Epitope ID stringlengths 8 35 | Epitope stringclasses 5
values | Epitope.1 stringlengths 1 829 | Epitope.2 stringlengths 2 111 ⌀ | Epitope.3 stringclasses 47
values | Epitope.4 stringlengths 1 17 ⌀ | Epitope.5 stringlengths 1 15 ⌀ | Epitope.6 stringlengths 3 43 ⌀ | Epitope.7 stringlengths 2 3.89k ⌀ | Epitope.8 stringlengths 1 433 ⌀ | Epitope.9 stringlengths 19 51 ⌀ | Epitope.10 stringlengths 1 188 ⌀ | Epitope.11 stringlengths 19 43 ⌀ | Epitope.12 stringlengths 4 95 ⌀ | Epitope.13 stringlengths 19 48 ⌀ | Epitope.14 stringlengths 4 52 ⌀ | Epitope.15 stringlengths 11 48 ⌀ | Related Object stringclasses 7
values | Related Object.1 stringclasses 11
values | Related Object.2 stringlengths 2 1.53k ⌀ | Related Object.3 stringlengths 1 17 ⌀ | Related Object.4 stringlengths 1 15 ⌀ | Related Object.5 stringclasses 81
values | Related Object.6 stringlengths 1 1.59k ⌀ | Related Object.7 stringlengths 2 286 ⌀ | Related Object.8 stringlengths 19 51 ⌀ | Related Object.9 stringlengths 3 144 ⌀ | Related Object.10 stringlengths 19 41 ⌀ | Related Object.11 stringclasses 494
values | Related Object.12 stringclasses 390
values | Related Object.13 stringclasses 251
values | Related Object.14 stringclasses 251
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
IEDB IRI | Object Type | Name | Modified Residue(s) | Modifications | Starting Position | Ending Position | IRI | Synonyms | Source Molecule | Source Molecule IRI | Molecule Parent | Molecule Parent IRI | Source Organism | Source Organism IRI | Species | Species IRI | Epitope Relation | Object Type | Name | Starting Position | Ending Position | IRI | Synonyms | Source Molecule | Source Molecule IRI | Molecule Parent | Molecule Parent IRI | Source Organism | Source Organism IRI | Species | Species IRI |
http://www.iedb.org/epitope/1 | Linear peptide | AA + MCM(A1,A2) | A1,A2 | Main chain modification | 200 | 201 | null | null | streptokinase, SKase | http://www.ncbi.nlm.nih.gov/protein/AAB20743.1 | Streptokinase A | http://www.uniprot.org/uniprot/P10520 | Streptococcus pyogenes serotype M3 D58 | https://ontology.iedb.org/ontology/ONTIE_0000450 | Streptococcus pyogenes | http://purl.obolibrary.org/obo/NCBITaxon_1314 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/2 | Linear peptide | AAAAAAAAAAAAA | null | null | 489 | 501 | null | null | RNA-binding protein 47 | https://www.uniprot.org/uniprot/A0AV96.2 | RNA-binding protein 47 | http://www.uniprot.org/uniprot/A0AV96 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/3 | Linear peptide | AAAAAAAAAAAANANIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/4 | Linear peptide | AAAAAAAAAAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/5 | Linear peptide | AAAAAAAAAFAAK | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/6 | Linear peptide | AAAAAAAAAKAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | PKYVKQNTLKLAT | 306 | 318 | null | hemagglutinin subunit 2 | hemagglutinin precursor | http://www.ncbi.nlm.nih.gov/protein/AAA43143.1 | Hemagglutinin | http://www.uniprot.org/uniprot/P03452 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 | Influenza A virus | http://purl.obolibrary.org/obo/NCBITaxon_11320 |
http://www.iedb.org/epitope/7 | Linear peptide | AAAAAAAATAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/8 | Linear peptide | AAAAAAATTAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/9 | Linear peptide | AAAAAACTTAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/10 | Linear peptide | AAAAAIFVI | null | null | 296 | 304 | null | null | MHC class I related protein A | http://www.ncbi.nlm.nih.gov/protein/AAU95382.1 | MHC class I polypeptide-related sequence A | http://www.uniprot.org/uniprot/A0A140T9M1 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/11 | Linear peptide | AAAAALDKKQRNFDKILA | null | null | 1436 | 1453 | null | null | MYH7 protein | http://www.ncbi.nlm.nih.gov/protein/ABQ59035.1 | Myosin-7 | http://www.uniprot.org/uniprot/P12883 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/12 | Linear peptide | AAAAARAAL | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/13 | Linear peptide | AAAAATQAAGAGAVA | null | null | 181 | 195 | null | null | PPE FAMILY PROTEIN | http://www.ncbi.nlm.nih.gov/protein/Q79FV1.1 | Uncharacterized PPE family protein PPE14 | http://www.uniprot.org/uniprot/P9WI33 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/14 | Linear peptide | AAAAAVAAEAY | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/15 | Linear peptide | AAAAAVCTTAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/16 | Linear peptide | AAAAAWDGVAAELTS | null | null | 26 | 40 | null | null | PPE FAMILY PROTEIN | http://www.ncbi.nlm.nih.gov/protein/Q79FV1.1 | Uncharacterized PPE family protein PPE14 | http://www.uniprot.org/uniprot/P9WI33 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/17 | Linear peptide | AAAAGSGASGAVPPAGGPSP | null | null | 1258 | 1277 | null | null | merozoite surface antigen 1 | http://www.ncbi.nlm.nih.gov/protein/AAA63427.1 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/A5K724 | Plasmodium vivax | http://purl.obolibrary.org/obo/NCBITaxon_5855 | Plasmodium vivax | http://purl.obolibrary.org/obo/NCBITaxon_5855 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/18 | Linear peptide | AAAAKAAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/19 | Linear peptide | AAAAKLAGLVFPQPPAPIAV | null | null | 14 | 33 | null | null | hypothetical protein Rv3878 - Mycobacterium tuberculosis (strain H37RV) | http://www.ncbi.nlm.nih.gov/protein/D70803 | ESX-1 secretion-associated protein EspJ | http://www.uniprot.org/uniprot/P9WJC3 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/20 | Linear peptide | AAAAMAAAATPYVGW | null | null | 61 | 75 | null | null | PPE FAMILY PROTEIN | http://www.ncbi.nlm.nih.gov/protein/CAE55334.1 | Uncharacterized PPE family protein PPE14 | http://www.uniprot.org/uniprot/P9WI33 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/21 | Linear peptide | AAAAPYAGW | null | null | 67 | 75 | null | null | PPE FAMILY PROTEIN | http://www.ncbi.nlm.nih.gov/protein/Q7TWN7 | PPE family protein PPE55 | http://www.uniprot.org/uniprot/Q6MWX9 | Mycobacterium tuberculosis variant bovis BCG str. Pasteur 1173P2 | http://purl.obolibrary.org/obo/NCBITaxon_410289 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/22 | Linear peptide | AAAARAAAL | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/23 | Linear peptide | AAAARYPNVTIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | AFHERYPNVTITA | 71 | 83 | null | pstS1 | Phosphate-binding protein pstS 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P15712.1 | Phosphate-binding protein PstS 1 | http://www.uniprot.org/uniprot/P9WGU1 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/24 | Linear peptide | AAAATCALV | null | null | 296 | 304 | null | null | SPI-2 | http://www.ncbi.nlm.nih.gov/protein/AAA48346.1 | Serine proteinase inhibitor 2 | http://www.uniprot.org/uniprot/P15059 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/25 | Linear peptide | AAAATPYVGWLAATA | null | null | 66 | 80 | null | null | PPE FAMILY PROTEIN | http://www.ncbi.nlm.nih.gov/protein/Q79FV1.1 | Uncharacterized PPE family protein PPE14 | http://www.uniprot.org/uniprot/P9WI33 | Mycobacterium tuberculosis H37Rv | http://purl.obolibrary.org/obo/NCBITaxon_83332 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/26 | Linear peptide | AAAAVVCTTAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/27 | Linear peptide | AAAAYRAAAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | ASQKRPSQRHG | 2 | 12 | null | MBP, PLPPR3 | MBP protein | http://www.ncbi.nlm.nih.gov/protein/AAH08749.3 | Myelin basic protein | http://www.uniprot.org/uniprot/P02686 | Homo sapiens (human) | http://purl.obolibrary.org/obo/NCBITaxon_9606 | Homo sapiens | http://purl.obolibrary.org/obo/NCBITaxon_9606 |
http://www.iedb.org/epitope/28 | Linear peptide | AAADVYAKTDQSLGTSLSQY | null | null | 74 | 93 | null | null | CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN | http://www.ncbi.nlm.nih.gov/protein/CAA17970.1 | ESX-1 secretion-associated protein EspJ | http://www.uniprot.org/uniprot/P9WJC3 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/29 | Linear peptide | AAAEGVGKDNKLSVLLFTTQ | null | null | 91 | 110 | null | null | putative M2L | http://www.ncbi.nlm.nih.gov/protein/AAA48004.1 | Early protein OPG038 | http://www.uniprot.org/uniprot/Q80HY2 | Vaccinia virus Copenhagen | http://purl.obolibrary.org/obo/NCBITaxon_10249 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/30 | Linear peptide | AAAEKAITVGAS | null | null | 322 | 333 | null | null | Subtilisin-like serine protease Pen ch 18.0101 | https://www.uniprot.org/uniprot/Q9P8G3.1 | Subtilisin-like serine protease EN45_078720 | http://www.uniprot.org/uniprot/P9WEW6 | Penicillium chrysogenum | http://purl.obolibrary.org/obo/NCBITaxon_5076 | Penicillium chrysogenum | http://purl.obolibrary.org/obo/NCBITaxon_5076 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/31 | Linear peptide | AAAEKTEKSVSA | null | null | 76 | 87 | null | null | Probable endopeptidase p60 | https://www.uniprot.org/uniprot/P21171.2 | Probable endopeptidase p60 | http://www.uniprot.org/uniprot/P21171 | Listeria monocytogenes EGD-e | http://purl.obolibrary.org/obo/NCBITaxon_169963 | Listeria monocytogenes | http://purl.obolibrary.org/obo/NCBITaxon_1639 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/32 | Linear peptide | AAAETGVGVIKSIAP | null | null | 180 | 194 | null | null | Toxin coregulated pilin precursor | http://www.ncbi.nlm.nih.gov/protein/P23024.1 | Toxin coregulated pilin | http://www.uniprot.org/uniprot/Q60153 | Vibrio cholerae O1 | http://purl.obolibrary.org/obo/NCBITaxon_127906 | Vibrio cholerae | http://purl.obolibrary.org/obo/NCBITaxon_666 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/33 | Linear peptide | AAAGAVVGGLGGYMLG | null | null | 115 | 130 | null | null | Major prion protein | https://www.uniprot.org/uniprot/P04925.2 | Major prion protein | http://www.uniprot.org/uniprot/P04925 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | Mus musculus | http://purl.obolibrary.org/obo/NCBITaxon_10090 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/34 | Linear peptide | AAAGDK | null | null | 7 | 12 | null | null | B13 antigen | http://www.ncbi.nlm.nih.gov/protein/AAP88022.1 | Surface antigen 2 (CA-2), putative | http://www.uniprot.org/uniprot/Q4DX15 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/35 | Linear peptide | AAAGFASKTPANQAISMIDG | null | null | 284 | 303 | null | null | Phosphate-binding protein pstS 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P15712.1 | Phosphate-binding protein PstS 1 | http://www.uniprot.org/uniprot/P9WGU1 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/36 | Linear peptide | AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT | null | null | 40 | 79 | null | null | Glycoprotein 4 | http://www.ncbi.nlm.nih.gov/protein/Q04568.1 | Glycoprotein 4 | http://www.uniprot.org/uniprot/Q04568 | Lelystad virus | http://purl.obolibrary.org/obo/NCBITaxon_11049 | Betaarterivirus suid 1 | http://purl.obolibrary.org/obo/NCBITaxon_2499680 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/37 | Linear peptide | AAAGNEGTSGSSSTV | null | null | 258 | 272 | null | null | Subtilisin BPN' precursor (Subtilisin Novo) (Subtilisin DFE) (Alkaline protease) | http://www.ncbi.nlm.nih.gov/protein/P00782.1 | Extracellular alkaline serine protease | http://www.uniprot.org/uniprot/A0A9P1JG13 | Bacillus amyloliquefaciens | http://purl.obolibrary.org/obo/NCBITaxon_1390 | Bacillus amyloliquefaciens | http://purl.obolibrary.org/obo/NCBITaxon_1390 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/38 | Linear peptide | AAAGTHGIGWILVA | null | null | null | null | null | null | Genome polyprotein | https://ontology.iedb.org/ontology/ONTIE_0002561 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus genotype 3 | http://purl.obolibrary.org/obo/NCBITaxon_356114 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/39 | Linear peptide | AAAIFMTATPPGTAD | null | null | 1783 | 1797 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/ANS59201.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P17763 | dengue virus type 3 | http://purl.obolibrary.org/obo/NCBITaxon_11069 | Dengue virus | http://purl.obolibrary.org/obo/NCBITaxon_12637 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/40 | Linear peptide | AAAKAAAAV | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/41 | Linear peptide | AAAKTPVIV | null | null | 2 | 10 | null | null | IMV heparin binding surface protein | http://www.ncbi.nlm.nih.gov/protein/YP_232983.1 | Envelope protein OPG108 | http://www.uniprot.org/uniprot/P07240 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/42 | Linear peptide | AAAKTPVIVV | null | null | 2 | 11 | null | null | IMV heparin binding surface protein | http://www.ncbi.nlm.nih.gov/protein/AAO89380.1 | Envelope protein OPG108 | http://www.uniprot.org/uniprot/P07240 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/43 | Linear peptide | AAAKVTALLSSLTVTRLLRR | null | null | 1948 | 1967 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/Q81487.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/44 | Linear peptide | AAALALHFL | null | null | 310 | 318 | null | null | Tegument protein UL25 | http://www.ncbi.nlm.nih.gov/protein/P16761.1 | Phosphoprotein 85 | http://www.uniprot.org/uniprot/P16761 | Human herpesvirus 5 strain AD169 | http://purl.obolibrary.org/obo/NCBITaxon_10360 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/45 | Linear peptide | AAALALLASLILGT | null | null | 305 | 318 | null | null | Latent membrane protein 2 | https://www.uniprot.org/uniprot/P13285.1 | Latent membrane protein 2 | http://www.uniprot.org/uniprot/P13285 | Human herpesvirus 4 strain B95-8 | http://purl.obolibrary.org/obo/NCBITaxon_10377 | human gammaherpesvirus 4 | http://purl.obolibrary.org/obo/NCBITaxon_10376 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/46 | Linear peptide | AAALEQLLGQTADVA | null | null | 54 | 68 | null | null | hypothetical protein ML1057 | http://www.ncbi.nlm.nih.gov/protein/NP_301777.1 | Uncharacterized protein | http://www.uniprot.org/uniprot/Q7AQA0 | Mycobacterium leprae | http://purl.obolibrary.org/obo/NCBITaxon_1769 | Mycobacterium leprae | http://purl.obolibrary.org/obo/NCBITaxon_1769 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/47 | Linear peptide | AAALGY | null | null | 121 | 126 | null | null | CFA/I fimbrial subunit B precursor | http://www.ncbi.nlm.nih.gov/protein/P02971.3 | null | null | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | Escherichia coli | http://purl.obolibrary.org/obo/NCBITaxon_562 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/48 | Linear peptide | AAALILSKHPNLSAS | null | null | 334 | 348 | null | null | Subtilisin Carlsberg precursor | http://www.ncbi.nlm.nih.gov/protein/P00780.1 | Apr | http://www.uniprot.org/uniprot/Q65LP7 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | Bacillus licheniformis | http://purl.obolibrary.org/obo/NCBITaxon_1402 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/49 | Linear peptide | AAALPGKCGV | null | null | 66 | 75 | null | null | Non-specific lipid-transfer protein 1 | http://www.ncbi.nlm.nih.gov/protein/P81402.1 | Non-specific lipid-transfer protein | http://www.uniprot.org/uniprot/Q5RZZ3 | Prunus persica | http://purl.obolibrary.org/obo/NCBITaxon_3760 | Prunus persica | http://purl.obolibrary.org/obo/NCBITaxon_3760 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/50 | Linear peptide | AAANPTGP | null | null | 42 | 49 | null | null | Immunogenic protein MPB70 precursor | http://www.ncbi.nlm.nih.gov/protein/P0A669.1 | Immunogenic protein MPT70 | http://www.uniprot.org/uniprot/P9WNF5 | Mycobacterium tuberculosis variant bovis | http://purl.obolibrary.org/obo/NCBITaxon_1765 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/51 | Linear peptide | AAANPTGPASVQGMSQ | null | null | 42 | 57 | null | null | Immunogenic protein MPB70 precursor | http://www.ncbi.nlm.nih.gov/protein/P0A669.1 | Immunogenic protein MPT70 | http://www.uniprot.org/uniprot/P9WNF5 | Mycobacterium bovis T/91/1378 | https://ontology.iedb.org/ontology/ONTIE_0000236 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/52 | Linear peptide | AAANTSDSQKE | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/53 | Linear peptide | AAAPVAHFQGSLPEVPAYNA | null | null | 202 | 221 | null | null | Probable coat protein VP1 | http://www.ncbi.nlm.nih.gov/protein/P07299.1 | Minor capsid protein VP1 | http://www.uniprot.org/uniprot/Q9PZT0 | Human parvovirus B19 | http://purl.obolibrary.org/obo/NCBITaxon_10798 | Erythroparvovirus primate1 | http://purl.obolibrary.org/obo/NCBITaxon_3052189 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/54 | Linear peptide | AAAQHGHMHGS | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/55 | Linear peptide | AAARASMVFE + NAc(A1) | A1 | N-acetylation | 1449 | 1458 | null | null | ORF 1 | http://www.ncbi.nlm.nih.gov/protein/AAA03189.1 | Non-structural polyprotein pORF1 | http://www.uniprot.org/uniprot/Q81862 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/56 | Linear peptide | AAARTTS | null | null | 7 | 13 | null | null | envelope glycoprotein 2 | http://www.ncbi.nlm.nih.gov/protein/ABP93610.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/57 | Linear peptide | AAARVTALLSSLTVTSLLRR | null | null | 1946 | 1965 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAC03058.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/58 | Linear peptide | AAARVTQILSSLTITQLLKR | null | null | 1940 | 1959 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA86907.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/59 | Linear peptide | AAASAIQG | null | null | 13 | 20 | null | null | 6 kDa early secretory antigenic target | http://www.ncbi.nlm.nih.gov/protein/P0A564.2 | 6 kDa early secretory antigenic target | http://www.uniprot.org/uniprot/P9WNK7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/60 | Linear peptide | AAASAIQGNVTSIHSL | null | null | 13 | 28 | null | null | 6 kDa early secretory antigenic target | http://www.ncbi.nlm.nih.gov/protein/P0A564.2 | 6 kDa early secretory antigenic target | http://www.uniprot.org/uniprot/P9WNK7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/61 | Linear peptide | AAASKVKANLLSVEE | null | null | 2493 | 2507 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/62 | Linear peptide | AAASVVCTTAAGNVNIAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | analog | Fragment of a Natural Sequence Molecule | VTGSVVCTTAAGNVNIAIGG | 61 | 80 | null | lpqH | Lipoprotein lpqH precursor | http://www.ncbi.nlm.nih.gov/protein/P0A5J0.1 | Lipoprotein LpqH | http://www.uniprot.org/uniprot/P9WK61 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 |
http://www.iedb.org/epitope/63 | Linear peptide | AAATPATPAATPA | null | null | 34 | 46 | null | null | Pollen allergen Lol p VA | https://www.uniprot.org/uniprot/Q9XF24.1 | Lol p 5 | http://www.uniprot.org/uniprot/Q40237 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | Lolium perenne | http://purl.obolibrary.org/obo/NCBITaxon_4522 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/64 | Linear peptide | AAAVGGAAAV + NAc(A1) | A1 | N-acetylation | 41 | 50 | null | null | ORF 3 | http://www.ncbi.nlm.nih.gov/protein/AAA03190.1 | Protein ORF3 | http://www.uniprot.org/uniprot/Q81870 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | Paslahepevirus balayani | http://purl.obolibrary.org/obo/NCBITaxon_1678143 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/65 | Linear peptide | AAAVLNLT | null | null | 307 | 314 | null | null | major outer membrane protein | http://www.ncbi.nlm.nih.gov/protein/1616229A | null | null | Chlamydia psittaci | http://purl.obolibrary.org/obo/NCBITaxon_83554 | Chlamydia psittaci | http://purl.obolibrary.org/obo/NCBITaxon_83554 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/66 | Linear peptide | AAAWGGSGSEAYQGVQQKWDATA | null | null | 40 | 62 | null | null | 6 kDa early secretory antigenic target | http://www.ncbi.nlm.nih.gov/protein/P0A564.2 | 6 kDa early secretory antigenic target | http://www.uniprot.org/uniprot/P9WNK7 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/67 | Linear peptide | AAAYAAAAAAKAAAA | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/68 | Linear peptide | AAAYFVGYLK | null | null | 249 | 258 | null | null | Spike glycoprotein | https://www.uniprot.org/uniprot/P59594.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/69 | Linear peptide | AAAYFVGYLKPTTFM | null | null | 249 | 263 | null | null | Spike glycoprotein | https://www.uniprot.org/uniprot/P59594.1 | Spike glycoprotein | http://www.uniprot.org/uniprot/P59594 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/70 | Linear peptide | AACAGNRVRRSVGSSLKC | null | null | null | null | null | null | Diphtheria toxin | https://ontology.iedb.org/ontology/ONTIE_0002889 | Diphtheria toxin | http://www.uniprot.org/uniprot/Q6NK15 | Corynebacterium diphtheriae | http://purl.obolibrary.org/obo/NCBITaxon_1717 | Corynebacterium diphtheriae | http://purl.obolibrary.org/obo/NCBITaxon_1717 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/71 | Linear peptide | AACAMLLVK | null | null | 3599 | 3607 | null | null | Replicase polyprotein 1ab | http://www.ncbi.nlm.nih.gov/protein/P59641.2 | Replicase polyprotein 1ab | http://www.uniprot.org/uniprot/P0C6X7 | SARS coronavirus Tor2 | http://purl.obolibrary.org/obo/NCBITaxon_227984 | SARS-CoV1 | https://ontology.iedb.org/taxon/10002316 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/72 | Linear peptide | AACGDIINGLPVSARRGREI | null | null | 991 | 1010 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/73 | Linear peptide | AACIVGCENV | null | null | 369 | 378 | null | null | cysteine proteinase cruzipain (EC 3.4.22.-) - Trypanosoma cruzi | http://www.ncbi.nlm.nih.gov/protein/A45629 | Cysteine peptidase, putative | http://www.uniprot.org/uniprot/Q4E0J7 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | Trypanosoma cruzi | http://purl.obolibrary.org/obo/NCBITaxon_5693 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/74 | Linear peptide | AACLTSKAYQQGVTV | null | null | 225 | 239 | null | null | virion glycoprotein D | http://www.ncbi.nlm.nih.gov/protein/CAB06713.1 | Envelope glycoprotein D | http://www.uniprot.org/uniprot/Q69467 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | Human alphaherpesvirus 2 | http://purl.obolibrary.org/obo/NCBITaxon_10310 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/75 | Linear peptide | AACNWTRGERCD | null | null | 642 | 653 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P27958.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate H) | http://purl.obolibrary.org/obo/NCBITaxon_11108 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/76 | Linear peptide | AACRAA | null | null | 2720 | 2725 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26663.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 1b | http://purl.obolibrary.org/obo/NCBITaxon_31647 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/77 | Linear peptide | AACRAAGL | null | null | 2721 | 2728 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26664.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate 1) | http://purl.obolibrary.org/obo/NCBITaxon_11104 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/78 | Linear peptide | AACRAAGLQDCTMLV | null | null | 2721 | 2735 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/79 | Linear peptide | AACRAAGLQDCTMLVC | null | null | 2721 | 2736 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26664.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate 1) | http://purl.obolibrary.org/obo/NCBITaxon_11104 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/80 | Linear peptide | AACRAAGLQDCTMLVCGDDL | null | null | 2721 | 2740 | null | null | HCV-1 | http://www.ncbi.nlm.nih.gov/protein/AAA45676.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/81 | Linear peptide | AADAILHTPGCV | null | null | 216 | 227 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P27958.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate H) | http://purl.obolibrary.org/obo/NCBITaxon_11108 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/82 | Linear peptide | AADAILHTPGCVPC | null | null | 216 | 229 | null | null | Genome polyprotein | https://www.uniprot.org/uniprot/P26664.3 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | hepatitis C virus genotype 1a | http://purl.obolibrary.org/obo/NCBITaxon_2847144 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/83 | Linear peptide | AADAILHTPGCVPCV | null | null | 216 | 230 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAB67036.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus (isolate H77) | http://purl.obolibrary.org/obo/NCBITaxon_63746 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/84 | Linear peptide | AADELVGGPPVEASAAAL | null | null | 14 | 31 | null | null | POSSIBLE phiRv2 PROPHAGE PROTEIN | http://www.ncbi.nlm.nih.gov/protein/CAB02330.1 | Antitoxin Rv2654c | http://www.uniprot.org/uniprot/P9WJ11 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/85 | Linear peptide | AADEVWALRDQTAESPVEDS | null | null | 694 | 713 | null | null | phosphoprotein 150 | http://www.ncbi.nlm.nih.gov/protein/AAA45992.1 | Large structural phosphoprotein | http://www.uniprot.org/uniprot/P08318 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | Human betaherpesvirus 5 | http://purl.obolibrary.org/obo/NCBITaxon_10359 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/86 | Linear peptide | AADHCPVVEVNGVTI | null | null | 416 | 430 | null | null | Fusion glycoprotein F0 precursor | http://www.ncbi.nlm.nih.gov/protein/P69353.1 | Fusion glycoprotein F0 | http://www.uniprot.org/uniprot/Q786F3 | Measles virus strain Edmonston | http://purl.obolibrary.org/obo/NCBITaxon_11235 | Measles morbillivirus | http://purl.obolibrary.org/obo/NCBITaxon_11234 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/87 | Linear peptide | AADKAAAAAY | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/88 | Linear peptide | AADKAAAAY | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/89 | Linear peptide | AADKPTLDIRMMNIEA | null | null | 210 | 225 | null | null | envelope protein | http://www.ncbi.nlm.nih.gov/protein/ABM65593.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P05769 | Murray Valley encephalitis virus | http://purl.obolibrary.org/obo/NCBITaxon_11079 | Orthoflavivirus murrayense | http://purl.obolibrary.org/obo/NCBITaxon_3048215 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/90 | Linear peptide | AADKPTLDIRMMNIEATNLAL | null | null | 35 | 55 | null | null | envelope protein E | http://www.ncbi.nlm.nih.gov/protein/NP_722531.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P05769 | Murray valley encephalitis virus (strain MVE-1-51) | http://purl.obolibrary.org/obo/NCBITaxon_301478 | Orthoflavivirus murrayense | http://purl.obolibrary.org/obo/NCBITaxon_3048215 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/91 | Linear peptide | AADLTQIFEV | null | null | 155 | 164 | null | null | Protein K4 | http://www.ncbi.nlm.nih.gov/protein/P18377.1 | Virion nicking-joining enzyme | http://www.uniprot.org/uniprot/P18377 | Vaccinia virus WR | http://purl.obolibrary.org/obo/NCBITaxon_10254 | Vaccinia virus | http://purl.obolibrary.org/obo/NCBITaxon_10245 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/92 | Linear peptide | AADMIMHTPGCVPC | null | null | 216 | 229 | null | null | polyprotein | http://www.ncbi.nlm.nih.gov/protein/AAA45721.1 | Genome polyprotein | http://www.uniprot.org/uniprot/P27958 | Hepatitis C virus subtype 1b | http://purl.obolibrary.org/obo/NCBITaxon_31647 | Hepacivirus hominis | http://purl.obolibrary.org/obo/NCBITaxon_3052230 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/93 | Linear peptide | AADMWGPSSDPAWER | null | null | 164 | 178 | null | null | diacylglycerol acyltransferase, partial | http://www.ncbi.nlm.nih.gov/protein/WP_031736382.1 | Diacylglycerol acyltransferase/mycolyltransferase Ag85B | http://www.uniprot.org/uniprot/P9WQP1 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | Mycobacterium tuberculosis | http://purl.obolibrary.org/obo/NCBITaxon_1773 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/94 | Linear peptide | AADNDKNS | null | null | 451 | 458 | null | null | Merozoite surface protein 1 precursor | http://www.ncbi.nlm.nih.gov/protein/P04934.2 | Merozoite surface protein 1 | http://www.uniprot.org/uniprot/Q8I0U8 | Plasmodium falciparum CAMP/Malaysia | http://purl.obolibrary.org/obo/NCBITaxon_5835 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/95 | Linear peptide | AADQARELINSW | null | null | 138 | 149 | null | null | ovalbumin | http://www.ncbi.nlm.nih.gov/protein/AAA48998.1 | Gal d 2 | http://www.uniprot.org/uniprot/P01012 | Gallus gallus | http://purl.obolibrary.org/obo/NCBITaxon_9031 | Gallus gallus | http://purl.obolibrary.org/obo/NCBITaxon_9031 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/96 | Linear peptide | AADQLPNV | null | null | 166 | 173 | null | null | major outer membrane protein | http://www.ncbi.nlm.nih.gov/protein/1616229A | null | null | Chlamydia psittaci | http://purl.obolibrary.org/obo/NCBITaxon_83554 | Chlamydia psittaci | http://purl.obolibrary.org/obo/NCBITaxon_83554 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/97 | Linear peptide | AADSFATSY | null | null | 1433 | 1441 | null | null | RNA polymerase | http://www.ncbi.nlm.nih.gov/protein/AAG22533.4 | Envelopment polyprotein | http://www.uniprot.org/uniprot/O55346 | Orthohantavirus andesense | http://purl.obolibrary.org/obo/NCBITaxon_1980456 | Orthohantavirus andesense | http://purl.obolibrary.org/obo/NCBITaxon_1980456 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/98 | Linear peptide | AADTIASGSQRSTNS | null | null | 91 | 105 | null | null | merozoite surface antigen 2 | http://www.ncbi.nlm.nih.gov/protein/CAA73082.1 | Merozoite surface protein 2 | http://www.uniprot.org/uniprot/P50498 | Plasmodium falciparum FC27/Papua New Guinea | http://purl.obolibrary.org/obo/NCBITaxon_5837 | Plasmodium falciparum | http://purl.obolibrary.org/obo/NCBITaxon_5833 | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
http://www.iedb.org/epitope/99 | Linear peptide | AAEAAAAAY | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null | null |
End of preview. Expand in Data Studio
YAML Metadata Warning:empty or missing yaml metadata in repo card
Check out the documentation for more information.
Dataset Summary
- The EpicNet dataset is a curated integration of peptide and protein epitope records extracted from the Immune Epitope Database (IEDB) and related immunoinformatics resources. It standardizes linear peptide epitope representations, cross-links source molecules, organisms, and taxonomy references, and unifies metadata under consistent ontological mappings.
- It supports bioinformatics, machine learning on epitope prediction, and immunotherapy research by providing aligned, structured representations of epitopes, their parent proteins, and associated immune contexts.
Supported Tasks and Use Cases
- Epitope–Protein Mapping — link and analyze how antigenic peptides relate to their source proteins and organisms.
- Sequence-Based Epitope Prediction — train models to predict immunogenic peptide segments.
- Antigen Similarity & Cross-reactivity Studies — compare epitopes across species for vaccine development.
- Knowledge Graph Integration — generate RDF/OWL graphs for ontology-powered immunoinformatics.
- Embedding Generation and Representation Learning using transformers or peptide encoders (e.g., ESM, ProtBERT).
Dataset Structure
Record Count
- 2,308,224 rows representing peptide–protein associations
- Average peptide length: 8–35 amino acids
- Approximate dataset size: 85.8 MB (raw TSV) / 156 MB (Parquet)
Data Sources and Provenance
- IEDB (Immune Epitope Database) — canonical epitope and antigen relationships
- UniProt / NCBI Protein — sequence-level references
- NCBI Taxonomy — standardized organism identifiers
- Each entry maps identifiers to IEDB IRIs, providing internationally traceable cross‑links.
Languages and Data Format
- Sequence representation: Amino acid single-letter codes (A–Y)
- Metadata fields: English-language labels and ontology-class terms
- Format: TSV / Parquet (CSV-compatible with structured metadata)
Intended Uses
- Computational immunology pipelines (e.g., T-cell / B-cell epitope classifier fine-tuning)
- Graph-based representation of immune networks
- Comparative peptide analytics across pathogens and hosts
- Foundation datasets for large-scale protein–epitope pretraining
Limitations and Ethical Considerations
- Dataset reflects experimentally or computationally curated peptide sequences; not all records are experimentally verified.
- Certain peptide segments appear across species due to homologs or predicted analogs.
- Users must verify NCBI Taxonomy and UniProt IDs for clinical or diagnostic applications.
- Dataset does not contain personally identifiable data or clinical metadata.
Citation
- If you use this dataset, please cite:
- Gokul Alex (2025). EpicNet – International Epitope Database Peptide Network. Hugging Face Datasets.
- Available at: https://huggingface.co/datasets/gokulalex/EpicNet
License
- Creative Commons Attribution 4.0 International (CC BY‑4.0)
Dataset Creation and Maintenance
- Author: Gokul Alex
- Release Date: October 2025
- Version: v1.0
- Contact: huggingface.co/gokulalex
Example Entry
json { "IEDB IRI": "http://www.iedb.org/epitope/1", "Object Type": "Linear peptide", "Name": "AA + MCM(A1,A2)", "Modified Residue(s)": "A1,A2", "Modifications": "Main chain modification", "Starting Position": 200, "Ending Position": 201, "Source Molecule": "Streptokinase", "Source Molecule IRI": "https://uniprot.org/uniprot/P10520", "Source Organism": "Streptococcus pyogenes", "Species": "Streptococcus pyogenes serotype M3 D58" }
Acknowledgments
- Data derived from the IEDB Consortium, NCBI, and UniProt KB.
- Compilation, integration, and ontology alignment under the EpicNet Data Initiative.
- Downloads last month
- 6