complex and barely comprehensible dance. --- ## Ozymandias Returns Bret Stephens, The Wall Street Journal, July 1, 2013 On Sunday millions of Egyptians poured into the squares and streets of Cairo, Alexandria and other cities to register intense dissatisfaction with their first freely elected government and demand President Mohammed Morsi’s resignation. On Monday the Egyptian military gave Mr. Morsi 48 hours to clean up his act, or else. Democracy in Egypt has not been fun while it’s lasted. Where do things go from here? The good news is that the political bloom is off the Islamist rose. The Muslim Brotherhood, so sure-footed when it came to seizing power, proved surprisingly ham-fisted when it came to consolidating it. Islam is the answer, goes the Brotherhood’s famous slogan—but not, as Egyptians are learning with each passing day, to the questions of how to shorten gas lines, or maintain public security, or attract foreign investment, or build foreign-exchange reserves. There’s also good news in that the army remains a willing and viable check on the Brotherhood’s political power and street muscle. There were reasons to wonder about that after the military squandered much of its support with its long interregnum (and constitutional shenanigans) following Hosni Mubarak’s downfall, and then again after Mr. Morsi sacked Mubarak-era Defense Minister Mohamed Tantawi and replaced him with Abdel Fattah Al Sisi. Yet Gen. Sisi proved he was his own man on Monday when he issued the ultimatum to his presumptive boss, warning that “if the people’s demands are not met [by Wednesday], the armed forces will announce a road map for the future and take a set of procedures and . . . oversee its implementation with the participation of all political forces.” Sounds lovely. But then, as Napoleon told one of his generals, “if you start to take Vienna, take Vienna.” On Monday a spokesman for Gen. Sisi insisted the army was not threatening a coup, but what happens if Mr. Morsi calls his bluff? In fact, Mr. Morsi must call the general’s bluff if he’s to retain the prerogatives of his office. And Gen. Sisi must make good on his threat—or else go to prison for gross insubordination. Perhaps there’s a face-saving compromise, like calling for a referendum on whether to hold early elections. But that would take months to arrange, and Egyptians are a people who have run out of patience. One side or the other will have to back down, humiliated, or there will be a confrontation. If it’s the latter, it could be along the lines of Algeria’s savage civil war in the 1990s, also the result of a military coup after an Islamist electoral victory. Egypt today is awash in small arms, mainly from Libya and Sudan. The conscript army is not well-disciplined, as it showed in its brutal assault on Coptic protesters in Cairo in October 2011. Police forces are a power unto themselves. And the Brotherhood, willful and accustomed to operating as a secret organization, can call on the support of millions of Egyptians. Nobody should want this outcome: The blood orgies of Syria are agony enough for the Middle East. What about the other choices? There will be a temptation in the West to support Mr. Morsi on grounds that, for all of his political misjudgments, he is a legitimately elected leader trying to stand his ground against street mobs abetted by army generals. So far Mr. Obama has said little more about Egypt than to call for “restraint” on both sides. But he had flattering things to say about Mr. Morsi during last November’s Gaza crisis, and the default position in American diplomacy is always to support whoever is in power. Then again, to support Mr. Morsi is to repeat the mistake Mr. Obama made in the first two years of his presidency, when U.S. policy amounted to flattering Hosni Mubarak. (Hillary Clinton, genius diplomat, went so far as to call the dictator a family friend in 2009.) At least the Mubarak regime could be described as secular and pro-American, and reasonably committed to peace with Israel. That doesn’t exactly describe Mr. Morsi, who showed he had all of Mr. Mubarak’s contempt for civil liberties with none of his talents for governance. It’s a sign of how atrophied U.S. influence in Egypt has become under Mr. Obama that his views count for so little—assuming he has views at all. For the rest of us, the lesson from Egypt is that democracy may be a blessing for people capable of self-government, but it’s a curse for those who are not. There is a reason that Egypt has been governed by pharaohs, caliphs, pashas and strongmen for 6,000 years. The best outcome for Egypt would be early elections, leading to the Brotherhood’s defeat at the hands of a reformist, technocratic government with military support. The second-best outcome would be a bloodless military coup, followed by the installment of a reformist government. The chances for either outcome are slight. But the Brotherhood will not go quietly. Get ready for a bloody road ahead. --- ## From Islamist to Freethinker Paul Berman, The Wall Street Journal, July 1, 2013 Amir Ahmad Nasr was born in 1986 in Sudan, but when he was still a little child his father’s career brought the family to Qatar and Kuala Lumpur, Malaysia, and young Mr. Nasr began his education at Islamic schools in those places. Memorization of the Quran was the core curriculum. His teachers taught him that Jews drink the blood of children and conspire against Islam. On Fridays he said “amen” to prayers calling for the destruction of the Jews. He dreamed of heroism: “I wished I could die and martyr myself for Islam and occupied Palestine.” He also learned English and, as a teenager in Kuala Lumpur, he took to roaming the Internet, where he came across blogs by liberal-minded young Muslims a few years older than himself. His Internet explorations offered an alternative education, which meant that, after a while, he hardly knew where he stood in regard to Islam, the Jews, the U.S. and the world in general. Nor did he know what culture was his own. In a vivid passage in his coming-of-age memoir, My Isl@m, he confesses to a friend that he is losing faith in Islam, to which the friend responds: “I understand you’ve got your issues with all those idiotic bearded monkeys who belong in a zoo. Even I hate them and think they’re giving Islam a bad name, but what about the Book, dude?” The Book is the Quran, and the dialogue makes it clear that Mr. Nasr and his friend, while pondering theology in Malaysia, have adopted personalities drawn from American popular culture, and they are dude and dude, or bro and bro, and life is a rap song. By the age of 19, Mr. Nasr was, in short, a young man perched awkwardly on the world’s largest tectonic fault line, which is the conflict between a traditional and sometimes politicized religious culture and the modern culture of skeptical rationalism, fatefully tinged with American ideas and American slang. Mr. Nasr came up with a brilliant way of coping with the awkward circumstance. He started a blog of his own, called The Sudanese Thinker, which allowed him to conduct his interior debate in public. “I ventured into the virtual desert to contemplate some truths and discuss the meaning of things,” he writes. My Isl@m By Amir Ahmad Nasr (St. Martin’s, 322 pages, $26.99) His memoir records the stages of his contemplation—his worried thoughts about Islam and anti-Semitism; his excited discovery of contemporary British and American atheist authors, especially Sam Harris; his resentful indignation at the hostility to Islam that seemed to him endemic on right-wing American blogs; his discovery of still other American writers who argued for flexible interpretations of religion, including his own religion; his joy at discovering a liberal philosophical school among the august thinkers of Sudanese Islam; and his resolve to make his own future contributions to a modernized and science-friendly Islam. He looks into Sufi Islam, which, for all its spirit of tolerance, seems to him “nowhere near intellectually satisfying as I had hoped it would be,” not to mention marred by “blind guru-worship.” And then, upon further reflection, he finds himself thinking, “The Sufis, Islam’s mystics, were right. They were right!”—though he still doesn’t go for the guru-worship. Meanwhile, as The Sudanese Thinker, he chatted with readers around the world and participated in online activist campaigns. Fame brought him invitations to Washington, D.C., Beirut and other glamorous places, where he met, as he says, “the crème de la crème of the Arab blogosphere.” And then, early in 2011, the Arab Spring went into bloom across the Middle East and North Africa, and, in the glorious early phase of the uprisings, his own little posse of sharp-tongued liberal bloggers turned out to be the revolutionary vanguard. From Malaysia, he even managed to play a useful role. The old Egyptian dictatorship of Hosni Mubarak tried to fend off the revolution by turning off the Internet. Mr. Nasr responded: “I loaded up my Internet browser, and readied my humble digital tools.” And the digital tools allowed him to circumvent the censorship. As for the Arab Spring’s subsequent, less glorious phases—the rise of anti-liberal Islamist parties across much of the region—well, he takes a long view of revolutions, which I think is wise. He figures that today’s Muslim Brotherhood–dominated era won’t last forever. “Yes, there are challenges, but I think the fear barrier has been broken and that’s why we should be optimistic.” My Isl@m displays the charm of a good blog—irreverent, nonchalant, open to fresh ideas, generous to other writers, ostentatiously unpretentious and secretly grandiose. Mr. Nasr appears to be convinced that his own intellectual trajectory—from medieval-style Quran-memorizing to thoughtful dude, digitally loquacious—reflects a deep trend in world history, with the Internet as prime mover. He never openly states this conviction. And yet it animates the book, and the possibility that he may be right imparts to his pages an electric glow, as if from an LCD screen. Then again, a blogger’s frenetic life doesn’t lend itself to mastering the best which has been thought and said. Mr. Nasr’s ruminations on science and religion have led him to a pro-Darwin Christian evangelist in the U.S. named Michael Dowd, whose help he graciously acknowledges. Only, I wonder if Mr. Nasr is aware of how vast and profound is the literature on science-and-religion themes, and how varied are its currents. For all his magnificent indignation against modern-day anti-Semitism, Mr. Nasr dismisses Israel as a colonialist error—an uncharacteristic concession to fashionable opinion on his part. But it is hard to see how a Muslim liberalism can advance without arriving at a deeper and more sympathetic understanding of Jewish history and Zionism. Political theory is another weak point: Mr. Nasr counts himself a libertarian and never explains why. This sort of thing, the offhand quality of Mr. Nasr’s opinions, may be OK for a blogger, and doubly OK for a student. But what will happen if, as Mr. Nasr expects, the Arab Spring arrives at still another phase, and liberals like him are given another chance? I hope they will be prepared. Paul Berman is a senior editor of the New Republic and the author, most recently, of The Flight of the Intellectuals. --- ## Tamarod, la rébellion qui veut chasser les Frères musulmans du pouvoir Sophie Anmuth, Slate Afrique, 25/06/2013 La campagne cherche à faire démissionner le président islamiste Morsi à l’occasion des manifestations prévues le 30 juin prochain. Elle se vante d’avoir recueilli 15 millions de signatures pour demander la démission du président Mohamed Morsi. Autrement dit plus que le total des voix qui a permis la victoire du candidat des Frères musulmans. La campagne « Tamarod » (rébellion) appelle les Égyptiens à « retirer leur confiance » au président issu des Frères musulmans, Mohamed Morsi, et à le forcer ainsi à démissionner, comme si le peuple était le parlement et pouvait voter contre le chef de l’État. La campagne reproche aux Frères musulmans d’avoir « augmenté le nombre des martyrs du peuple égyptien » : en effet depuis l’élection de Morsi des dizaines de personnes ont trouvé la mort dans des manifestations ou affrontements de nature politique ou sociale. Indépendance Elle les accuse aussi d’essayer d’intimider les figures de l’opposition avec des procès ou des campagnes dans les médias (contre par exemple Baradei ou Bassem Youssef). D’autres accusations sont plus tendancieuses, comme celle qui reproche au gouvernement de chercher à vendre l’Égypte à ses protecteurs (ici c’est le Qatar et son aide généreuse qui sont visés – sans davantage de preuves, il faut bien le dire). La campagne « Tamarod » a reçu le soutien du Front de Salut national, qui est une coalition de partis et figures de l’opposition, du parti du Dostour, par exemple (parti de l’ancien directeur de l’Agence internationale pour l’énergie atomique et opposant à Moubarak, Mohamed El Baradei), du groupe d’activistes du 6 avril (fondé en 2008), mais aussi des salafistes. La Gamaa islamiya, elle, a lancé une contre-initiative, incitant à l’« impartialité » et à la stabilité. « Tamarod » reçoit ces soutiens politiques plusieurs semaines après le début de ses activités, et se déclare indépendante de toute tendance politique. À l’occasion de l’anniversaire de l’investiture de Mohamed Morsi, « Rébellion » a l’intention d’organiser une marche sur le palais présidentiel et de soumettre la pétition au procureur-général, afin d’exiger la démission du président. Des élections présidentielles anticipées — un an seulement après l’élection de Mohamed Morsi — pourraient alors avoir lieu. Écueils Juridiquement, l’initiative n’est pourtant pas très viable. Les porte-paroles du parti des Frères musulmans, Liberté et Justice, nient toute importance à cette pétition et rappellent que seule vaut la légitimité des élections. Le 16 mai dernier, une plainte a été déposée contre les organisateurs de la campagne : ils chercheraient à faire plonger le pays dans le chaos, détruire l’unité nationale. Un peu d’exagération. L’autre chef d’accusation, par contre, ne semble pas illégitime : chercher à renverser le gouvernement. Des campagnes de désobéissance civile ont été lancées régulièrement dans plusieurs villes d’Égypte notamment celles du Canal de Suez. Ici c’est à l’échelle nationale que le mouvement essaie de prendre forme. --- ## Les Occidentaux pris de court par les événements en Égypte Renaud Girard, 03/07/2013 Personne en Europe et aux États-Unis n’avait prévu la chute de Moubarak et la victoire électorale des Frères musulmans. Leur chute est également une surprise, compliquant encore les stratégies diplomatiques au Moyen-Orient. Quand l’Égypte passa, dans les années 1950, d’un régime monarchique bon enfant à une dictature militaire nationaliste, les Occidentaux eurent déjà le plus grand mal à bien gérer le tournant. Comme s’il y avait une malédiction diplomatique propre au delta du Nil, soixante ans plus tard, les puissances occidentales sont à nouveau prises de court par les événements du Caire. En 2011, personne, dans les Chancelleries et dans les universités américaines et européennes, n’avait prévu la chute de Moubarak, dans une révolution de rue que l’armée laissait faire. Ensuite, personne n’avait prévu une victoire électorale aussi massive des Frères musulmans, lesquels, après tout, n’avaient pris qu’en route la révolution. Enfin, à peine l’Amérique s’était-elle persuadée que les Frères musulmans, islamistes mais procapitalistes, étaient la bonne solution pour le monde arabo-musulman, à peine Washington avait-il persuadé ses alliés qu’il fallait partout au Moyen-Orient soutenir les Frères sunnites contre l’axe chiite présidé par l’Iran, que ce modèle se mettait à s’effriter dangereusement, en Tunisie d’abord, puis en Turquie, et maintenant en Égypte. Quand les tentatives de prospective des ministères, des think-tanks et des médias se trouvent régulièrement démenties par les faits, le pilotage stratégique devient extrêmement difficile au Moyen-Orient, même si les Occidentaux ont renoncé au rêve néoconservateur d’y imposer l’État de droit par la force. L’armée égyptienne formée, équipée et financée par les Américains Ils ne manquent pas pour autant de leviers. Le premier est celui de l’armée égyptienne, formée, équipée et financée par les Américains, qui lui conseillent la modération et le « maintien d’une dynamique démocratique » dans le pays. Le secrétaire d’État John Kerry suit personnellement le dossier, lui qui a décidé de consacrer sa mandature à « l’arc de crise » en général et au Levant en particulier. Quand le Quai d’Orsay appelle de ses vœux un « signe démocratique fort » venant du Caire, il est en plein accord avec le département d’État américain et le Foreign Office britannique. Il s’agit de constituer un gouvernement d’union nationale, où entreraient des technocrates compétents et des personnalités de l’opposition anti-islamiste. L’opposition n’a ni leader, ni programme Les Occidentaux ne peuvent aller plus loin dans leurs initiatives, car ils ont constaté l’aporie devant laquelle se trouve l’opposition. Cette dernière est la simple addition des anti-islamistes classiques et des déçus de Morsi, qui avaient cru aux promesses de restauration économique et sociale du président Frère musulman. Les foules sont nombreuses dans la rue, mais l’opposition n’a ni leader, ni programme, ni ciment idéologique. Les Occidentaux le regrettent, mais elle n’est pas pour le moment une solution de remplacement! Paris, Londres et Washington ne veulent pas d’élections immédiates dans une atmosphère aussi chaude. Mais ils sont conscients qu’il est devenu presque impossible à Morsi de finir tranquillement son mandat. --- --- # South Jordan Wedding Florists Wedding florists create beautiful arrangements to set the mood for your big day. A wedding florist will help determine your style and design bouquets, centerpieces, and more to decorate your venue. We recommend hiring a wedding florist in South Jordan about 10 months before your big day to ensure you have plenty of time to turn your dreams into reality. --- ## Sweet William Floral & Design 8 reviews · Wedding Florists · South Jordan, UT Sweet William Floral & Design is a full-service florist shop located in South Jordan, Utah that provides custom, exceptional floral designs for weddings and other events. We understand that each couple is unique and we believe that your flowers should reflect that individuality. Our expert florists... Typical Price: $950 ## Poppy & Bloom Floristry 1 review · Wedding Florists · South Jordan, UT Poppy & Bloom Floristry is a wedding florist located in South Jordan, Utah. They specialize in providing gorgeous and unforgettable arrangements to couples across all of Salt Lake City and Northern Utah. Poppy & Bloom Floristry is passionate about what they do and they aim to deliver stunning... Typical Price: $1,500 ## Beehive Floral Co. 55 reviews · Wedding Florists · 13.6 miles from South Jordan, UT Every arrangement I create begins with a journey. From an early morning foraging trip along a river, gathering hidden blooms and watching the morning birds swoop by to the bounty of my own carefully curated cut flower garden to truckloads of blooms from nearby flower farms committed to sustainable... ## Apiana Blooms 2 reviews · Wedding Florists · 13.8 miles from South Jordan, UT Apiana Blooms is a farm-to-bouquet wedding florist located near the Cottonwood Canyons in Salt Lake City, Utah. They pride themselves on their beautiful, local flowers that are sustainably grown on their farm. Their goal is to bring your unique vision to life through their unforgettable... ## Lei Away Wedding Florists · 13.8 miles from South Jordan, UT Lei Away is a wedding florist business based in Orem, Utah, which also serves the Salt Lake City area. Here, couples will find the perfect complement to a tropical or island-inspired wedding. The florists can create leis for not only the bride and groom, but also the entire wedding party. Whether... ## Urban Chateau Floral 5 reviews · Wedding Florists · 14.3 miles from South Jordan, UT We are excited to hear from you and to start planning your upcoming wedding with our expertise. We are inspired by the up and coming trends and have been designing for fifteen years now. Overall we love a lush, romantic, mountain vibe and create that by sourcing the freshest flowers locally and... ## Flower Imagination Wedding Florists · 14.6 miles from South Jordan, UT Flower Imagination is a flower design studio located in the heart of Salt Lake City at 481 E. South Temple and is specializing in wedding and event decorations. Our designers hail from some of the world's top floral design schools. Our specialty is grounded in the rich history of European floral... ## Florette 12 reviews · Wedding Florists · 25.7 miles from South Jordan, UT A floral design company in Park City, Utah, Florette specializes in imaginative and innovative wedding blooms. They love telling a couple’s story through their arrangements, focusing on mood, imagination, and the celebration of beauty. Accommodating both intimate weddings and grand, formal...	9,690	6,009	-9,107,226,852,288,020,000	concat	[ "concat_full" ]	0.75	true	null
-1,403,356,772,892,817,400	What is sTeam Whenever I tell someone that I am working for Fossasia under Google Summer of Code, I am asked to explain what my project is all about. Here I give a detailed introduction to sTeam and explain what it actually is. kopfleiste_big Well some of you must of heard of MUDs (Multi User Dungeon) sTeam is based on this concept. For those who don’t know what MUDs are I will provide a brief introduction. MUDs are text based games. These games create a kind of real-time virtual world. These games are based on role playing and the user acts like one of the organisms of the virtual world. He can do whatever the organisms could have done in a real world. For example if I represent a man in a virtual world, I can do whatever a man can do, things like walk, talk, eat and stuff. This way the user interacts with his virtual environment. This whole concept is taken to create a virtual office space. Just like MUDs sTeam creates virtual office space. Now how can we imagine an office? Well it will have rooms each room will have containers with different kinds of files, there will be people moving around working or having meetings. Well all this is possible in sTeam virtually. The user is also carrying a rucksack and can copy objects into this as he moves around. This is what sTeam is. Steam provides two interfaces web and command line. The web interface can be accessed at http://societyserver.org/ and the code is put up at https://github.com/societyserver/sTeam. logo-200 More of similar projects are available under Fossasia. Check this site for more details http://labs.fossasia.org/ideas.html. Close Menu Get ClassPass Group Fitness Amenities Distance 39 Fitness Studios in Davie • The Yoga Joint Yoga The Yoga Joint 8192 W State Rd 84, Davie 4.9 (5000+) more info FUSION FIIT45 Great class, and very attentive, motivating instructor. Im in town visiting my folks, but if I lived here, Id be at this studio all the time. Will be back next visit! see all reviews Yoga Joint Davie is a brand new hot yoga studio specializing in Hot Fusion Flow,… • CycleBar Cycling CycleBar 2270 S University Dr, Suite 120, Davie 4.8 (1000+) more info Beats&Brews: HipHop: NY's Finest Beautiful class with Krystal...motivation was through the roof! Loved the music! Instructor took the time to adjust my bike and confirm that I was ok..Forgive me for forgetting his name but was greated by a gentleman and he walked me through and introduction to the studio was pleasant. Studio was clean, bikes were good, monitors working..bathroom, lockeroom, and showers were great.. AND they actually do have a cute little bar area afterwards! (Thanks for my protein powder). Sweat accomplished and calories obliterated! Thanks Krystal! see all reviews CycleBar is not your average cycling class—it’s a mind-blowing, heart-pumping party… • StudioB Pilates StudioB 11330 W State Rd 84, Davie 4.9 (1000+) more info HIIT Pilates This class is awesome and it will definitely challenge you! The instructor was so nice and helpful and she really explained each exercise. It was my first time taking this class and I am still SO sore two days later. see all reviews StudioB is committed to helping you take control of your health & wellness. They… • Casa D Hot Yoga Yoga Casa D Hot Yoga 8632 Griffin Rd, Cooper City 4.8 (1000+) more info Hot HIIT This was a really great class! Not really HIIT but Amanda explained how the class was going to be. It was more of a continuous hot Yogalates flow with some childs pose breaks. We were also encouraged to take a break as needed and it really made this for an enjoyable workout! No pressure! Also the music was great! see all reviews Casa D Hot Yoga is a Yoga and Fitness studio located in Cooper City, FL with a mission… • Bodytek Fitness Strength Training Bodytek Fitness 7020 SW 22nd Ct, Davie 4.9 (1000+) more info Total Body Workout Great workout. Only complaint was the extra Bodytek employees in the room who didnt help correct form and kind of got in the way... trying to move weights when we were using them see all reviews Bodytek is an hour-long strength training and cardio workout designed to burn between… • Ultimate Workout Cycling, Pilates, … Ultimate Workout 5173 South University Drive, Davie 4.9 (500+) more info Pilates Level 1 Really great workout. Fully body, not just legs and abs like a lot of other Pilates places see all reviews They offer the best in cardio and strength training workouts, Pilates, hot yoga,… • PER4ORM Boxing PER4ORM 10384 W State Rd 84, Davie 4.9 (100+) more info ASP Good interval workout in open air. Instructor was clear and left you to it after demonstrating the exercises. Music was too thumpy/clubby/angry for the most part (gives me a headache, I know some like it), and the floor is an abrasive plastic carpet, but overall very cool people working hard! Will go again ???? see all reviews PER4ORM is where hopes and dreams live and fear and doubt die. It is a place that… • Elevate Training & Fitness Cycling Elevate Training & Fitness 3400 SW 26th Terrace, Fort Lauderdale 4.9 (100+) more info R.I.P.T Really great workout! Justin motivated me to do more reps and lift more than I thought I could. Im probably going to be a bit sore tomorrow but I dont regret it. Great class! see all reviews Elevate Training & Fitness is a training facility that does it all. They offer a… • Fitspace Studio Pilates, Strength Training Fitspace Studio 1437 S University Dr, Plantation 4.7 (100+) more info FITSPACE Pilates I wouldn’t call this a Pilates class - it was unlike other Pilates classes I have taken and was not on a traditional reformer. However, it was a great work out with a small group and the instructor was very good. see all reviews FITSPACE is a fitness and Pilates Boutique Studio in Plantation, Florida If you… • The Yoga Nest Yoga The Yoga Nest 12165 Sheridan St, Hollywood 4.9 (100+) more info Kundalini Yoga & Gong Bath Such a wonderful class! This was a beautiful introduction to Kundalini yoga for me! Gina is so lovely and the whole energy of the class was relaxing and peaceful. The Gong bath at the end was incredible and left me feeling bliss. I look forward to continuing my Kundalini practice. see all reviews The Yoga Nest's passion is people and making connections. Through yoga you can find… • Cyc-ology Time Cycling Cyc-ology Time 9112 W State Rd 84, Davie 4.8 (100+) more info Find your "ME" time! The cool vibe of Cycleward with great bonuses like aromatherapy cooled towels at the end and rad music to vibe on during your ride. Not as many bike view options as Cyclebar (no calories, no gear) but it makes it more tuned to your inner voice- what is “your” level 5 etc... I may have even worked harder than if I did see the gear. Great instructor, clean pretty facility see all reviews Cyc-ology Time is a boutique indoor cycling and health studio dedicated to offering… • Fitness 1440 Gym Access, Strength Training Fitness 1440 7067 W Broward Blvd, Plantation 4.8 (88) more info Power Flow Good for strength and flexibility. Absolutely adore the cold towels at the end. see all reviews At Fitness 1440, it’s not just about weight and measurements. It’s about helping… • Om Joyful Yoga Yoga Om Joyful Yoga 5900 Hiatus Road , Suite 200, Fort Lauderdale 4.8 (67) more info Basic Gentle Flow The perfect class if you are just starting yoga! But, also great to get some position adjustments that you rarely get in most classes. Nice studio, easy parking. see all reviews Om Joyful Yoga is a scared space, which was created 8 years ago and has been nothing… • Atomic Training and Performance Strength Training, Rowing Atomic Training and Performance 1417 S State Rd 7, Fort Lauderdale 4.8 (92) more info SpartanSGX Good circuit workout. Different than what I normally do, but like a playground for adults, where you sweat gallons, and are a little sore afterwards - but in a good way see all reviews Atomic Training and Performance is a first of it’s kind obstacle based training arena… • Challenge Fitness Strength Training Challenge Fitness 4130 Davie Road, Davie 5.0 (37) more info Full Body Workout Always the best with Amy see all reviews They provide personal training in a group setting. Their focus is your results so… • Crossfit Showdown Strength Training Crossfit Showdown 6950 Stirling Rd, #3, Hollywood 4.9 (51) more info Meltdown The Meltdown classes are perfect for me; someone who is a little intimidated by typical CrossFit but still loves the push. Such a great workout! see all reviews CrossFit Showdown is a 10,000sqft indoor and outdoor facility, where they provide… • Rock MMA Martial Arts Rock MMA 12930 W State Rd 84, Davie 4.8 (36) more info Women's Fitness/Bootcamp Im not a fan of boot camp but my instructor was so thoughtful yet tough but caring its hard to hate this class. Still not my thing but Ill return. Nice people here. A lot of WOD type exercises. You follow a list of exercises with names and reps, very self led. So as a newbie to self led exercise this was a turn off but the other class attendees encouraged and helped me. The instructor also choked in to clarify the routines and proper form. see all reviews Rock M.M.A. is a top notch training facility. Their coaches are professional mixed… • Elite International Dance Academy Dance Elite International Dance Academy 6692 Stirling Rd, Hollywood 4.8 (12) more info Intro To Salsa Great facility and teachers! see all reviews Elite International Dance Studio focuses on Latin and Ballroom dance education for… • Truefit Nutrition Strength Training Truefit Nutrition 9950 Northwest 6th Court, Pembroke Pines 4.8 (19) more info BOOT CAMP Ken Jay led a challenging workout but the real winner is the small community you are introduced to. The workout consisted of a warm-up outside and 5 timed partner stations inside. You were encouraged to meet others and the class ended with a motivational message. The room is simple with some resistance bands, a bench & mostly use of body weight. see all reviews TrueFit Nutrition was offered many different nutrition programs & fitness classes… • Driving Force CrossFit Strength Training Driving Force CrossFit 8507 Pines Blvd, Pembroke Pines 4.8 (18) more info CrossFit Really appreciated that the instructor spent a lot of time on proper form and took the time to help the students. It’s easy to get an injury in CrossFit, so it’s great that the class focuses on the one-on-one and not just speed and reps. see all reviews Driving Force CrossFit is a strength and conditioning facility that turns individuals… • The Hive Strength Training The Hive 10368 W State Road 84, Suite 104, Davie 4.8 (13) more info The Colony Andy is amazing! He always comes up with unique movements and workouts - you’ll never hit a plateau. see all reviews The Hive is a custom designed, professional training and therapy facility. Anchored… • Grounds Fitness Strength Training Grounds Fitness 4827 S State Rd 7, Davie 4.4 (23) more info Beginner's Course Wasn’t sure what to expect at first because I couldn’t figure out who worked there and no one was expecting me, but ended up being an amazing experience. Basically had my own personal trainer correcting my form and modifying exercises for me. Planning to come back! see all reviews At Grounds Fitness, they pride themselves in the family that has formed at their… • S.B.R. Fitness Studio Strength Training S.B.R. Fitness Studio 8200 Pines Blvd., Pembroke Pines 4.4 (8) more info Functional HIIT Training Waited until 10 minutes after and the instructor still has not arrived. Left without taking the class see all reviews S.B.R. Fitness Studio is not like a regular commercial gym. They are a personal studio… • Yoga Institute Of Broward Yoga Yoga Institute Of Broward 10400 Griffin Road, Suite 205, Cooper City The Yoga Institute of Broward is one of South Florida's premier authentic Iyengar… • Blitz45 Functional Training Boxing Blitz45 Functional Training 6887 Stirling Road, Davie Their primary goal is to provide quality fitness services for those located in urban… • Warrior Fitness Camp Strength Training Warrior Fitness Camp 4747 SW 51St St., Davie Warrior Fitness Camp is a health and fitness organization created to help the average… • Issa Yoga Yoga Issa Yoga 10353 Orange Drive, Davie 4.6 (6) more info Therapeutic Yoga It's a random house with no signs I could see from the road so I went to the gym instead. Gotta at least look like a business! see all reviews Issa Yoga school is located in the western town of Davie Fl. It is a place for self… • Bruce Zone Strength Training Bruce Zone 3400 Davie Blvd, Davie A training facility where you will feel at home, & will be pushed to your limits… • American International Karate Institute Martial Arts American International Karate Institute 7107 W Broward Blvd, Plantation American International Karate Institute was established to further the personal growth… • Zen Do USA - Tai Chi Meditation Qi Gong Yoga Zen Do USA - Tai Chi Meditation Qi Gong 4040 Southwest 76th Avenue, Davie Zen Do USA - Tai Chi Meditation Qi Gong is a small, dedicated sangha community offering… • Guzzo Fitness Systems Strength Training Guzzo Fitness Systems 3031 Palm Trace Landings Drive, Davie Join a fitness community that is passionate, determined and supportive. Whether you… • Atemi Ryu Ju-Jitsu Martial Arts Atemi Ryu Ju-Jitsu 6936 Stirling Road, Hollywood At Atemi-Ryu Ju-Jitsu, they provide Japanese Ju-Jitsu based, self-defense training… • Sedley Training Systems Strength Training Sedley Training Systems 10388 W State Rd 84 Suite 110, Davie Sedley Training Systems feel there is a lack of quality of gyms with training programs… • Yoga Fairy Prenatal Yoga Yoga Yoga Fairy Prenatal Yoga 10400 Griffin Rd, Cooper City Yoga Fairy Prenatal Yoga is your source for pregnancy yoga in Broward County and… • Fortify Your Frame Strength Training Fortify Your Frame 9123 Taft Street, Pembroke Pines Fortify Your Frame is a boutique personal training studio dedicated to providing… • GET FIT WITH KING Boxing GET FIT WITH KING 8050 Pines Blvd, Pembroke Pines Get Fit with King inside of Club KO is a state of the art Training Center for Boxing… • Academy of Martial Arts \| AMA \| Pembroke Pines Martial Arts Academy of Martial Arts \| AMA \| Pembroke Pines 8937 Taft St, Pembroke Pines The Academy of Martial Arts is one of the premiere martial arts studios in the Fort… • Mind & Body Transformation Strength Training Mind & Body Transformation 3414 Griffin Rd, Fort Lauderdale Mind & Body Transformation is a unique studio that offers semi-private fitness classes… • Jazzercise Strength Training, Dance Jazzercise 3801 S. Pine Island Rd., Davie 3.6 (8) more info Dance Mixx Yes, Jazzercise is still alive! And it’s actually a really good workout! see all reviews Jazzercise Davie Recreation Center in Davie, FL offers group fitness classes for… More activities in Davie Explore nearby places	# What is sTeam Whenever I tell someone that I am working for Fossasia under Google Summer of Code, I am asked to explain what my project is all about. Here I give a detailed introduction to sTeam and explain what it actually is. ## MUDs (Multi User Dungeon) Well some of you must of heard of MUDs (Multi User Dungeon) sTeam is based on this concept. For those who don’t know what MUDs are I will provide a brief introduction. MUDs are text based games. These games create a kind of real-time virtual world. These games are based on role playing and the user acts like one of the organisms of the virtual world. He can do whatever the organisms could have done in a real world. For example if I represent a man in a virtual world, I can do whatever a man can do, things like walk, talk, eat and stuff. This way the user interacts with his virtual environment. ## sTeam: A Virtual Office Space This whole concept is taken to create a virtual office space. Just like MUDs sTeam creates virtual office space. Now how can we imagine an office? Well it will have rooms—each room will have containers with different kinds of files, there will be people moving around working or having meetings. Well all this is possible in sTeam virtually. The user is also carrying a rucksack and can copy objects into this as he moves around. This is what sTeam is. ## Interfaces sTeam provides two interfaces: - Web interface: http://societyserver.org/ - Command-line interface The code is available at: https://github.com/societyserver/sTeam ## More Projects More similar projects are available under Fossasia. Check this site for more details: http://labs.fossasia.org/ideas.html --- ## 39 Fitness Studios in Davie ### The Yoga Joint Category: Yoga Address: 8192 W State Rd 84, Davie Rating: 4.9 (5000+) Featured Class: FUSION FIIT45 > “Great class, and very attentive, motivating instructor. I’m in town visiting my folks, but if I lived here, I’d be at this studio all the time. Will be back next visit!” --- ### CycleBar Category: Cycling Address: 2270 S University Dr, Suite 120, Davie Rating: 4.8 (1000+) Featured Class: Beats&Brews: HipHop: NY’s Finest > “Beautiful class with Krystal… motivation was through the roof! Loved the music! Instructor took the time to adjust my bike…” --- ### StudioB Category: Pilates Address: 11330 W State Rd 84, Davie Rating: 4.9 (1000+) Featured Class: HIIT Pilates > “This class is awesome and it will definitely challenge you! The instructor was so nice and helpful…” --- ### Casa D Hot Yoga Category: Yoga Address: 8632 Griffin Rd, Cooper City Rating: 4.8 (1000+) Featured Class: Hot HIIT > “This was a really great class! Not really HIIT but Amanda explained how the class was going to be…” --- ### Bodytek Fitness Category: Strength Training Address: 7020 SW 22nd Ct, Davie Rating: 4.9 (1000+) Featured Class: Total Body Workout > “Great workout. Only complaint was the extra Bodytek employees in the room who didn’t help…” --- ### Ultimate Workout Category: Cycling, Pilates, … Address: 5173 South University Drive, Davie Rating: 4.9 (500+) Featured Class: Pilates Level 1 > “Really great workout. Full body, not just legs and abs like a lot of other Pilates places.” --- ### PER4ORM Category: Boxing Address: 10384 W State Rd 84, Davie Rating: 4.9 (100+) Featured Class: ASP > “Good interval workout in open air. Instructor was clear and left you to it after demonstrating…” --- ### Elevate Training & Fitness Category: Cycling Address: 3400 SW 26th Terrace, Fort Lauderdale Rating: 4.9 (100+) Featured Class: R.I.P.T > “Really great workout! Justin motivated me to do more reps and lift more than I thought I could…” --- ### Fitspace Studio Category: Pilates, Strength Training Address: 1437 S University Dr, Plantation Rating: 4.7 (100+) Featured Class: FITSPACE Pilates > “I wouldn’t call this a Pilates class—it was unlike other Pilates classes I have taken…” --- ### The Yoga Nest Category: Yoga Address: 12165 Sheridan St, Hollywood Rating: 4.9 (100+) Featured Class: Kundalini Yoga & Gong Bath > “Such a wonderful class! This was a beautiful introduction to Kundalini yoga for me…” --- ### Cyc-ology Time Category: Cycling Address: 9112 W State Rd 84, Davie Rating: 4.8 (100+) Featured Class: Find your "ME" time! > “The cool vibe of Cycleward with great bonuses like aromatherapy cooled towels…” --- ### Fitness 1440 Category: Gym Access, Strength Training Address: 7067 W Broward Blvd, Plantation Rating: 4.8 (88) Featured Class: Power Flow > “Good for strength and flexibility. Absolutely adore the cold towels at the end.” --- ### Om Joyful Yoga Category: Yoga Address: 5900 Hiatus Road, Suite 200, Fort Lauderdale Rating: 4.8 (67) Featured Class: Basic Gentle Flow > “The perfect class if you are just starting yoga! But also great to get some position adjustments…” --- ### Atomic Training and Performance Category: Strength Training, Rowing Address: 1417 S State Rd 7, Fort Lauderdale Rating: 4.8 (92) Featured Class: SpartanSGX > “Good circuit workout. Different than what I normally do, but like a playground for adults…” --- ### Challenge Fitness Category: Strength Training Address: 4130 Davie Road, Davie Rating: 5.0 (37) Featured Class: Full Body Workout > “Always the best with Amy.” --- ### Crossfit Showdown Category: Strength Training Address: 6950 Stirling Rd, #3, Hollywood Rating: 4.9 (51) Featured Class: Meltdown > “The Meltdown classes are perfect for me; someone who is a little intimidated by typical CrossFit…” --- ### Rock MMA Category: Martial Arts Address: 12930 W State Rd 84, Davie Rating: 4.8 (36) Featured Class: Women's Fitness/Bootcamp > “I’m not a fan of boot camp but my instructor was so thoughtful yet tough…” --- ### Elite International Dance Academy Category: Dance Address: 6692 Stirling Rd, Hollywood Rating: 4.8 (12) Featured Class: Intro To Salsa > “Great facility and teachers!” --- ### Truefit Nutrition Category: Strength Training Address: 9950 Northwest 6th Court, Pembroke Pines Rating: 4.8 (19) Featured Class: BOOT CAMP > “Ken Jay led a challenging workout but the real winner is the small community you are introduced to…” --- ### Driving Force CrossFit Category: Strength Training Address: 8507 Pines Blvd, Pembroke Pines Rating: 4.8 (18) Featured Class: CrossFit > “Really appreciated that the instructor spent a lot of time on proper form…” --- ### The Hive Category: Strength Training Address: 10368 W State Road 84, Suite 104, Davie Rating: 4.8 (13) Featured Class: The Colony > “Andy is amazing! He always comes up with unique movements…” --- ### Grounds Fitness Category: Strength Training Address: 4827 S State Rd 7, Davie Rating: 4.4 (23) Featured Class: Beginner’s Course > “Wasn’t sure what to expect at first… ended up being an amazing experience.” --- ### S.B.R. Fitness Studio Category: Strength Training Address: 8200 Pines Blvd., Pembroke Pines Rating: 4.4 (8) Featured Class: Functional HIIT Training > “Waited until 10 minutes after and the instructor still had not arrived. Left without taking the class.” --- ### Yoga Institute Of Broward Category: Yoga Address: 10400 Griffin Road, Suite 205, Cooper City > One of South Florida's premier authentic Iyengar yoga studios. --- ### Blitz45 Functional Training Category: Boxing Address: 6887 Stirling Road, Davie > Providing quality fitness services for urban communities. --- ### Warrior Fitness Camp Category: Strength Training Address: 4747 SW 51st St., Davie > A health and fitness organization for the average person. --- ### Issa Yoga Category: Yoga Address: 10353 Orange Drive, Davie Rating: 4.6 (6) Featured Class: Therapeutic Yoga > “It's a random house with no signs I could see from the road so I went to the gym instead.” --- ### Bruce Zone Category: Strength Training Address: 3400 Davie Blvd, Davie > A training facility where you will feel at home & be pushed to your limits. --- ### American International Karate Institute Category: Martial Arts Address: 7107 W Broward Blvd, Plantation > Established to further personal growth through karate. --- ### Zen Do USA – Tai Chi Meditation Qi Gong Category: Yoga Address: 4040 Southwest 76th Avenue, Davie > A small, dedicated sangha community offering Tai Chi and Qi Gong. --- ### Guzzo Fitness Systems Category: Strength Training Address: 3031 Palm Trace Landings Drive, Davie > A passionate, determined and supportive fitness community. --- ### Atemi Ryu Ju-Jitsu Category: Martial Arts Address: 6936 Stirling Road, Hollywood > Japanese Ju-Jitsu based self-defense training. --- ### Sedley Training Systems Category: Strength Training Address: 10388 W State Rd 84, Suite 110, Davie > A gym with quality training programs. --- ### Yoga Fairy Prenatal Yoga Category: Yoga Address: 10400 Griffin Rd, Cooper City > Your source for pregnancy yoga in Broward County. --- ### Fortify Your Frame Category: Strength Training Address: 9123 Taft Street, Pembroke Pines > A boutique personal training studio. --- ### GET FIT WITH KING Category: Boxing Address: 8050 Pines Blvd, Pembroke Pines > A state-of-the-art boxing training center inside Club KO. --- ### Academy of Martial Arts (AMA) \| Pembroke Pines Category: Martial Arts Address: 8937 Taft St, Pembroke Pines > One of the premiere martial arts studios in the Fort Pines area. --- ### Mind & Body Transformation Category: Strength Training Address: 3414 Griffin Rd, Fort Lauderdale > Unique semi-private fitness classes. --- ### Jazzercise Category: Strength Training, Dance Address: 3801 S Pine Island Rd., Davie Rating: 3.6 (8) Featured Class: Dance Mixx > “Yes, Jazzercise is still alive! And it’s actually a really good workout!”	3,633	2,597	-1,403,356,772,892,817,400	concat	[ "concat_full" ]	0.75	true	null
7,067,199,003,124,980,000	Grinder Green Teeth Series • Home • Grinder Green Teeth Series TreeStuff - 700 Wearsharp Tooth Awesome stump grinder teeth - 03/22/2018 Reviewer: RSC. We run a rental equipment company and have a couple of Toro stump grinders we use these wood chipping teeth on 700 series and they work great they will stand all of our rough abuse our customers use them on we come back every time and purchase them from tree stuff. Home - Greenteeth "I have been using Greenteeth for 10 years now, and continue to appreciate their durability and the ease with which they are changed. When grinding big stumps you need high horse power and sharp teeth. With three sides to a tooth and it only taking a few minutes to flip the outer two sets, green teeth are a crucial part of our system. Greenteeth - Product Information The 700 Series LoPro Greenteeth ® are designed for machines with a horsepower of 18-35. They are made from a steel shank and have the carbide tip brazed on. As is the case for all Greenteeth ®, the teeth come in two colors: Red and Green.. NEW Green Teeth ® Wearsharp Teeth has an innovative design which allows the tooth to wear to a new edge while cutting! Greenteeth - 900 Series Stump Grinding Teeth\| CEI Supply The 900 Series LoPro Greenteeth ® are designed for machines with a horsepower of 35-90. They are made from a steel shank and have the carbide tip brazed on. As is the case for all Greenteeth ®, the teeth come in two colors: Red and Green.. NEW Green Teeth ® Wearsharp Teeth has an innovative design which allows the tooth to wear to a new edge while cutting! TreeStuff - Green Teeth Green Teeth. Greenteeth stump grinder pockets and teeth are configurable for nearly any commercial stump grinder. The teeth can be easily rotated to provide a fresh, sharp cutting edge in a matter of seconds. Look for the Greenteeth setup for your brand of stump grinder, buy teeth or pockets individually, or purchase one of Greenteeth's cutting ... Stump Grinder Teeth Reviews: 5 Best Stump Grinder ... If you have a large industrial or commercial stump grinder, you can benefit from these affordable GreenTeeth stump grinder teeth. They feature WearSharp technology to last longer, can be rotated three times before needing sharpened, and are durable as well. Overall, they are some of the best stump grinder teeth for the money. Stump Grinder Tooth Sharpening \| Blades LLC Stump Grinder Tooth Sharpening. Sharpening Stump Cutter Teeth (also referred to as Stump Grinder Teeth or Stump Bits) can be an excellent business opportunity. The AL-65 Stump Cutter Tooth Sharpener is a professional grinding system that makes sharpening various styles of carbide stump teeth fast and simple. Stump Grinders at Dosko Stump Grinders. With quality construction, operator safety features and a user-friendly design, Dosko's walk behind stump grinders are made to meet your tree care needs. Narrow widths ensure transport ease and a unique side discharge frame keeps cuttings away from the machine while grinding. SP5014 Series Self-Propelled Stump Cutters « Carlton ... The SP5014 series is a four-wheeled self-propelled unit designed to deliver maximum cutting power in hard to get to areas. A unique dual speed ground system allows the SP5014 to travel faster than any other stump cutter on the market today. The unit also boasts a 1 1/4-inch thick, 21-inch diameter cutting wheel, letting you grind faster and smoother than ever before. 700 series Green Teeth on 2016 RG45X stump grinder ... Aug 04, 2017· So I bought a new RG45X last summer. It came with the OEM Rayco Super teeth. Worked great! My old RG1625 Super Jr came with the Super Teeth as well, I converted it to 700 series GT, and then a Green wheel, so I had 18 GT pockets and a bunch on new and used teeth, along with some Super teeth. Wearsharp Greenteeth - Sales and Servi The 700, 900, and 1100 Wearsharp® teeth can utilize the already existing pockets of their corresponding series . Each tooth has (3) positions. NOTE: 900 Series Wearsharp® Greenteeth When purchasing the 900 Wearsharp® teeth, please know the diameter of your wheel. The 900 Wearsharp® teeth have two … Broadhead & Son Stump Grinding Broadhead And Son Stump Grinding Service is a family owned and operated business that has been servicing Baldwin County and the surrounding areas for 10 years. We use state of the art equipment (Carlton SP7015) that is self propelled, remote controlled and turf friendly. It can travel through a 36" gate and is capable of removing any size stump. : 700 Series Greenteeth 10 Pack (Wearsharp ... 700 Series Greenteeth 10 Pack (Wearsharp) ... Stump Grinder Teeth For Toro STX 26 And STX 38 Stumpgrinder Green Teeth $161.28. 900 Series Greenteeth 10 Pack (Three-sided, Green) 5.0 out of 5 stars 2. $119.00. 500 Series Greenteeth 10 Pack (Red) greenteeth \| eBay 10 PACK - GREENTEETH 900 LOPRO SERIES STUMP GRINDER TEETH - GREEN. Brand New. 5.0 out of 5 stars. 4 product ratings - 10 PACK - GREENTEETH 900 LOPRO SERIES STUMP GRINDER TEETH - GREEN. $119.00. ... 2 product ratings - 500 Series Greenteeth Stump Grinder Teeth, 11/16" Carbide Cutting Face - 10 Pack. $69.50. Buy It Now +$7.00 shipping. 11 Watching. Stump Tooth Compatible with Greenteeth® 1100 Series ... A Our teeth are a hybrid between a green and red dish. Our teeth are slightly more recessed than a standard green dish but less recessed than a red dish. We do this to accommodate customers in all geographic areas of the country grinding in different soil types. stump grinder teeth - BuyCheapr.com stump grinder teeth - compare prices at BuyCheapr.com. help Season in style with this OXO Good Grips grinder shaker. Shake salt from the top and grind pepper from the base with one convenient tool Salt shaker acts as a knob for easy pepper grinding Grind-selector locks into 5 different settings to easily adjust from fine to coarse Unscrew cap to refill salt and remove salt chamber to refill ... Greenteeth Machine Set-Ups (1100 Series) - Greenteeth ... Greenteeth Stump Grinder Teeth & Pockets; Rayco Stump Grinder Teeth; Quadco Grinder Teeth ; Winn Wear Grinder Teeth Inserts; Stump Grinder Wheels. ... Greenteeth Stump Grinder Set (1100 Series with 32 Teeth) for 1-1/2" Wheel . $869.99. Add to Wish List. Add to Compare. #GT9 682210 ... Sharpening greenteeth - YouTube Jan 01, 2012· My grinder setup to sharpen greenteeth. 20 Extreme Fast Firewood Processor Machine, Fastest Excavator Log Splitter Wood Processing Skills - Duration: 10:19. Andrew Ward 2,080,568 views NEW SET OF GREENTEETH STUMP GRINDER TEETH FOR RAYCO … new set of greenteeth stump grinder teeth for rayco rg13 series ll grinder - $170.00. this is a new low profile greenteeth set up for a rayco rg13 series llyour machine should have a 3/8" thick cutter wheelphone price is $152.00 you get,,,, 4 - 500 series angle pockets4 - 500 series straight pockets8 - 500 series green teeth8 - 1-3/4" pocket bolts if you want a different combination of pockets ... Greenteeth \|American Arborist Supplies, tree care ... Greenteeth Greenteeth is a tooth and pocket system that provides the ability to rotate the tooth itself, providing a fresh cutting edge in a matter of seconds. This being done using only a standard wrench and without having to remove the pocket! Since each tooth can be rotated to a new edge three times, it’s like having three teeth in one! General discussion Locked ODBC Driver Manager Error By weirong_w_lue · ODBC resource DLL (c:\winnt\system32\odbcint.dll) is a different version than the ODBC driver manager (c:\winnt\system32\odbc32.dll). You need to reinstall the ODBC components to ensure proper operation. How to resolve the above Windows NT problem? This conversation is currently closed to new comments. 5 total posts (Page 1 of 1) Thread display: Collapse - \| Expand + All Comments Collapse - ODBC Driver Manager Error by Jeff Williams In reply to ODBC Driver Manager Error The easiest way would be to grab the dll from a different machine with the same config. Sounds like some software got installed that overwrote the dll. Collapse - ODBC Driver Manager Error by weirong_w_lue In reply to ODBC Driver Manager Error This schme was tested and failed. Collapse - ODBC Driver Manager Error by howarde In reply to ODBC Driver Manager Error My suggestion would be to goto http://www.microsoft.com/data and download the newest Data Access Components (MDAC) installing this should fix any inconsistincies in file versions. Collapse - ODBC Driver Manager Error by weirong_w_lue In reply to ODBC Driver Manager Error Downloading the newest MDAC was tried and fialed to resolve the problem. Collapse - ODBC Driver Manager Error by weirong_w_lue In reply to ODBC Driver Manager Error This question was closed by the author Back to Windows Forum 5 total posts (Page 1 of 1) Related Discussions Related Forums	# Grinder Green Teeth Series - Home - Grinder Green Teeth Series ## TreeStuff – 700 Wearsharp Tooth Awesome stump grinder teeth – 03/22/2018 Reviewer: RSC. We run a rental equipment company and have a couple of Toro stump grinders we use these wood chipping teeth on 700 series and they work great they will stand all of our rough abuse our customers use them on we come back every time and purchase them from tree stuff. ## Home – Greenteeth "I have been using Greenteeth for 10 years now, and continue to appreciate their durability and the ease with which they are changed. When grinding big stumps you need high horse power and sharp teeth. With three sides to a tooth and it only taking a few minutes to flip the outer two sets, green teeth are a crucial part of our system. ## Greenteeth – Product Information The 700 Series LoPro Greenteeth® are designed for machines with a horsepower of 18–35. They are made from a steel shank and have the carbide tip brazed on. As is the case for all Greenteeth®, the teeth come in two colors: Red and Green. NEW Green Teeth® Wearsharp Teeth has an innovative design which allows the tooth to wear to a new edge while cutting! ## Greenteeth – 900 Series Stump Grinding Teeth \| CEI Supply The 900 Series LoPro Greenteeth® are designed for machines with a horsepower of 35–90. They are made from a steel shank and have the carbide tip brazed on. As is the case for all Greenteeth®, the teeth come in two colors: Red and Green. NEW Green Teeth® Wearsharp Teeth has an innovative design which allows the tooth to wear to a new edge while cutting! ## TreeStuff – Green Teeth Green Teeth. Greenteeth stump grinder pockets and teeth are configurable for nearly any commercial stump grinder. The teeth can be easily rotated to provide a fresh, sharp cutting edge in a matter of seconds. Look for the Greenteeth setup for your brand of stump grinder, buy teeth or pockets individually, or purchase one of Greenteeth's cutting ... ## Stump Grinder Teeth Reviews: 5 Best Stump Grinder … If you have a large industrial or commercial stump grinder, you can benefit from these affordable GreenTeeth stump grinder teeth. They feature WearSharp technology to last longer, can be rotated three times before needing sharpened, and are durable as well. Overall, they are some of the best stump grinder teeth for the money. ## Stump Grinder Tooth Sharpening \| Blades LLC Stump Grinder Tooth Sharpening. Sharpening Stump Cutter Teeth (also referred to as Stump Grinder Teeth or Stump Bits) can be an excellent business opportunity. The AL-65 Stump Cutter Tooth Sharpener is a professional grinding system that makes sharpening various styles of carbide stump teeth fast and simple. --- # ODBC Driver Manager Error Error Message ``` ODBC resource DLL (c:\winnt\system32\odbcint.dll) is a different version than the ODBC driver manager (c:\winnt\system32\odbc32.dll). You need to reinstall the ODBC components to ensure proper operation. ``` Question How to resolve the above Windows NT problem? --- ## Comments Jeff Williams The easiest way would be to grab the DLL from a different machine with the same configuration. Sounds like some software got installed that overwrote the DLL. --- weirong_w_lue This scheme was tested and failed. --- howarde My suggestion would be to go to http://www.microsoft.com/data and download the newest Data Access Components (MDAC). Installing this should fix any inconsistencies in file versions. --- weirong_w_lue Downloading the newest MDAC was tried and failed to resolve the problem. --- weirong_w_lue This question was closed by the author.	2,115	831	7,067,199,003,124,980,000	concat	[ "concat_full" ]	0.75	true	null
1,588,770,531,802,208,500	in Form Themes for NEX-Forms v7.5 Nulled Download Form Themes for NEX-Forms v7.5 Nulled Form Themes for NEX-Forms v7.5 Nulled Free Download Form Themes for NEX-Forms v7.5 Nulled. This useful add-on will enable you to select between 25 preset themes (color schemes) to instantly change the overall look of your form. This will make it very easy to quickly and effectively fit a form’s design to your theme’s overall look and feel. Form Analytics – Analytics that gives you stats of form views, form submissions and even form interactions! Complete with line, bar, pie, polar and radar charts. NEX-Forms also provides you with GeoLocation stats! Now you can see where your form submissions came from! Cost Estimations / Math Logic – Use Math Logic to perform cost calculations based on user selections. Use any custom formulas on any number of fields! Fully Responsive – NEX-Forms easily and efficiently scales to any device from phones to tablets to desktops. Interactive Forms – Interact in real-time with your users by displaying the users input in the forms in a manner of conversation. Conditional Logic – NEX-Forms includes advanced conditional logic to show and hide form elements based on your users input. Add unlimited rules with multiple conditions and multiple actions. For example, add a rule that has a condition for 3 conditions to be true before running any number of actions. 50+ Form Elements – Make use of 50+ Bootstrap styled fields with pixel perfect precision! From special fields to uploaders and your most common form fields. Multi-Step Forms & Online Quizes – Break large forms into managable steps for your users to complete with ease. Combine multi-steps, math logic and conditional logic to create online questionnaires. Popup Forms – Trigger Popup Forms on Exit Intent, Time on Page, Scroll Position or from Buttons or Links! So, when a user tries to leave the page and/or spends x amount of time on the page and/or the user scrolls to a specified position from the top of the page then the form will popup! Submission Reports and Exports – Generate reports from your form submissions based on your own criteria. Your reports can also be exported to CSV and/or PDF! Modern Design – Designed with modern trends and techniques in mind, NEX-Forms will help you connect with your customers in a whole new and exciting way. You can Download Form Themes for NEX-Forms v7.5 Nulled form the download links below. We share files under the terms of GPL (GNU General Public License) that provides premium themes, plugins & php scripts for testing purpose only. We promote WordPress and bloggers web design and scripts to the users globally so that you can check it before buying any theme/plugin/script from the original developer/designer. If the item fulfill your requirements and you’re satisfied with it then buy it from the developer for commercial use. We don’t host any of the files, this site only contains download links from 3rd party sites by individual users which are freely available on all over the Internet. [adinserter block=”1″] [adace-ad id=”13964″] DOWNLOAD PROVIDER DOWNLOAD URL Google DriveDownload Now What do you think? 80 points Upvote Downvote This slideshow requires JavaScript. We have recently digitised many of the ‘legacy’ catalogues of our manuscript collections, and these are now available as searchable PDFs through Manchester eScholar, the University of Manchester’s Institutional Repository. Links to eScholar are provided below. Many of the catalogues were published in the early decades of the twentieth century, and they reflect the scholarship and attitudes of the period. Eventually we hope to update many of the catalogues in accordance with modern metadata standards and scholarship, but for now we hope that the PDFs will suffice. Thanks to Ben Green, Phil Butler and their teams in Digital Technologies and Services for facilitating this initiative. John Hodgson Arabic Margoliouth, D.S., Catalogue of the Arabic Papyri in the John Rylands Library Manchester (Manchester: Manchester University Press, 1933). • pp. 1-49. eScholarID:3o989 • pp. 50-143. eScholarID:3o995 • pp. 144-241. eScholarID:3o996 • Plates 1-42. eScholarID:3o997 Mingana, A., Catalogue of the Arabic Manuscripts in the John Rylands Library Manchester (Manchester: Manchester University Press, 1934). • Sections I – VI, cols. 1-332. eScholarID:3o998 • Sections VII – XII, cols. 331-716. eScholarID:3o999 • Sections XIII – Indexes, cols. 715-1192. eScholarID:3o988 Coptic Crum, Walter E., Catalogue of the Coptic Manuscripts in the Collection of the John Rylands Library Manchester (Manchester: Manchester University Press, 1909). 285 pp. eScholarID:4o977 Cuneiform Bedale, C.L., and C.H.W. Johns, Sumerian Tablets from Umma in the John Rylands Library Manchester (Manchester: Manchester University Press, 1915). 25 pp. eScholarID:4o976 Fish, T., Catalogue of the Sumerian Tablets in the John Rylands Library (Manchester: Manchester University Press, 1932). 160 pp. eScholarID:4o973 Fish, T., Letters of the First Babylonian Dynasty in the John Rylands Library (Manchester: Manchester University Press, 1936). 54 pp. eScholarID:4o972 Demotic Griffith, F.LL., Catalogue of the Demotic Papyri in the John Rylands Library Manchester (Manchester: Manchester University Press, 1909). • Vol. I, Atlas of facsimiles. 85 pp. eScholarID:4o993 • Vol. II, Hand-copies of the earlier documents (Nos. I-IX). 42 pp. eScholarID:4o987 • Vol. III, Key-list, translations, commentaries and indices. 469 pp. eScholarID:4o994 Greek Hunt, Arthur S., Catalogue of the Greek Papyri in the John Rylands Library, Manchester, Volume I, Literary Texts (Nos. 1-61). (Manchester: Manchester University Press, 1911). • Part 1: pp. 1-75. eScholarID:3o1001 • Part 2: pp. 76-178. eScholarID:3o1000 • Part 3: pp. 179-201 & Plates. eScholarID:3o986 Johnson, J. De M., Victor Martin, and Arthur S. Hunt. Catalogue of the Greek Papyri in the John Rylands Library, Manchester, Volume II, Documents of the Ptolemaic and Roman Periods (Nos. 62-456). (Manchester: Manchester University Press, 1915). • Part 1: pp. 1-487. eScholarID:3o990 • Part 2: Plates, pp. 488-510. eScholarID:3o1003 Roberts, C.H., Catalogue of the Greek and Latin Papyri in the John Rylands Library Manchester, Volume III, Theological and Literary Texts (Nos. 457-551). (Manchester: Manchester University Press, 1938). 227 pp. eScholarID:4o991 Roberts, C.H., and E.G. Turner, Catalogue of the Greek and Latin Papyri in the John Rylands Library Manchester, Volume IV, Documents of the Ptolemaic, Roman, and Byzantine Periods. (Manchester: Manchester University Press, 1952). 217 pp. eScholarID:4o992 Latin James, M.R., and Frank Taylor, A Descriptive Catalogue of the Latin Manuscripts in the John Rylands University Library (Manchester: Manchester University Press, 1980). • Catalogue, pp. 1-328. eScholarID:3o980 • Plates 1-188. eScholarID:3o979 Persian Bibliotheca Lindesiana, Hand-list of Oriental Manuscripts: Arabic, Persian, Turkish, Persian section, pp. 1-159. (Privately printed, 1898). eScholarID:3o10 Samaritan Robertson, Edward. Catalogue of the Samaritan Manuscripts in the John Rylands Library, Manchester. Volume I. (Manchester: Manchester University Press, 1962). 417 pp. eScholarID:4o970 Robertson, Edward. Catalogue of the Samaritan Manuscripts in the John Rylands Library, Manchester. Volume II The Gaster Manuscripts. (Manchester: Manchester University Press, 1938). 326 pp. eScholarID:4o969 Miscellaneous Leigh, Charles W.E., Catalogue of the Christie Collection Bequeathed to the Library of the University of Manchester, Section II: Manuscripts, pp. 461-9. (Manchester: Manchester University Press, 1915). eScholarID:3o975 Taylor, Frank, Supplementary Hand-list of Western Manuscripts in the John Rylands Library. (Manchester: Manchester University Press, 1937). 49 pp. eScholarID:4o971	# Form Themes for NEX-Forms v7.5 Nulled Free Download Form Themes for NEX-Forms v7.5 Nulled. This useful add-on enables you to select between 25 preset themes (color schemes) to instantly change the overall look of your form. It’s easy to fit a form’s design to your site’s look and feel. ## Features - Form Analytics Stats for form views, submissions and interactions with line, bar, pie, polar and radar charts. Includes GeoLocation stats. - Cost Estimations / Math Logic Perform cost calculations based on user selections. Apply custom formulas to any fields. - Fully Responsive Scales to any device—from phones and tablets to desktops. - Interactive Forms Display user input in a conversational, real-time manner. - Conditional Logic Show or hide form elements based on user input. Unlimited rules, conditions and actions. - 50+ Form Elements Over 50 Bootstrap-styled fields, from common inputs to advanced uploaders. - Multi-Step Forms & Online Quizzes Break large forms into manageable steps. Combine multi-steps with math and conditional logic. - Popup Forms Trigger by exit intent, time on page, scroll position or manual link/button. - Submission Reports and Exports Generate reports based on your criteria and export to CSV or PDF. - Modern Design Built with the latest trends and techniques. --- Download Link [Google Drive – Download Now](#) > We share files under the GPL (GNU General Public License) for testing purposes only. If the item meets your requirements, please purchase it from the original developer for commercial use. --- We have recently digitised many of the ‘legacy’ catalogues of our manuscript collections, and these are now available as searchable PDFs through Manchester eScholar, the University of Manchester’s Institutional Repository. Links to eScholar are provided below. Many of the catalogues were published in the early decades of the twentieth century, and they reflect the scholarship and attitudes of the period. Eventually we hope to update many of the catalogues in accordance with modern metadata standards and scholarship, but for now we hope that the PDFs will suffice. Thanks to Ben Green, Phil Butler and their teams in Digital Technologies and Services for facilitating this initiative. John Hodgson ## Arabic - Margoliouth, D.S., Catalogue of the Arabic Papyri in the John Rylands Library Manchester (Manchester University Press, 1933) • pp. 1–49. eScholarID: 3o989 • pp. 50–143. eScholarID: 3o995 • pp. 144–241. eScholarID: 3o996 • Plates 1–42. eScholarID: 3o997 - Mingana, A., Catalogue of the Arabic Manuscripts in the John Rylands Library Manchester (Manchester University Press, 1934) • Sections I–VI, cols. 1–332. eScholarID: 3o998 • Sections VII–XII, cols. 331–716. eScholarID: 3o999 • Sections XIII–Indexes, cols. 715–1192. eScholarID: 3o988 ## Coptic - Crum, Walter E., Catalogue of the Coptic Manuscripts in the Collection of the John Rylands Library Manchester (Manchester University Press, 1909) • 285 pp. eScholarID: 4o977 ## Cuneiform - Bedale, C.L., and C.H.W. Johns, Sumerian Tablets from Umma in the John Rylands Library Manchester (Manchester University Press, 1915) • 25 pp. eScholarID: 4o976 - Fish, T., Catalogue of the Sumerian Tablets in the John Rylands Library (Manchester University Press, 1932) • 160 pp. eScholarID: 4o973 - Fish, T., Letters of the First Babylonian Dynasty in the John Rylands Library (Manchester University Press, 1936) • 54 pp. eScholarID: 4o972 ## Demotic - Griffith, F.LL., Catalogue of the Demotic Papyri in the John Rylands Library Manchester (Manchester University Press, 1909) • Vol. I, Atlas of facsimiles. 85 pp. eScholarID: 4o993 • Vol. II, Hand-copies of the earlier documents (Nos. I–IX). 42 pp. eScholarID: 4o987 • Vol. III, Key-list, translations, commentaries and indices. 469 pp. eScholarID: 4o994 ## Greek - Hunt, Arthur S., Catalogue of the Greek Papyri in the John Rylands Library, Manchester, Volume I, Literary Texts (Nos. 1–61) (Manchester University Press, 1911) • Part 1: pp. 1–75. eScholarID: 3o1001 • Part 2: pp. 76–178. eScholarID: 3o1000 • Part 3: pp. 179–201 & Plates. eScholarID: 3o986 - Johnson, J. De M., Victor Martin, and Arthur S. Hunt, Catalogue of the Greek Papyri in the John Rylands Library, Manchester, Volume II, Documents of the Ptolemaic and Roman Periods (Nos. 62–456) (Manchester University Press, 1915) • Part 1: pp. 1–487. eScholarID: 3o990 • Part 2: Plates, pp. 488–510. eScholarID: 3o1003 - Roberts, C.H., Catalogue of the Greek and Latin Papyri in the John Rylands Library Manchester, Volume III, Theological and Literary Texts (Nos. 457–551) (Manchester University Press, 1938) • 227 pp. eScholarID: 4o991 - Roberts, C.H., and E.G. Turner, Catalogue of the Greek and Latin Papyri in the John Rylands Library Manchester, Volume IV, Documents of the Ptolemaic, Roman, and Byzantine Periods (Manchester University Press, 1952) • 217 pp. eScholarID: 4o992 ## Latin - James, M.R., and Frank Taylor, A Descriptive Catalogue of the Latin Manuscripts in the John Rylands University Library (Manchester University Press, 1980) • Catalogue, pp. 1–328. eScholarID: 3o980 • Plates 1–188. eScholarID: 3o979 ## Persian - Bibliotheca Lindesiana, Hand-list of Oriental Manuscripts: Arabic, Persian, Turkish, Persian section (Privately printed, 1898) • pp. 1–159. eScholarID: 3o10 ## Samaritan - Robertson, Edward, Catalogue of the Samaritan Manuscripts in the John Rylands Library, Manchester. Volume I (Manchester University Press, 1962) • 417 pp. eScholarID: 4o970 - Robertson, Edward, Catalogue of the Samaritan Manuscripts in the John Rylands Library, Manchester. Volume II The Gaster Manuscripts (Manchester University Press, 1938) • 326 pp. eScholarID: 4o969 ## Miscellaneous - Leigh, Charles W.E., Catalogue of the Christie Collection Bequeathed to the Library of the University of Manchester, Section II: Manuscripts (Manchester University Press, 1915) • pp. 461–469. eScholarID: 3o975 - Taylor, Frank, Supplementary Hand-list of Western Manuscripts in the John Rylands Library (Manchester University Press, 1937) • 49 pp. eScholarID: 4o971	2,005	1,759	1,588,770,531,802,208,500	concat	[ "concat_full" ]	0.75	true	null

Subsets and Splits

No community queries yet

The top public SQL queries from the community will appear here once available.