dataset
stringclasses 1
value | question
stringlengths 29
13k
| exe_method
stringclasses 1
value | solutions
null | task_id
int64 0
5.07k
| test_time_limit
int64 1
1
| example_input
listlengths 0
5
| example_output
listlengths 0
5
| test_input
listlengths 1
10
| test_output
listlengths 1
10
|
|---|---|---|---|---|---|---|---|---|---|
CodeContests
|
Your mission in this problem is to write a computer program that manipulates molecular for- mulae in virtual chemistry. As in real chemistry, each molecular formula represents a molecule consisting of one or more atoms. However, it may not have chemical reality.
The following are the definitions of atomic symbols and molecular formulae you should consider.
* An atom in a molecule is represented by an atomic symbol, which is either a single capital letter or a capital letter followed by a small letter. For instance H and He are atomic symbols.
* A molecular formula is a non-empty sequence of atomic symbols. For instance, HHHeHHHe is a molecular formula, and represents a molecule consisting of four H’s and two He’s.
* For convenience, a repetition of the same sub-formula <image> where n is an integer between 2 and 99 inclusive, can be abbreviated to (X)n. Parentheses can be omitted if X is an atomic symbol. For instance, HHHeHHHe is also written as H2HeH2He, (HHHe)2, (H2He)2, or even ((H)2He)2.
The set of all molecular formulae can be viewed as a formal language. Summarizing the above description, the syntax of molecular formulae is defined as follows.
<image>
Each atom in our virtual chemistry has its own atomic weight. Given the weights of atoms, your program should calculate the weight of a molecule represented by a molecular formula. The molecular weight is defined by the sum of the weights of the constituent atoms. For instance, assuming that the atomic weights of the atoms whose symbols are H and He are 1 and 4, respectively, the total weight of a molecule represented by (H2He)2 is 12.
Input
The input consists of two parts. The first part, the Atomic Table, is composed of a number of lines, each line including an atomic symbol, one or more spaces, and its atomic weight which is a positive integer no more than 1000. No two lines include the same atomic symbol.
The first part ends with a line containing only the string END OF FIRST PART.
The second part of the input is a sequence of lines. Each line is a molecular formula, not exceeding 80 characters, and contains no spaces. A molecule contains at most 105 atoms. Some atomic symbols in a molecular formula may not appear in the Atomic Table.
The sequence is followed by a line containing a single zero, indicating the end of the input.
Output
The output is a sequence of lines, one for each line of the second part of the input. Each line contains either an integer, the molecular weight for a given molecular formula in the correspond- ing input line if all its atomic symbols appear in the Atomic Table, or UNKNOWN otherwise. No extra characters are allowed.
Example
Input
H 1
He 4
C 12
O 16
F 19
Ne 20
Cu 64
Cc 333
END_OF_FIRST_PART
H2C
(MgF)2As
Cu(OH)2
H((CO)2F)99
0
Output
14
UNKNOWN
98
7426
|
stdin
| null | 2,654 | 1 |
[
"H 1\nHe 4\nC 12\nO 16\nF 19\nNe 20\nCu 64\nCc 333\nEND_OF_FIRST_PART\nH2C\n(MgF)2As\nCu(OH)2\nH((CO)2F)99\n0\n"
] |
[
"14\nUNKNOWN\n98\n7426\n"
] |
[
"H 1\nHe 4\nC 12\nO 16\nF 19\nNe 24\nCu 64\nCc 333\nEND_OF_FIRST_PART\nH2C\n(MgF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 1\nHe 4\nC 12\nO 16\nF 22\nNe 24\nCu 64\nCc 333\nEND_OF_FIRST_PART\nH2C\n(MgF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 1\nHe 4\nC 12\nO 16\nF 19\nNe 20\nCu 64\nCc 333\nEND_OF_FIRST_PART\nH2C\n(MgF)2As\nCu(OH)2\nH((CO)2F)89\n0\n",
"H 1\nHe 4\nC 12\nO 16\nF 19\nNe 24\nCu 64\nCc 333\nEND_OF_FIRST_PART\nHC2\n(MgF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 1\nHe 4\nC 12\nO 16\nF 22\nNe 24\nuC 64\nCc 241\nEND_OF_FIRST_PART\nH2C\n(MhF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 0\nHe 4\nC 12\nO 16\nF 19\nNe 24\nCu 64\nCc 333\nEND_OF_FIRST_PART\nHC2\n(MgF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 1\nHd 4\nC 7\nO 16\nF 22\nNe 24\nuD 64\nCc 241\nEND_OF_FIRST_PART\nH2C\n(MhF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 1\nHd 4\nC 7\nO 6\nF 22\nNe 24\nuD 64\nCc 241\nEND_OF_FIRST_PART\nH2C\n(MhF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 0\nHd 4\nC 7\nO 6\nF 22\nNe 24\nuD 64\nCc 241\nEND_OF_FIRST_PART\nH2C\n(MhF)2As\nCu(OH)2\nH((CO)2F)99\n0\n",
"H 1\nHe 4\nC 2\nO 16\nF 19\nNe 24\nCu 64\nCc 333\nEND_OF_FIRST_PART\nH2C\n(MgF)2As\nCu(OH)2\nH((CO)2F)99\n0\n"
] |
[
"14\nUNKNOWN\n98\n7426\n",
"14\nUNKNOWN\n98\n7723\n",
"14\nUNKNOWN\n98\n6676\n",
"25\nUNKNOWN\n98\n7426\n",
"14\nUNKNOWN\nUNKNOWN\n7723\n",
"24\nUNKNOWN\n96\n7425\n",
"9\nUNKNOWN\nUNKNOWN\n6733\n",
"9\nUNKNOWN\nUNKNOWN\n4753\n",
"7\nUNKNOWN\nUNKNOWN\n4752\n",
"4\nUNKNOWN\n98\n5446\n"
] |
CodeContests
|
Problem
Multiple rooted trees are given as the initial state. Alice and Bob, on the other hand, play the game. The game is played alternately by two players, with Alice on the play and Bob on the play. The player whose turn has turned takes the following actions.
1. Select one root (vertex that has no parent). Let this vertex be S.
2. Select the vertices contained in the rooted tree rooted at S (S can also be selected here). Let this vertex be T.
3. Delete all vertices on the path from S to T, including S and T. It also deletes all edges where the deleted vertices are endpoints.
If all vertices have been deleted when the turn comes, that player loses.
When Alice and Bob always take the best action, determine which player will win against a given initial state.
The figure below shows an example of a player's actions.
Example of player behavior
Constraints
The input satisfies the following constraints.
* 1 ≤ N ≤ 1000
* 0 ≤ M <N
* i <pi ≤ N (1 ≤ i ≤ M)
Input
The input is given in the following format.
N M
p1
p2
::
pM
In the first line, the number of vertices N and the number of sides M in the initial state are given separated by blanks. At this time, the numbers representing each vertex are 1 to N. The next M line gives edge information. Of these, in line i, one integer pi is given. This means that there is an edge from vertex pi to vertex i. In other words, it means that the parent of vertex i is vertex pi.
Output
Print the name of the winning player (Alice or Bob) on one line.
Examples
Input
6 3
4
4
5
Output
Alice
Input
6 4
2
5
4
5
Output
Bob
|
stdin
| null | 2,218 | 1 |
[
"6 3\n4\n4\n5\n",
"6 4\n2\n5\n4\n5\n"
] |
[
"Alice\n",
"Bob\n"
] |
[
"6 3\n4\n7\n5\n",
"6 4\n2\n8\n4\n8\n",
"6 4\n2\n8\n4\n5\n",
"6 4\n2\n8\n8\n8\n",
"6 3\n4\n5\n5\n",
"8 4\n2\n5\n4\n5\n",
"6 4\n2\n8\n1\n8\n",
"2 4\n2\n8\n8\n8\n",
"10 3\n4\n5\n5\n",
"9 4\n2\n5\n4\n5\n"
] |
[
"Alice\n",
"Bob\n",
"Alice\n",
"Bob\n",
"Alice\n",
"Bob\n",
"Bob\n",
"Bob\n",
"Alice\n",
"Alice\n"
] |
CodeContests
|
In a flower bed, there are N flowers, numbered 1,2,......,N. Initially, the heights of all flowers are 0. You are given a sequence h=\\{h_1,h_2,h_3,......\\} as input. You would like to change the height of Flower k to h_k for all k (1 \leq k \leq N), by repeating the following "watering" operation:
* Specify integers l and r. Increase the height of Flower x by 1 for all x such that l \leq x \leq r.
Find the minimum number of watering operations required to satisfy the condition.
Constraints
* 1 \leq N \leq 100
* 0 \leq h_i \leq 100
* All values in input are integers.
Input
Input is given from Standard Input in the following format:
N
h_1 h_2 h_3 ...... h_N
Output
Print the minimum number of watering operations required to satisfy the condition.
Examples
Input
4
1 2 2 1
Output
2
Input
5
3 1 2 3 1
Output
5
Input
8
4 23 75 0 23 96 50 100
Output
221
|
stdin
| null | 3,675 | 1 |
[
"4\n1 2 2 1\n",
"8\n4 23 75 0 23 96 50 100\n",
"5\n3 1 2 3 1\n"
] |
[
"2\n",
"221\n",
"5\n"
] |
[
"4\n1 4 2 1\n",
"8\n4 23 75 1 23 96 50 100\n",
"5\n1 1 2 3 1\n",
"4\n1 8 2 1\n",
"8\n4 23 75 0 23 97 50 100\n",
"4\n1 12 2 1\n",
"8\n4 23 136 0 23 97 50 100\n",
"4\n1 12 0 2\n",
"8\n4 39 136 0 23 97 50 101\n",
"8\n4 39 136 0 23 108 50 101\n"
] |
[
"4\n",
"220\n",
"3\n",
"8\n",
"222\n",
"12\n",
"283\n",
"14\n",
"284\n",
"295\n"
] |
CodeContests
|
In 2012, human beings have been exposed to fierce onslaught of unidentified mysterious extra-terrestrial creatures. We have exhaused because of the long war and can't regist against them any longer. Only you, an excellent wizard, can save us. Yes, it's time to stand up!
The enemies are dispatched to the earth with being aligned like an n * n square. Appearently some of them have already lost their fighting capabilities for some unexpected reason. You have invented a highest grade magic spell 'MYON' to defeat them all. An attack of this magic covers any rectangles (which is parallel to axis). Once you cast a spell "myon," then all the enemies which the magic covers will lose their fighting capabilities because of tremendous power of the magic. However, the magic seems to activate enemies' self-repairing circuit. Therefore if any enemy which have already lost its fighting capability is exposed to the magic, the enemy repossesses its fighting capability. You will win the war when all the enemies will lose their fighting capabilities.
Let me show an example. An array of enemies below have dispatched:
1 1 1 1 1
1 0 0 0 1
1 0 1 0 1
1 0 0 0 1
1 1 1 1 1
Here, '0' means an enemy that doesn't possess fighting capability, and '1' means an enemy that possesses. First, you cast a spell "myon" with covering all the enemies, which results in;
0 0 0 0 0
0 1 1 1 0
0 1 0 1 0
0 1 1 1 0
0 0 0 0 0
Next, cast once again with covering central 3 * 3 enemies.
0 0 0 0 0
0 0 0 0 0
0 0 1 0 0
0 0 0 0 0
0 0 0 0 0
Now you can defeat them all by casting a spell covers remaining one. Therefore you can cast "myonmyonmyon," which is the shortest spell for this case.
You are given the information of the array. Please write a program that generates the shortest spell that can defeat them all.
Constraints
* 1 ≤ n ≤ 5
Input
The first line of each test case has an integer n. Following n lines are information of an array of enemies. The format is same as described in the problem statement.
Input terminates when n = 0. You may assume that one or more enemy have fighting capability.
Output
For each dataset, output the shortest spell.
Example
Input
5
1 1 1 1 1
1 0 0 0 1
1 0 1 0 1
1 0 0 0 1
1 1 1 1 1
3
1 1 1
1 1 1
1 1 1
5
1 1 1 1 0
1 1 1 1 0
1 0 0 0 1
0 1 1 1 1
0 1 1 1 1
0
Output
myonmyonmyon
myon
myonmyon
|
stdin
| null | 4,592 | 1 |
[
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 1 1 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n"
] |
[
"myonmyonmyon\nmyon\nmyonmyon\n"
] |
[
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 1 0 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 0 1 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n1 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n1\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 1 0 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 2 1 0 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 0 1 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 2 1 0 1\n1 0 0 0 1\n1 0 1 0 1\n0 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 0 1 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 0 1\n5\n1 1 1 1 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n4\n1 1 1 1 0\n1 1 1 1 0\n0 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 0\n1 1 1 1 1\n1\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 1 0 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n1 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 0 1\n1 1 1\n5\n1 1 1 0 0\n1 1 1 1 0\n1 0 0 0 0\n0 1 1 1 1\n0 1 1 1 1\n0\n",
"5\n1 1 1 1 1\n1 0 0 0 1\n0 0 1 0 1\n1 0 0 0 1\n1 1 1 1 1\n3\n1 1 1\n1 1 1\n1 1 1\n5\n1 1 1 1 0\n1 1 1 1 0\n1 0 0 0 1\n0 1 1 1 1\n0 1 1 1 1\n0\n"
] |
[
"myonmyonmyon\nmyon\nmyonmyonmyon\n",
"myonmyonmyon\nmyon\nmyonmyonmyonmyon\n",
"myonmyonmyon\nmyon\nmyon\nmyon\nmyon\nmyon\nmyonmyonmyon\n",
"myonmyonmyonmyon\nmyon\nmyonmyonmyon\n",
"myonmyonmyonmyonmyon\nmyon\nmyonmyonmyon\n",
"myonmyonmyon\nmyonmyon\nmyonmyon\n",
"myonmyonmyon\nmyon\nmyonmyonmyon\nmyon\nmyon\n",
"myonmyonmyonmyon\nmyon\nmyon\nmyon\nmyon\nmyon\nmyonmyonmyon\n",
"myonmyonmyon\nmyonmyon\nmyonmyonmyonmyon\n",
"myonmyonmyonmyon\nmyon\nmyonmyon\n"
] |
CodeContests
|
If you draw a few infinitely long straight lines on an infinitely wide plane, this plane will be divided into several areas. For example, if you draw a straight line, the plane will be divided into two areas. Even if you draw the same number of straight lines, the number of areas obtained will differ depending on how you draw. For example, if you draw two straight lines in parallel, you get three areas, and if you draw two straight lines perpendicular to each other, you get four areas.
<image>
Create a program that outputs the maximum number of regions that can be obtained by drawing n straight lines.
Input
Given multiple datasets. Each dataset is given n (1 ≤ n ≤ 10,000) on one row. Please process until the end of the input.
The number of datasets does not exceed 50.
Output
For each dataset, output the maximum number of divisions on one line.
Example
Input
1
3
Output
2
7
|
stdin
| null | 2,329 | 1 |
[
"1\n3\n"
] |
[
"2\n7\n"
] |
[
"1\n5\n",
"1\n0\n",
"1\n1\n",
"1\n2\n",
"1\n4\n",
"1\n8\n",
"1\n13\n",
"1\n6\n",
"1\n25\n",
"1\n9\n"
] |
[
"2\n16\n",
"2\n1\n",
"2\n2\n",
"2\n4\n",
"2\n11\n",
"2\n37\n",
"2\n92\n",
"2\n22\n",
"2\n326\n",
"2\n46\n"
] |
CodeContests
|
Problem statement
Given the string $ S $. Find the number of all anagrams in $ S $ that are palindromic.
An anagram of the string $ X $ is an anagram of $ Y $, which means that $ X $ is equal to $ Y $, or that the rearranged characters of $ X $ are equal to $ Y $. For example, for the string abcd, abcd and cbda are anagrams, but abed, cab and abcdd are not anagrams.
When the string $ X $ is a palindrome, it means that the reverse reading of $ X $ is equal to $ X $ itself. For example, abc and ab are not palindromes, and a and abccba are palindromes.
Constraint
* $ 1 \ leq | S | \ leq 40 $ ($ | S | $ is the length of the string $ S $)
* $ S $ contains only lowercase letters.
* The answer is guaranteed to be less than $ 2 ^ {63} $.
input
Input follows the following format.
$ S $
output
Output the number on one line.
Examples
Input
ab
Output
0
Input
abba
Output
2
|
stdin
| null | 4,518 | 1 |
[
"ab\n",
"abba\n"
] |
[
"0\n",
"2\n"
] |
[
"ac\n",
"cbcb\n",
"cc\n",
"abca\n",
"bc\n",
"aaca\n",
"cb\n",
"aacb\n",
"ca\n",
"bacb\n"
] |
[
"0\n",
"2\n",
"1\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n"
] |
CodeContests
|
Julius Cipher is a type of cipher which relates all the lowercase alphabets to their numerical position in the alphabet, i.e., value of a is 1, value of b is 2, value of z is 26 and similarly for the rest of them.
Little Chandan is obsessed with this Cipher and he keeps converting every single string he gets, to the final value one gets after the multiplication of the Julius Cipher values of a string. Arjit is fed up of Chandan's silly activities, so he decides to at least restrict Chandan's bad habits.
So, he asks Chandan not to touch any string which is a palindrome, otherwise he is allowed to find the product of the Julius Cipher values of the string.
Input:
The first line contains t number of test cases. The first line of every test case contains a string, S.
Output:
Print the value if the string is not a palindrome, otherwise print Palindrome - where value is equal to the product of all the characters of Julius Cipher values.
Constraints:
1 ≤ T ≤ 10^2
1 ≤ length of the string ≤ 10
Note:
The string will contain only lowercase letters.
SAMPLE INPUT
2
zazaz
goodarjit
SAMPLE OUTPUT
Palindrome
204120000
|
stdin
| null | 4,574 | 1 |
[
"2\nzazaz\ngoodarjit\n\nSAMPLE\n"
] |
[
"Palindrome\n204120000\n"
] |
[
"60\nvlmezxuyim\nusholhjomc\nfcrnbpodhf\ndltrthaaic\ncosnljmjtk\nzbowagxejo\nrjfguazsry\nbjzquzutvj\norhzmghfol\nbwvktwfepv\ncoamsgojyl\naqihirbyor\nxbetzvxvsr\nyffovdqcem\njuvvyioxzr\njchybdlgrw\nnxuspkypqf\nwovtphcriy\nogxpfdhykg\nsjdeufkvkq\ncmrtnhvzpm\nwnrqjfoojr\nznlihidhjz\nfzzpzkutat\njrditbhvgj\nejdvzwtfjo\njbpphavgoh\nrwawbmkvlr\nwlasvigvqy\nyyixdhjntz\nqftfeklqiv\nsllwbnkohy\nvjinoqcfym\nxdfbdtkxyo\nncchczannm\nnzuyvggdsk\nrqhawuoyxr\nnlpflyrsaw\nuceqoxyxrj\nqchgrsrqbz\nwxkshlvafy\nkovvlpsfxt\nvacwooxoba\neyabnbpcwj\nwmzhpsoyxw\nloxikvwswi\nzthyfietac\nzhhknwbeij\nwsfwpfeqvn\ngfvzffvuwe\nhxeyrugauj\nlevqyzzhen\ntfqwkhpcrl\nocfkqwottu\ntqbggmopls\nhikebhlbxr\ngbkrglmupj\nkajrgayfen\nyqjdsewrww\nsexsdglfwo\n",
"2\nzazaz\ngooradjit\n\nSAMPLE\n",
"60\nvlmezxuyim\nusholhjomc\nfcrnbpodhf\ndltrthaaic\ncosnljmjtk\nzbowagxejo\nrjfguazsry\nbjzquzutvj\norhzmghfol\nbwvktwfepv\ncoamsgojyl\naqihirbyor\nxbetzvxvsr\nyffovdqcem\njuvvyioxzr\njchybdlgrw\nnxuspkypqf\nwovtphcriy\nogxpfdhykg\nsjdeufkvkq\ncmrtnhvzpm\nwnrqjfoojr\nznlihidhjz\nfzzpzkutat\njrditbhvgj\nejdvzwtfjo\njbpphavgoh\nrwawbmkvlr\nwlasvigvqy\nyyixdhjntz\nqftfeklqiv\nsllwbnkohy\nvjinoqcfym\nxdfbdtkxyo\nncchczannm\nnzuyvggdsk\nrqhawuoyxr\nnlpflyrsaw\nuceqoxyxrj\nqchgrsrqbz\nwxkshlvafy\nkovvlpsfxs\nvacwooxoba\neyabnbpcwj\nwmzhpsoyxw\nloxikvwswi\nzthyfietac\nzhhknwbeij\nwsfwpfeqvn\ngfvzffvuwe\nhxeyrugauj\nlevqyzzhen\ntfqwkhpcrl\nocfkqwottu\ntqbggmopls\nhikebhlbxr\ngbkrglmupj\nkajrgayfen\nyqjdsewrww\nsexsdglfwo\n",
"2\nzazay\ngooradjit\n\nSAMPLD\n",
"60\nvlmezxuyim\nusholhjomc\nfcrnbpodhf\ndltrthaaic\ncosnljmjtk\nzbowagxejo\nrjfguazsry\nbjzquzutvj\norhzmghfol\nbwvktwfepv\ncoamsgojyl\naqihirbyor\nxbetzvxvsr\nyffovdqcem\njuvvyioxzr\njchybdlgrw\nnxuspkypqf\nwovtphcriy\nogxpfdhykg\nsjdeufkvkq\ncmrtnhvzpm\nrjoofjqrnw\nznlihidhjz\nfzzpzkutat\njrditbhvgj\nejdvzwtfjo\njbpphavgoh\nrwawbmkvlr\nwlasvigvqy\nyyixdhjntz\nqftfeklqiv\nsllwbnkohy\nvjinoqcfym\nxdfbdtkxyo\nncchczannm\nnzuyvggdsk\nrqhawuoyxr\nnlpflyrsaw\nuceqoxyxrj\nqchgrssqbz\nwxkshlvafy\nkovvlpsfxs\nvacwooxoba\neyabnbpcwj\nwmzhpsoyxw\nloxikvwswi\nzthyfietac\nzhhknwbeij\nwsfwpfeqvn\ngfvzffvuwe\nhxeyrugauj\nlevqyzzhen\ntfqwkhpcrl\nocfkqwottu\ntqbggmopls\nhikebhlbxr\ngbkrglmupj\nkajrgayfen\nyqjdsewrww\nsexsdglfwo\n",
"60\nvlmezxuyim\nusholhjomc\nfcrnbpodhf\ndltrthaaic\ncosnljmjtk\nzbowagxejo\nrjfguazsry\nbjzquzutvj\norhzmghfol\nbwvktwfepv\ncoamsgojyl\naqihirbyor\nxbetzvxvsr\nyffovdqcem\njuvvyioxzr\njchybdlgrw\nnxuspkypqf\nwovtphcriy\nogxpfdhykg\nsjdeufkvkq\ncmrtnhvzpm\nrjoofjqrnw\nznlihidhjz\nfzzpzkutat\njrditbhvgj\nejdvzwtfjo\njbpphavgoh\nrwawbmkvlr\nwlasvigvqy\nyyixdhjntz\nqftfeklqiv\nsllwbnkohy\nvjinoqcfym\nxdfbdtkxyo\nncchczannm\nnzuyvggdsk\nrqhawuoyxr\nnlpflyrsaw\nuceqoxyxrj\nqchgrssqbz\nwxkshlvafy\nkovvlpsfxs\nvacwooxoba\neyabnbpcwj\nwmzhpsoyxw\nloxikvwswi\nzthyfietac\nzghknwbeij\nwsfwpfeqvn\ngfvzffvuwe\nhxeyrugauj\nlevqyzzhen\ntfqwkhpcrl\nocfkqwottu\ntqbggmopls\nhikebhlbxr\ngbkrglmupj\nkajrgayfen\nyqjdsewrww\nsexsdglfwo\n",
"2\nxazaz\ngooradjit\n\nSAMPLD\n",
"60\nvlmezxuyim\nusholhjomc\nfcrnbpodhf\ndltrthaaic\ncosnljmjtk\nzbowagxejo\nrjfguazsry\nbjzquzutvj\norhzmghfol\nbwvktwfepv\ncoamsgojyl\naqihirbyor\nxbetzvxvsr\nyffovdqcem\njuvvyioxzr\njchybdlgrw\nnxuspkypqf\nwovtphcriy\nogxpfdhykg\nsjdeufkvkq\ncmrtnhvzpm\nrjoofjqrnw\nznlihidhjz\nfzzpzkutat\njrditbhvgj\nejdvzwtfjo\njbpphavgoh\nrwawbmkvlr\nwlasvigvqy\nyyixdhjntz\nqftfeklqiv\nsllwbnkohy\nvjinoqcfym\nxdfbdtkxyo\nncchczannm\nnzuyvggdsk\nrqhawuoyxr\nnlpflyrsaw\nuceqoxyxrj\nqchgrssqbz\nwxkshluafy\nkovvlpsfxs\nvacwooxoba\neyabnbpcwj\nwmzhpsoyxw\nloxikvwswi\nzthyfietac\nzghknwbeij\nwsfwpfeqvn\ngfvzffvuwe\nhxeyrugauj\nlevqyzzhen\ntfqwkhpcrl\nocfkqwottu\ntqbggmopls\nhikebhlbxr\ngbkrglmupj\nkajrgayfen\nyqjdsewrww\nsexsdglfwo\n",
"60\nvlmezxuyim\nusholhjomc\nfcrnbpodhf\ndltrthaaic\ncosnljmjtk\nzbowagxejo\nrjfguazsry\nbjzquzutvj\norhzmghfol\nbwvktwfepv\ncoamsgojyl\naqihirbyor\nxbetzvxvsr\nyffovdqcem\njuvvyioxzr\njchybdlgrw\nnxuspkypqf\nwovtphcriy\nogxpfdhykg\nsjdeufkvkq\ncmrtnhvzpm\nrjoofjqrnw\nznlihidhjz\nfzzpzkutat\njrditbhvgj\nejdvzwtfjo\njbpphavgoh\nrwawbmkvlr\nwlasvigvqy\nyyixdhjntz\nqftfeklqiv\nsllwbnkohy\nvjinoqcfym\nxdfbdtkxyo\nncchczannm\nnzuyvggdsk\nrqhawuoyxr\nnlpflyrsaw\nuceqoxyxrj\nqchgrssqbz\nwxkshluafy\nkovvlpsfxs\nvacwooxoba\neyabnbpcwj\nwmzhpsozxw\nloxikvwswi\nzthyfietac\nzghknwbeij\nwsfwpfeqvn\ngfvzffvuwe\nhxeyrugauj\nlevqyzzhen\ntfqwkhpcrl\nocfkqwottu\ntqbggmopls\nhikebhlbxr\ngbkrglmupj\nkajrgayfen\nyqjdsewrww\nsexsdglfwo\n",
"2\nxazaz\ntjjdaroog\n\nSAMPLD\n"
] |
[
"657729072000\n26889408000\n418037760\n74649600\n41081040000\n2260440000\n35292348000\n445981536000\n44155238400\n54074803200\n3501225000\n2676888000\n495789465600\n3938220000\n3852969120000\n1669248000\n962686771200\n236079360000\n14902272000\n21667615200\n187087380480\n239432760000\n23549460480\n155906150400\n3193344000\n47361600000\n756940800\n12941083584\n67957520400\n314496000000\n27191894400\n58145472000\n41351310000\n9123840000\n200333952\n172220848800\n191546208000\n38058854400\n208202400000\n15542077824\n36548582400\n839028326400\n245916000\n77280000\n3913618176000\n851125112640\n1684800000\n5304499200\n151565863680\n45950224320\n13335840000\n212372160000\n42809057280\n146320020000\n23702515200\n656916480\n10170800640\n145530000\n353694690000\n30129926400\n",
"Palindrome\n204120000\n",
"657729072000\n26889408000\n418037760\n74649600\n41081040000\n2260440000\n35292348000\n445981536000\n44155238400\n54074803200\n3501225000\n2676888000\n495789465600\n3938220000\n3852969120000\n1669248000\n962686771200\n236079360000\n14902272000\n21667615200\n187087380480\n239432760000\n23549460480\n155906150400\n3193344000\n47361600000\n756940800\n12941083584\n67957520400\n314496000000\n27191894400\n58145472000\n41351310000\n9123840000\n200333952\n172220848800\n191546208000\n38058854400\n208202400000\n15542077824\n36548582400\n797076910080\n245916000\n77280000\n3913618176000\n851125112640\n1684800000\n5304499200\n151565863680\n45950224320\n13335840000\n212372160000\n42809057280\n146320020000\n23702515200\n656916480\n10170800640\n145530000\n353694690000\n30129926400\n",
"16900\n204120000\n",
"657729072000\n26889408000\n418037760\n74649600\n41081040000\n2260440000\n35292348000\n445981536000\n44155238400\n54074803200\n3501225000\n2676888000\n495789465600\n3938220000\n3852969120000\n1669248000\n962686771200\n236079360000\n14902272000\n21667615200\n187087380480\n239432760000\n23549460480\n155906150400\n3193344000\n47361600000\n756940800\n12941083584\n67957520400\n314496000000\n27191894400\n58145472000\n41351310000\n9123840000\n200333952\n172220848800\n191546208000\n38058854400\n208202400000\n16405526592\n36548582400\n797076910080\n245916000\n77280000\n3913618176000\n851125112640\n1684800000\n5304499200\n151565863680\n45950224320\n13335840000\n212372160000\n42809057280\n146320020000\n23702515200\n656916480\n10170800640\n145530000\n353694690000\n30129926400\n",
"657729072000\n26889408000\n418037760\n74649600\n41081040000\n2260440000\n35292348000\n445981536000\n44155238400\n54074803200\n3501225000\n2676888000\n495789465600\n3938220000\n3852969120000\n1669248000\n962686771200\n236079360000\n14902272000\n21667615200\n187087380480\n239432760000\n23549460480\n155906150400\n3193344000\n47361600000\n756940800\n12941083584\n67957520400\n314496000000\n27191894400\n58145472000\n41351310000\n9123840000\n200333952\n172220848800\n191546208000\n38058854400\n208202400000\n16405526592\n36548582400\n797076910080\n245916000\n77280000\n3913618176000\n851125112640\n1684800000\n4641436800\n151565863680\n45950224320\n13335840000\n212372160000\n42809057280\n146320020000\n23702515200\n656916480\n10170800640\n145530000\n353694690000\n30129926400\n",
"16224\n204120000\n",
"657729072000\n26889408000\n418037760\n74649600\n41081040000\n2260440000\n35292348000\n445981536000\n44155238400\n54074803200\n3501225000\n2676888000\n495789465600\n3938220000\n3852969120000\n1669248000\n962686771200\n236079360000\n14902272000\n21667615200\n187087380480\n239432760000\n23549460480\n155906150400\n3193344000\n47361600000\n756940800\n12941083584\n67957520400\n314496000000\n27191894400\n58145472000\n41351310000\n9123840000\n200333952\n172220848800\n191546208000\n38058854400\n208202400000\n16405526592\n34887283200\n797076910080\n245916000\n77280000\n3913618176000\n851125112640\n1684800000\n4641436800\n151565863680\n45950224320\n13335840000\n212372160000\n42809057280\n146320020000\n23702515200\n656916480\n10170800640\n145530000\n353694690000\n30129926400\n",
"657729072000\n26889408000\n418037760\n74649600\n41081040000\n2260440000\n35292348000\n445981536000\n44155238400\n54074803200\n3501225000\n2676888000\n495789465600\n3938220000\n3852969120000\n1669248000\n962686771200\n236079360000\n14902272000\n21667615200\n187087380480\n239432760000\n23549460480\n155906150400\n3193344000\n47361600000\n756940800\n12941083584\n67957520400\n314496000000\n27191894400\n58145472000\n41351310000\n9123840000\n200333952\n172220848800\n191546208000\n38058854400\n208202400000\n16405526592\n34887283200\n797076910080\n245916000\n77280000\n4070162903040\n851125112640\n1684800000\n4641436800\n151565863680\n45950224320\n13335840000\n212372160000\n42809057280\n146320020000\n23702515200\n656916480\n10170800640\n145530000\n353694690000\n30129926400\n",
"16224\n226800000\n"
] |
CodeContests
|
There are 'n' ants on a 'n+1' length rod. The ants are numbered from 1 to n and are initially placed at positions starting from position 1 till position n. They are moving either in left direction (denoted by '-1') or in the right direction (denoted by '1'). Whenever an ant crosses the boundary of the rod it falls off the rod. You are given the initial direction of the ants. Now, whenever two ants collide their direction switches, i.e. the ant going in left direction ('-1) changes it's direction towards right ('1') and the ant going in the right direction ('1') changes it's direction towards left ('-1').
Find last ant to fall off the rod.
Note: In case two ants are falling simultaneously in the end print the index of the lower indexed ant.
Input Format:
First line contains number of test cases and second line contains the integer 'n' denoting the total number of ants s.t. 1 ≤ n ≤ 1,000
Second line contains 'n' space separated numbers (either '1' or '-1') denoting the initial directions of the ants.
Output Format:
Output a single integer which is the index (lower index in case two ants are falling simultaneously in the end) of the last ant to fall off the table.
SAMPLE INPUT
2
2
1 1
8
1 1 -1 1 1 1 -1 1
SAMPLE OUTPUT
1
3
|
stdin
| null | 4,692 | 1 |
[
"2\n2\n1 1\n8\n1 1 -1 1 1 1 -1 1\n\nSAMPLE\n"
] |
[
"1\n3\n"
] |
[
"2\n2\n1 1\n8\n1 1 -1 1 1 1 -1 2\n\nSAMPLE\n",
"1\n2\n-1 0\n",
"2\n2\n1 1\n8\n1 1 0 1 1 1 -1 1\n\nLAMPSE\n",
"2\n2\n1 2\n8\n0 1 0 1 1 1 0 0\n\nLAMPSE\n",
"2\n2\n2 1\n8\n1 2 -1 1 1 1 -1 -1\n\nSAMPLE\n",
"2\n2\n-1 -1\n8\n1 0 0 2 2 2 0 1\n\nLSPMAE\n",
"2\n2\n1 1\n8\n1 2 -1 1 1 1 -1 2\n\nSAMPLE\n",
"2\n2\n2 1\n8\n1 2 -1 1 1 1 -1 2\n\nSAMPLE\n",
"2\n2\n2 1\n8\n1 2 -1 1 1 1 -1 0\n\nSAMPLE\n",
"2\n2\n2 1\n8\n1 2 -1 1 1 2 -1 0\n\nSAMPLE\n"
] |
[
"1\n3\n",
"1\n",
"1\n2\n",
"1\n1\n",
"1\n4\n",
"2\n1\n",
"1\n3\n",
"1\n3\n",
"1\n3\n",
"1\n3\n"
] |
CodeContests
|
In a two-dimensional plane, we have a rectangle R whose vertices are (0,0), (W,0), (0,H), and (W,H), where W and H are positive integers. Here, find the number of triangles \Delta in the plane that satisfy all of the following conditions:
* Each vertex of \Delta is a grid point, that is, has integer x- and y-coordinates.
* \Delta and R shares no vertex.
* Each vertex of \Delta lies on the perimeter of R, and all the vertices belong to different sides of R.
* \Delta contains at most K grid points strictly within itself (excluding its perimeter and vertices).
Constraints
* 1 \leq W \leq 10^5
* 1 \leq H \leq 10^5
* 0 \leq K \leq 10^5
Input
Input is given from Standard Input in the following format:
W H K
Output
Print the answer.
Examples
Input
2 3 1
Output
12
Input
5 4 5
Output
132
Input
100 100 1000
Output
461316
|
stdin
| null | 3,113 | 1 |
[
"2 3 1\n",
"100 100 1000\n",
"5 4 5\n"
] |
[
"12\n",
"461316\n",
"132\n"
] |
[
"3 3 1\n",
"100 110 1000\n",
"5 4 8\n",
"3 3 0\n",
"100 101 1000\n",
"0 4 8\n",
"100 101 1001\n",
"101 101 1001\n",
"101 101 1101\n",
"011 110 0001\n"
] |
[
"24\n",
"453944\n",
"168\n",
"8\n",
"459806\n",
"0\n",
"460442\n",
"458904\n",
"538944\n",
"238\n"
] |
CodeContests
|
There are N people, conveniently numbered 1 through N. We want to divide them into some number of groups, under the following two conditions:
* Every group contains between A and B people, inclusive.
* Let F_i be the number of the groups containing exactly i people. Then, for all i, either F_i=0 or C≤F_i≤D holds.
Find the number of these ways to divide the people into groups. Here, two ways to divide them into groups is considered different if and only if there exists two people such that they belong to the same group in exactly one of the two ways. Since the number of these ways can be extremely large, print the count modulo 10^9+7.
Constraints
* 1≤N≤10^3
* 1≤A≤B≤N
* 1≤C≤D≤N
Input
The input is given from Standard Input in the following format:
N A B C D
Output
Print the number of ways to divide the people into groups under the conditions, modulo 10^9+7.
Examples
Input
3 1 3 1 2
Output
4
Input
7 2 3 1 3
Output
105
Input
1000 1 1000 1 1000
Output
465231251
Input
10 3 4 2 5
Output
0
|
stdin
| null | 2,406 | 1 |
[
"10 3 4 2 5\n",
"7 2 3 1 3\n",
"1000 1 1000 1 1000\n",
"3 1 3 1 2\n"
] |
[
"0\n",
"105\n",
"465231251\n",
"4\n"
] |
[
"7 3 4 2 5\n",
"8 2 3 1 3\n",
"1000 1 1000 2 1000\n",
"1000 1 1000 3 1000\n",
"10 3 7 2 5\n",
"7 1 3 1 3\n",
"1000 1 1000 1 1001\n",
"7 1 6 2 5\n",
"0 3 8 2 7\n",
"2 1 3 1 2\n"
] |
[
"0\n",
"280\n",
"860178665\n",
"980205027\n",
"126\n",
"595\n",
"465231251\n",
"105\n",
"1\n",
"2\n"
] |
CodeContests
|
Brio got his house constructed near the National Highway. The Construction and Planning Committee has planned to construct a road near his house. Brio is worried about the Committee's plan as he fears that his house might come on the way of the road being constructed.
In such a case, he needs to request the Committee members to replan the construction. Assume that Brio's house is a circle with center at (0,0) and radius r. Given 2 integral points (x1,y1) and (x2,y2) through which the road passes you need to give output as mentioned below:
if the road crosses his house, print "REPLANNING" (quotes for clarity).
if the road just touches his house, print "JUST MISSED"
if the road is far off his house, print "SAFE"
INPUT
The first line of the input contains the number of testcases T. Each of the next T test cases has 2 lines, the first containing 4 space separated integers x1 y1 x2 y2 and the second line contains r.
OUTPUT
One line per test case containing the required output.
CONSTRAINTS
T ≤ 10000
-10000 ≤ x1 y1 x2 y2 ≤ 10000
r ≤ 10000
SAMPLE INPUT
2
5 5 -5 5
4
1 2 3 4
5
SAMPLE OUTPUT
SAFE
REPLANNING
|
stdin
| null | 4,137 | 1 |
[
"2\n5 5 -5 5 \n4\n1 2 3 4\n5\n\nSAMPLE\n"
] |
[
"SAFE\nREPLANNING\n"
] |
[
"2\n5 3 -5 5 \n4\n1 2 3 4\n5\n\nSAMPLE\n",
"2\n5 4 -5 5 \n4\n1 2 0 4\n5\n\nSAMPLE\n",
"2\n5 8 -9 5 \n1\n1 2 0 4\n1\n\nSAMPLE\n",
"2\n13 8 -9 5 \n1\n0 1 0 6\n0\n\nSAMPLE\n",
"2\n31 1 -1 1 \n1\n0 1 1 6\n0\n\nRAMPME\n",
"2\n31 1 -1 0 \n1\n-1 1 1 2\n0\n\nEMPMAR\n",
"2\n10 1 -1 0 \n1\n2 1 0 0\n0\n\nEAMPMR\n",
"2\n6 0 0 0 \n0\n0 2 1 0\n1\n\nELPSAM\n",
"2\n4 7 -2 -1 \n1\n-1 13 -1 -1\n1\n\nDLOMCS\n",
"2\n5 3 -5 5 \n4\n1 2 0 4\n5\n\nSAMPLE\n"
] |
[
"REPLANNING\nREPLANNING\n",
"SAFE\nREPLANNING\n",
"SAFE\nSAFE\n",
"SAFE\nJUST MISSED\n",
"JUST MISSED\nSAFE\n",
"REPLANNING\nSAFE\n",
"REPLANNING\nJUST MISSED\n",
"JUST MISSED\nREPLANNING\n",
"JUST MISSED\nJUST MISSED\n",
"REPLANNING\nREPLANNING\n"
] |
CodeContests
|
Some positive integers can be represented by a sum of one or more consecutive prime numbers. How many such representations does a given positive integer have? For example, the integer 53 has two representations 5 + 7 + 11 + 13 + 17 and 53. The integer 41 has three representations 2 + 3 + 5 + 7 + 11 + 13, 11 + 13 + 17, and 41. The integer 3 has only one representation, which is 3. The integer 20 has no such representations. Note that summands must be consecutive prime numbers, so neither 7 + 13 nor 3 + 5 + 5 + 7 is a valid representation for the integer 20.
Your mission is to write a program that reports the number of representations for the given positive integer.
Input
The input is a sequence of positive integers each in a separate line. The integers are between 2 and 10 000, inclusive. The end of the input is indicated by a zero.
Output
The output should be composed of lines each corresponding to an input line except the last zero. An output line includes the number of representations for the input integer as the sum of one or more consecutive prime numbers. No other characters should be inserted in the output.
Example
Input
2
3
17
41
20
666
12
53
0
Output
1
1
2
3
0
0
1
2
|
stdin
| null | 2,774 | 1 |
[
"2\n3\n17\n41\n20\n666\n12\n53\n0\n"
] |
[
"1\n1\n2\n3\n0\n0\n1\n2\n"
] |
[
"2\n3\n17\n41\n20\n666\n24\n53\n0\n",
"2\n3\n17\n41\n20\n666\n24\n56\n0\n",
"2\n3\n17\n41\n20\n666\n24\n20\n0\n",
"2\n3\n17\n41\n20\n666\n46\n53\n0\n",
"2\n3\n17\n70\n20\n666\n24\n56\n0\n",
"2\n3\n17\n34\n20\n666\n24\n20\n0\n",
"2\n6\n17\n34\n20\n666\n24\n20\n0\n",
"2\n3\n2\n41\n20\n666\n46\n53\n0\n",
"2\n6\n17\n34\n20\n666\n24\n17\n0\n",
"2\n3\n2\n41\n20\n1171\n46\n53\n0\n"
] |
[
"1\n1\n2\n3\n0\n0\n1\n2\n",
"1\n1\n2\n3\n0\n0\n1\n1\n",
"1\n1\n2\n3\n0\n0\n1\n0\n",
"1\n1\n2\n3\n0\n0\n0\n2\n",
"1\n1\n2\n0\n0\n0\n1\n1\n",
"1\n1\n2\n0\n0\n0\n1\n0\n",
"1\n0\n2\n0\n0\n0\n1\n0\n",
"1\n1\n1\n3\n0\n0\n0\n2\n",
"1\n0\n2\n0\n0\n0\n1\n2\n",
"1\n1\n1\n3\n0\n2\n0\n2\n"
] |
CodeContests
|
Ken and Keiko are young, poor and busy. Short explanation: they are students, and ridden with part-time jobs. To make things worse, Ken lives in Hakodate and Keiko in Tokyo. They want to meet, but since they have neither time nor money, they have to go back to their respective jobs immediately after, and must be careful about transportation costs. Help them find the most economical meeting point.
Ken starts from Hakodate, Keiko from Tokyo. They know schedules and fares for all trains, and can choose to meet anywhere including their hometowns, but they cannot leave before 8am and must be back by 6pm in their respective towns. Train changes take no time (one can leave the same minute he/she arrives), but they want to meet for at least 30 minutes in the same city.
There can be up to 100 cities and 2000 direct connections, so you should devise an algorithm clever enough for the task.
Input
The input is a sequence of data sets.
The first line of a data set contains a single integer, the number of connections in the timetable. It is not greater than 2000.
Connections are given one on a line, in the following format.
Start_city HH:MM Arrival_city HH:MM price
Start_city and Arrival_city are composed of up to 16 alphabetical characters, with only the first one in upper case. Departure and arrival times are given in hours and minutes (two digits each, separated by ":") from 00:00 to 23:59. Arrival time is strictly after departure time. The price for one connection is an integer between 1 and 10000, inclusive. Fields are separated by spaces.
The end of the input is marked by a line containing a zero.
Output
The output should contain one integer for each data set, the lowest cost possible. This is the total fare of all connections they use.
If there is no solution to a data set, you should output a zero.
The solution to each data set should be given in a separate line.
Example
Input
5
Hakodate 08:15 Morioka 12:30 2500
Morioka 14:05 Hakodate 17:30 2500
Morioka 15:30 Hakodate 18:00 3000
Morioka 14:30 Tokyo 17:50 3000
Tokyo 08:30 Morioka 13:35 3000
4
Hakodate 08:15 Morioka 12:30 2500
Morioka 14:04 Hakodate 17:30 2500
Morioka 14:30 Tokyo 17:50 3000
Tokyo 08:30 Morioka 13:35 3000
18
Hakodate 09:55 Akita 10:53 3840
Hakodate 14:14 Akita 16:09 1920
Hakodate 18:36 Akita 19:33 3840
Hakodate 08:00 Morioka 08:53 3550
Hakodate 22:40 Morioka 23:34 3550
Akita 14:23 Tokyo 14:53 2010
Akita 20:36 Tokyo 21:06 2010
Akita 08:20 Hakodate 09:18 3840
Akita 13:56 Hakodate 14:54 3840
Akita 21:37 Hakodate 22:35 3840
Morioka 09:51 Tokyo 10:31 2660
Morioka 14:49 Tokyo 15:29 2660
Morioka 19:42 Tokyo 20:22 2660
Morioka 15:11 Hakodate 16:04 3550
Morioka 23:03 Hakodate 23:56 3550
Tokyo 09:44 Morioka 11:04 1330
Tokyo 21:54 Morioka 22:34 2660
Tokyo 11:34 Akita 12:04 2010
0
Output
11000
0
11090
|
stdin
| null | 2,734 | 1 |
[
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 18:00 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 19:33 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morioka 23:34 3550\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 15:29 2660\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n"
] |
[
"11000\n0\n11090\n"
] |
[
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 18:00 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 19:33 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morioka 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 15:29 2660\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 18:00 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 19:33 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morioka 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 51:29 2660\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 10:08 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 33:91 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morkoia 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 51:29 3384\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akjta 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 3089\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 18:00 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 @kita 16:09 1920\nHakodate 18:36 Akita 19:33 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morioka 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 15:29 2660\nMorioka 19:42 Tojyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:45 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 10:08 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 30:51 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 33:91 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morkoia 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 51:29 2660\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 18:00 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 53:31 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 19:33 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morioka 23:34 3550\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 15:29 2660\nMorioka 19:42 oykoT 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 10:08 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 1041\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Aktia 33:91 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morkoia 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 51:29 3384\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 10:08 3000\nMorioka 14:30 Tokyo 17:50 5253\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 30:51 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 33:91 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morkoia 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkiua 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 51:29 2660\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 akoiroM 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 10:08 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Norioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 33:91 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morkoia 23:34 4139\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 51:29 3384\nMorioka 19:42 Tokyo 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n",
"5\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:05 Hakodate 17:30 2500\nMorioka 15:30 Hakodate 18:00 3000\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 1918\n4\nHakodate 08:15 Morioka 12:30 2500\nMorioka 14:04 Hakodate 17:30 2500\nMorioka 14:30 Tokyo 17:50 3000\nTokyo 08:30 Morioka 13:35 3000\n18\nHakodate 09:55 Akita 10:53 3840\nHakodate 14:14 Akita 16:09 1920\nHakodate 18:36 Akita 19:33 3840\nHakodate 08:00 Morioka 08:53 3550\nHakodate 22:40 Morioka 23:34 3550\nAkita 14:23 Tokyo 14:53 2010\nAkita 20:36 Tokyo 21:06 2010\nAkita 08:20 Hakodate 09:18 3840\nAkita 13:56 Hakodate 14:54 3840\nAkita 21:37 Hakodate 22:35 3840\nMorioka 09:51 Tokyo 10:31 2660\nMorioka 14:49 Tokyo 15:29 2660\nMorioka 19:42 oykoT 20:22 2660\nMorioka 15:11 Hakodate 16:04 3550\nMorioka 23:03 Hakodate 23:56 3550\nTokyo 09:44 Morioka 11:04 1330\nTokyo 21:54 Morioka 22:34 2660\nTokyo 11:34 Akita 12:04 2010\n0\n"
] |
[
"11000\n0\n11090\n",
"11000\n0\n11700\n",
"11000\n0\n0\n",
"11589\n0\n11090\n",
"11000\n0\n12060\n",
"0\n0\n11090\n",
"11000\n0\n8901\n",
"13253\n0\n12060\n",
"0\n0\n11700\n",
"9918\n0\n11090\n"
] |
CodeContests
|
Tic-Tac-Toe are three cousins. They planned to play cricket this afternoon but got stuck in their homework. Mrs. Jaime assigned them a task to arrange all the letters in a scrambled word in the order of their appearance in english alphabets. All the letters are in upper-case. Help Tic-Tac-Toe to solve their homework so that they can play cricket.
Input: First line of the input contains T, followed by T lines, each containing a scrambled word in upper-case.
Output: T lines, each containing arranged words.
Constraints: 1 ≤ T ≤ 500 | S ≤ 10^3 , Where S: Length of each scrambled word.
SAMPLE INPUT
4
INDIA
PROGRAM
HACKEREARTH
COLOUR
SAMPLE OUTPUT
ADIIN
AGMOPRR
AACEEHHKRRT
CLOORU
Explanation
For the 1st test case, INDIA can be arranged as ADIIN.
For the 2nd test case, PROGRAM can be arranged as AGMOPRR.
|
stdin
| null | 1,202 | 1 |
[
"4\nINDIA\nPROGRAM\nHACKEREARTH\nCOLOUR\n\nSAMPLE\n"
] |
[
"ADIIN\nAGMOPRR\nAACEEHHKRRT\nCLOORU\n"
] |
[
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nIIDHCVDPTY\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAI\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQB\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUJH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCW\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQIXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGBIYTJXUG\nEKCCTKTUGW\nKXHECCADFZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nCEKSJCBQKQ\nOYJGSEYYVM\nJQRHSVKLKJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"4\nINDIA\nPROGRAM\nHACLEREARTH\nCOLOUR\n\nSAMPLE\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nIIDHCVDPTY\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAI\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQB\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCW\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQIXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGBIYTJXUG\nEKCCTKTUGW\nKXHECCAFDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nIIDHCVDPTY\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAJ\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQB\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCW\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQIXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGBIYTJXUG\nEKCCTKTUGW\nKXHECCAFDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nIIDHCVDPTY\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAJ\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQB\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCW\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQIXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGBIYTJXUG\nEKCCTKTUGW\nKXHECCAGDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"4\nAIDNI\nMARGORQ\nHTRAERELCAH\nCOLOUR\n\nNASPLE\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nIIDHCVDPTY\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAJ\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQA\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCW\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQIXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGBIYTJXUG\nEKCCTKTUGW\nKXHECCAGDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nYIDHCVDPTI\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAJ\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQA\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCV\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQIXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGTIYBJXUG\nEKCCTKTUGW\nKXHECCAGDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nYIDHCVDPTI\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAJ\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQA\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVCHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCV\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQHXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGTIYBJXUG\nEKCCTKTUGW\nKXHECCAGDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n",
"100\nSPLJVSBNMQ\nWWHUTVFYVS\nYIDHCVDPTI\nMYDGOIXYPH\nOJOHEUSGQJ\nBFNBMMDCPC\nNRSRPSAGOE\nNSIPJMNQTP\nTUBHAAOBCQ\nOZOHLOIXHK\nSVNLNUILUP\nXMNHGMOYWJ\nEADXWJNVRW\nYKTCRWMMQH\nHIMMNSZLJF\nVRHXCEGBAJ\nPIXEKYDSYS\nRQCUTIUBNK\nJHKWDIWNUI\nVNGLLTGECQ\nBGEVTTYSUU\nSQQYJDSRYN\nMSYNHSWKQZ\nXDBZMTCLAK\nZCNQZODTQA\nMECJUFGULE\nZMARUONAWE\nSYQYPZHDQZ\nGEBBIGCTQV\nKWOCXZNCHQ\nKRNFYURPUK\nUQVBHFPMEA\nMESPGIMBYN\nBCDQTIJAYE\nLNDLNNBIZU\nXNVIVEVZMF\nLZLSABVOIO\nHIOEBAPQOG\nJEBUUSWUKH\nYSVLWMZIEC\nYZYJBDJSFY\nHMCIDWEWMA\nJEZSHXQEJD\nZLLEQWISEY\nQKYXDHGAXZ\nXCPBGWLAAI\nFGLJOAVJBO\nRMEMPHSLCV\nGJXDHVPQRI\nSTGAHRMWQA\nUCSWNLCVSK\nZBSGCOGOTD\nUMOSXCBYFW\nVATUZJSSYS\nXQRSDJDCJF\nXHUETWHQMI\nYANRMWQIWX\nTPSALWIAZA\nYBOQLZJEGT\nLNIWWIFGHP\nKXAMFHTSVL\nUQNLUHPRJZ\nVPVQPHEJOH\nIMEGAXAFJZ\nYADZZDDURV\nOGWFMSHMTB\nDGHEMVNDIX\nCHZNXCVYJH\nXUBTVXDCPP\nZWPNYERRZB\nNKQWCDTJNW\nWXQHOENURS\nQHXHDOYTWD\nGCSVUVEGEM\nOYOUATUFEF\nLABABOBAYX\nSEJXFZGTBV\nAJWMUWTFXG\nHKJREWDTKN\nRQZCPMWREM\nDFWLOGQPRX\nTTVLJUCYKO\nOGGOTCKHQD\nWRLIYRBMDD\nECNSVUTLJF\nQGTIYBJXUG\nEKCCTKTUGW\nKXHECCAGDZ\nOMHOOUDGID\nWPPYHOOOPE\nSDDTBTHXRX\nKYSUQPRWTI\nWFZFIBGKCZ\nBWFXWYSEVM\nRXBJQCSKYU\nSEKCJCBQKQ\nOYJGSEYYVM\nJKLKVSHRQJ\nFWJVLNYZVN\nJABHQLNEKS\n"
] |
[
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHIRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nBCDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJJSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSW\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHIOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEFHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"ADIIN\nAGMOPRR\nAACEEHHLRRT\nCLOORU\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHIRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nBCDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSW\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHIOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEFHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHJRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nBCDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSW\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHIOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEFHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHJRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nBCDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSW\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHIOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEGHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"ADIIN\nAGMOQRR\nAACEEHHLRRT\nCLOORU\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHJRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nACDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSW\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHIOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEGHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHJRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nACDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSV\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHIOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEGHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHJRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nACDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nACEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSV\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHHOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEGHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n",
"BJLMNPQSSV\nFHSTUVVWWY\nCDDHIIPTVY\nDGHIMOPXYY\nEGHJJOOQSU\nBBCCDFMMNP\nAEGNOPRRSS\nIJMNNPPQST\nAABBCHOQTU\nHHIKLOOOXZ\nILLNNPSUUV\nGHJMMNOWXY\nADEJNRVWWX\nCHKMMQRTWY\nFHIJLMMNSZ\nABCEGHJRVX\nDEIKPSSXYY\nBCIKNQRTUU\nDHIIJKNUWW\nCEGGLLNQTV\nBEGSTTUUVY\nDJNQQRSSYY\nHKMNQSSWYZ\nABCDKLMTXZ\nACDNOQQTZZ\nCEEFGJLMUU\nAAEMNORUWZ\nDHPQQSYYZZ\nBBCEGGIQTV\nCCHKNOQWXZ\nFKKNPRRUUY\nABEFHMPQUV\nBEGIMMNPSY\nABCDEIJQTY\nBDILLNNNUZ\nEFIMNVVVXZ\nABILLOOSVZ\nABEGHIOOPQ\nBEHJKSUUUW\nCEILMSVWYZ\nBDFJJSYYYZ\nACDEHIMMWW\nDEEHJJQSXZ\nEEILLQSWYZ\nADGHKQXXYZ\nAABCGILPWX\nABFGJJLOOV\nCEHLMMPRSV\nDGHIJPQRVX\nAAGHMQRSTW\nCCKLNSSUVW\nBCDGGOOSTZ\nBCFMOSUWXY\nAJSSSTUVYZ\nCDDFJJQRSX\nEHHIMQTUWX\nAIMNQRWWXY\nAAAILPSTWZ\nBEGJLOQTYZ\nFGHIILNPWW\nAFHKLMSTVX\nHJLNPQRUUZ\nEHHJOPPQVV\nAAEFGIJMXZ\nADDDRUVYZZ\nBFGHMMOSTW\nDDEGHIMNVX\nCCHHJNVXYZ\nBCDPPTUVXX\nBENPRRWYZZ\nCDJKNNQTWW\nEHNOQRSUWX\nDDHHOQTWXY\nCEEGGMSUVV\nAEFFOOTUUY\nAAABBBLOXY\nBEFGJSTVXZ\nAFGJMTUWWX\nDEHJKKNRTW\nCEMMPQRRWZ\nDFGLOPQRWX\nCJKLOTTUVY\nCDGGHKOOQT\nBDDILMRRWY\nCEFJLNSTUV\nBGGIJQTUXY\nCCEGKKTTUW\nACCDEGHKXZ\nDDGHIMOOOU\nEHOOOPPPWY\nBDDHRSTTXX\nIKPQRSTUWY\nBCFFGIKWZZ\nBEFMSVWWXY\nBCJKQRSUXY\nBCCEJKKQQS\nEGJMOSVYYY\nHJJKKLQRSV\nFJLNNVVWYZ\nABEHJKLNQS\n"
] |
CodeContests
|
Pablo Squarson is a well-known cubism artist. This year's theme for Pablo Squarson is "Squares". Today we are visiting his studio to see how his masterpieces are given birth.
At the center of his studio, there is a huuuuuge table and beside it are many, many squares of the same size. Pablo Squarson puts one of the squares on the table. Then he places some other squares on the table in sequence. It seems his methodical nature forces him to place each square side by side to the one that he already placed on, with machine-like precision.
Oh! The first piece of artwork is done. Pablo Squarson seems satisfied with it. Look at his happy face.
Oh, what's wrong with Pablo? He is tearing his hair! Oh, I see. He wants to find a box that fits the new piece of work but he has trouble figuring out its size. Let's help him!
Your mission is to write a program that takes instructions that record how Pablo made a piece of his artwork and computes its width and height. It is known that the size of each square is 1. You may assume that Pablo does not put a square on another.
I hear someone murmured "A smaller box will do". No, poor Pablo, shaking his head, is grumbling "My square style does not seem to be understood by illiterates".
<image>
Input
The input consists of a number of datasets. Each dataset represents the way Pablo made a piece of his artwork. The format of a dataset is as follows.
> N
n1 d1
n2 d2
...
nN-1 dN-1
The first line contains the number of squares (= N) used to make the piece of artwork. The number is a positive integer and is smaller than 200.
The remaining (N-1) lines in the dataset are square placement instructions. The line "ni di" indicates placement of the square numbered i (≤ N-1). The rules of numbering squares are as follows. The first square is numbered "zero". Subsequently placed squares are numbered 1, 2, ..., (N-1). Note that the input does not give any placement instruction to the first square, which is numbered zero.
A square placement instruction for the square numbered i, namely "ni di", directs it to be placed next to the one that is numbered ni, towards the direction given by di, which denotes leftward (= 0), downward (= 1), rightward (= 2), and upward (= 3).
For example, pieces of artwork corresponding to the four datasets shown in Sample Input are depicted below. Squares are labeled by their numbers.
<image>
The end of the input is indicated by a line that contains a single zero.
Output
For each dataset, output a line that contains the width and the height of the piece of artwork as decimal numbers, separated by a space. Each line should not contain any other characters.
Sample Input
1
5
0 0
0 1
0 2
0 3
12
0 0
1 0
2 0
3 1
4 1
5 1
6 2
7 2
8 2
9 3
10 3
10
0 2
1 2
2 2
3 2
2 1
5 1
6 1
7 1
8 1
0
Output for the Sample Input
1 1
3 3
4 4
5 6
Example
Input
1
5
0 0
0 1
0 2
0 3
12
0 0
1 0
2 0
3 1
4 1
5 1
6 2
7 2
8 2
9 3
10 3
10
0 2
1 2
2 2
3 2
2 1
5 1
6 1
7 1
8 1
0
Output
1 1
3 3
4 4
5 6
|
stdin
| null | 543 | 1 |
[
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 2\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n"
] |
[
"1 1\n3 3\n4 4\n5 6\n"
] |
[
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 1\n2 0\n3 1\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 2\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 0\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 0\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 0\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 0\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 0\n4 1\n5 1\n6 2\n3 2\n8 2\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 2\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 2\n0\n",
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 2\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 1\n5 1\n6 2\n7 2\n8 2\n9 3\n10 3\n10\n0 2\n1 2\n2 1\n3 2\n2 1\n5 1\n6 1\n7 1\n8 2\n0\n",
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 0\n1 0\n2 0\n3 1\n4 2\n5 1\n6 2\n7 1\n8 1\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n",
"1\n5\n0 0\n0 1\n0 2\n0 3\n12\n0 1\n1 0\n2 0\n3 1\n4 2\n5 1\n6 2\n7 1\n8 1\n9 3\n10 3\n10\n0 2\n1 3\n2 2\n3 2\n2 1\n5 1\n6 1\n7 1\n8 1\n0\n"
] |
[
"1 1\n3 3\n4 5\n5 6\n",
"1 1\n3 3\n4 4\n4 6\n",
"1 1\n3 2\n4 4\n4 6\n",
"1 1\n3 2\n5 3\n4 6\n",
"1 1\n3 2\n5 5\n4 6\n",
"1 1\n3 3\n4 4\n5 5\n",
"1 1\n3 3\n5 3\n4 6\n",
"1 1\n3 3\n4 4\n4 5\n",
"1 1\n3 3\n4 5\n4 6\n",
"1 1\n3 3\n3 6\n4 6\n"
] |
CodeContests
|
N persons are standing in a row. The height of the i-th person from the front is A_i.
We want to have each person stand on a stool of some heights - at least zero - so that the following condition is satisfied for every person:
Condition: Nobody in front of the person is taller than the person. Here, the height of a person includes the stool.
Find the minimum total height of the stools needed to meet this goal.
Constraints
* 1 \leq N \leq 2\times 10^5
* 1 \leq A_i \leq 10^9
* All values in input are integers.
Input
Input is given from Standard Input in the following format:
N
A_1 \ldots A_N
Output
Print the minimum total height of the stools needed to meet the goal.
Examples
Input
5
2 1 5 4 3
Output
4
Input
5
3 3 3 3 3
Output
0
|
stdin
| null | 290 | 1 |
[
"5\n3 3 3 3 3\n",
"5\n2 1 5 4 3\n"
] |
[
"0\n",
"4\n"
] |
[
"5\n1 3 3 3 3\n",
"5\n2 1 5 8 3\n",
"5\n1 2 3 6 3\n",
"5\n2 1 2 8 4\n",
"5\n2 1 2 16 6\n",
"5\n2 1 1 16 6\n",
"5\n4 4 3 6 6\n",
"5\n0 1 1 16 6\n",
"5\n4 4 3 7 6\n",
"5\n0 0 1 19 6\n"
] |
[
"0\n",
"6\n",
"3\n",
"5\n",
"11\n",
"12\n",
"1\n",
"10\n",
"2\n",
"13\n"
] |
CodeContests
|
Team India is playing too much cricket in this season. Team players are getting better in their performance with match by match. Sir Jadeja has become a Trump Card for M.S Dhoni. There is a hidden reason of his special position in the team. He can make new copies of a person by some magic. Due to this, players can get many chances to bat. Now there is a fixed batting line up of top 7 batsman decided by Dhoni as : [ "Rohit", "Dhawan", "Kohli", "Yuvraj", "Raina" , "Dhoni", "Sir Jadeja"]. Now they are playing one ball at a time and once they play a ball, Jadeja will make a new copy of that player (including himself) and both the same players will get back in this batting line up. In this way they will get a chance to play a ball turn by turn. Your task is very simple. You are required to output the name of a player as given in the above list who will play a K^th ball.
Input
First line will contain T (No. of test cases).
Each test case will consist of one line containing the value of K .
Output
For every test case, print a new line having the name of a player who will play the K^th ball.
Constraints
1 ≤ T ≤ 1000
1 ≤ K ≤ 10^9
SAMPLE INPUT
2
3
9
SAMPLE OUTPUT
Kohli
Rohit
Explanation
In second test case where K = 9, Sequence after the 7th ball will become Rohit, Rohit, Dhawan, Dhawan, Kohli, Kohli, Yuvraj, Yuvraj, Raina, Raina, Dhoni, Dhoni, Sir Jadeja, Sir Jadeja. So 8th and 9th ball will be played by Rohit.
|
stdin
| null | 639 | 1 |
[
"2\n3\n9\n\nSAMPLE\n"
] |
[
"Kohli\nRohit\n"
] |
[
"1000\n509869197\n704921863\n747550363\n299599178\n307311852\n292108723\n323673613\n406319034\n5990172\n892556229\n812345922\n189962849\n544886888\n836735222\n79035005\n635127190\n588939927\n354303480\n599514650\n49434020\n908869585\n113013398\n833715652\n721245910\n582288889\n239457458\n970221549\n670225566\n929342441\n809824450\n115643291\n730266943\n520547810\n791744213\n36294266\n905452335\n868254897\n608655708\n211856882\n943808469\n274704928\n668963267\n188719611\n770234879\n306170431\n435598799\n337245364\n873471509\n237424065\n361627523\n495041245\n806539431\n591420147\n444075500\n864334589\n85128422\n115455286\n717950562\n31949868\n696695367\n71269132\n110602139\n109874925\n418103696\n295405102\n684436871\n408060752\n7369767\n457089277\n543552634\n886764721\n318138861\n873022631\n76162320\n746034269\n234023671\n193264027\n986306939\n227531994\n254927272\n332767933\n783216337\n589686683\n20129690\n957846665\n784560157\n346045533\n394636469\n18711954\n397890417\n80144955\n523995210\n104524950\n695387045\n557137755\n578626779\n967400451\n293767934\n85841699\n425503730\n320628794\n771653629\n528781564\n944398056\n446475409\n604319639\n349989197\n103804260\n674555870\n487413991\n109912853\n469367145\n946153778\n37607638\n150071649\n108386352\n376364822\n17302346\n328928878\n684728362\n12182688\n182182752\n781299076\n224148348\n574951192\n675739278\n49599417\n979922124\n292128639\n451498045\n60996871\n263403279\n55096873\n240772068\n590035342\n437590569\n600669042\n917043768\n264457451\n592696501\n66533295\n533575812\n710041833\n106444046\n151186365\n516065348\n971320437\n604979586\n704300191\n36527287\n526868988\n11987922\n410621657\n453214575\n845945537\n464880406\n492555270\n620043126\n474146625\n463591779\n516341531\n170677184\n680745930\n297053715\n829775564\n72179944\n593137674\n245780738\n225793572\n102039769\n83526684\n964848498\n559670583\n405097815\n955798909\n934567197\n575469015\n788855851\n529330600\n582111513\n405782680\n728906722\n134149940\n947679064\n548898270\n890943212\n472172974\n859081547\n50984835\n849226113\n766946423\n871665261\n92068620\n647762501\n349730851\n56750332\n113170070\n171934669\n340459855\n5426784\n452337515\n344487419\n184122015\n14753972\n9371186\n528296285\n23861071\n601045142\n795705527\n42105607\n939896400\n742166889\n13864834\n891110576\n137576068\n194166478\n328319140\n967376251\n887038541\n625264307\n179706165\n752586887\n842208400\n931844617\n61707175\n464064365\n662256072\n130042897\n640084067\n940405660\n711365121\n872108992\n959920963\n494452064\n287205179\n661671831\n841218865\n126211628\n672455394\n544452218\n180591253\n802779154\n816954011\n328703380\n189750763\n920937367\n279666427\n305014727\n339034494\n878608361\n673149749\n683962241\n20888923\n478986401\n555715838\n302787877\n212684770\n180123969\n184684134\n872353417\n773004644\n760454192\n71501054\n713547906\n50954481\n339066435\n415440741\n636277004\n232123589\n470840558\n733098532\n73327672\n555649347\n539661060\n53073546\n240066118\n816939347\n82245532\n468654490\n499075655\n40875230\n381399211\n730932403\n174419568\n947580642\n249107136\n297989936\n178068962\n5919837\n710435891\n286925911\n262981849\n207670031\n442364056\n17382692\n886207873\n696612753\n682775648\n405173202\n868440798\n585610161\n225501140\n482102446\n239992985\n587793023\n612544555\n147198994\n658506455\n180351968\n76083446\n774786371\n286781410\n981837196\n473392818\n33646818\n152562966\n30278238\n80188554\n695472410\n51287443\n847095248\n460720360\n294138859\n84431013\n692811658\n222281386\n54788143\n701301672\n32542342\n478278843\n194302994\n120872492\n131909809\n243728160\n87853478\n25218664\n234499390\n598738679\n40074938\n815793456\n504995731\n400957387\n880198444\n627870959\n685645976\n254652024\n1642091\n828802860\n903812992\n26200720\n707529046\n616802097\n482359624\n60512557\n67859875\n793278209\n841457501\n989483226\n924296435\n900947481\n110197584\n752969988\n838535966\n486272135\n246091884\n12773460\n82644347\n167796061\n295448130\n407608460\n995632711\n406379547\n23032156\n347468846\n693937943\n824400565\n135788705\n573115008\n672862075\n937088844\n7117204\n507230230\n301476441\n603801\n203744593\n246424420\n99834931\n179649011\n146387022\n896594940\n178388775\n292953407\n635375712\n116494474\n565005288\n664267803\n728951102\n880044600\n189698498\n42519512\n660850567\n923136706\n736735001\n707532626\n883874937\n141663047\n164545827\n710243887\n494557\n869551745\n723039794\n312938806\n375044133\n502222580\n244152537\n423519363\n329110970\n243277539\n104200912\n544247680\n37888374\n927821720\n813966587\n658675733\n877923667\n50399559\n395523196\n96450894\n493101394\n415718379\n214475349\n2710384\n42442935\n960013382\n693350777\n693319831\n173210409\n100081785\n33556895\n350001938\n317942247\n509111007\n846924415\n530110003\n442248439\n428595200\n739357556\n42045337\n926938517\n209263068\n299249511\n79813297\n392270138\n902492497\n514381512\n588376196\n469611158\n752312975\n887924123\n269951672\n237884614\n659623618\n776641326\n398239030\n289928932\n195148275\n649512150\n691310543\n969749125\n320129979\n771100732\n619272500\n407137325\n667201347\n286513816\n779352132\n68502658\n66017628\n102307718\n498882013\n726914017\n2495350\n930237571\n614985051\n8038560\n605687580\n718653474\n960889984\n600918842\n27368847\n426694265\n2597709\n503101637\n779174234\n19150846\n538801093\n838897486\n912984061\n545534826\n989210953\n643171418\n496810162\n265052612\n651245420\n550704602\n37710438\n291638795\n15528298\n931662613\n943345828\n734644816\n291919096\n77192498\n294174292\n679953444\n217030808\n2636857\n806674660\n716730303\n850409692\n332005846\n652818230\n215118501\n74747813\n594735237\n119314528\n155721439\n220739001\n256114625\n754353201\n463876740\n10713757\n470566972\n784293337\n156569087\n582257048\n704305778\n337331776\n178314346\n189508844\n149972021\n227034790\n842741645\n97254957\n915182573\n988704011\n712931812\n433680858\n107761902\n618651907\n359861596\n879877214\n523925650\n935430044\n44953015\n758546195\n68566547\n346703824\n721115071\n176374050\n791208684\n625592958\n260892588\n807586176\n797290406\n554975783\n956489154\n798096670\n220952942\n349949945\n444095903\n414151583\n444234968\n249545978\n83672849\n835251192\n759262926\n584150002\n661316364\n161852297\n537241764\n46671334\n573562577\n959607090\n307252074\n80516104\n319445512\n211585878\n38398941\n564599288\n637464157\n857251237\n353735730\n1662401\n815765617\n37105658\n657615790\n243330842\n852580800\n314596003\n103362921\n699422245\n11654864\n48463005\n60114823\n32499258\n547262282\n957792894\n87734740\n383976525\n98175854\n567216696\n324180053\n121217746\n137755440\n268291808\n612225190\n867694967\n580943013\n448543416\n794671156\n630397613\n201446814\n282358413\n452066842\n90253602\n768817226\n101996577\n564502527\n11202037\n441541757\n81905288\n45140883\n621076384\n660244655\n476991950\n40328813\n142090693\n702637428\n7756957\n167753253\n930361494\n550275265\n57390647\n344429820\n363539262\n206480133\n771101200\n981525589\n324277490\n965745178\n390882034\n194948679\n235482052\n81953370\n291963864\n36512047\n625117721\n656615137\n605225047\n534795924\n889111387\n896944897\n410761360\n653719249\n326159305\n26767765\n61727319\n9528346\n22200751\n52043120\n455952925\n772237393\n395781104\n136143356\n884379651\n827552884\n222819190\n858112796\n594668541\n205258643\n923259013\n644865103\n690899133\n497632196\n402979941\n513525170\n80738091\n902897367\n669676881\n90624454\n352372069\n350544678\n56742612\n983420037\n306397734\n754009253\n332497418\n531638026\n708314649\n935529836\n367769739\n648050501\n895179557\n805463038\n827835812\n683022792\n263955116\n385499331\n129076312\n427075508\n967697876\n204526388\n146763690\n346094261\n66124325\n102467963\n690248668\n302685176\n988460123\n908873490\n385548513\n955678186\n53059376\n356298341\n914888765\n345640249\n25479222\n673117815\n940343730\n24895024\n444436624\n698198496\n771458258\n540148454\n654769923\n804968047\n744069250\n774591463\n512833721\n344456623\n459629870\n500530025\n714668070\n550198013\n113403703\n158024619\n275579615\n691829560\n896029476\n57666142\n679706991\n369862531\n107479873\n380461578\n358907514\n670102796\n13430691\n36920116\n686695050\n706569566\n877594686\n609279420\n750262458\n430235843\n396357046\n78582322\n30626143\n484976955\n100321727\n918778435\n147330889\n141589626\n284946500\n207275884\n467290148\n397803551\n767671740\n177166198\n219938231\n475571344\n786523895\n345239167\n726944996\n730063183\n597824557\n354424607\n842199905\n582165372\n310990886\n641703625\n449933335\n739623452\n215992115\n725192789\n138587405\n804934488\n534430550\n43237870\n849391598\n400769164\n11701763\n689210865\n40199331\n320274146\n46631847\n496097015\n16609225\n125837292\n262149990\n111517707\n672344552\n829014371\n370614855\n221274872\n318176521\n358490611\n460052429\n953124417\n874632960\n223674419\n992657297\n583816557\n352073550\n982690559\n930962870\n920183469\n493804623\n143082527\n753813483\n130254535\n340825453\n914485216\n212546927\n10880315\n122423624\n77594156\n395485577\n257284588\n90568512\n205251102\n589613646\n940080478\n688482181\n471205445\n423303400\n994388123\n756521721\n402970381\n707237663\n14495310\n750102473\n36335228\n239513249\n114804652\n874550572\n986462950\n702125224\n989078924\n926031075\n783367130\n622193574\n109504162\n836044676\n417350405\n726648927\n48998794\n36477144\n831599227\n657712927\n875912394\n252285187\n817498145\n884028930\n582339751\n94295085\n560737750\n954200628\n635158421\n113839337\n475983123\n264842600\n269057390\n594459982\n788071044\n223981233\n61216667\n810030997\n85207653\n299607063\n439835047\n668905149\n211930392\n386194805\n873585815\n804177587\n698097325\n11657121\n86396404\n951592297\n894095884\n919523743\n936304203\n497654026\n769876751\n522660296\n936558056\n469194103\n185320531\n830859561\n317952120\n675046518\n143800339\n726274112\n985030257\n452077870\n275601198\n54575034\n853254810\n550876425\n778055952\n758441875\n817131367\n162042018\n254586596\n216266231\n37293100\n306082417\n896927368\n116151457\n94885870\n313934203\n717908563\n326072682\n718378651\n636907117\n439401958\n625525494\n274508780\n667271118\n459155006\n902521585\n796359748\n93275939\n611820104\n501865506\n330873347\n153164133\n189769999\n451140592\n702639021\n34530508\n326742680\n241616795\n754976509\n556783474\n66676946\n239143329\n133106373\n27026478\n908045643\n149922093\n742282314\n806329169\n352514000\n588495348\n679102588\n594692132\n601752580\n155101524\n539245831\n723674471\n596924323\n256577298\n147467504\n290194284\n359952045\n252569910\n514774085\n389512253\n2263302\n177690489\n441762480\n644113095\n936802559\n637976143\n872265351\n440363022\n745742606\n774494564\n824832095\n739158694\n640351584\n348500358\n850690951\n409771152\n43678929\n819819263\n240353503\n997664335\n",
"1000\n509768355\n10070376\n749068153\n832388171\n32592846\n765808378\n864991989\n249148354\n990740862\n586548217\n165926576\n87268433\n575398171\n391276970\n390187090\n252443113\n531180553\n255113106\n101692537\n335661988\n824571068\n853948979\n687260346\n617564843\n416929764\n892482808\n932746595\n834478486\n11682472\n364987028\n123666951\n499354582\n286350392\n180168611\n141886001\n971153831\n306703604\n599799042\n327339290\n531422837\n239116780\n893801117\n467245848\n800737091\n501352109\n646531969\n788628584\n211525198\n18550188\n180960315\n356249467\n93463447\n822687186\n49411490\n530207875\n87183129\n141693850\n36639254\n54310930\n916329956\n152321042\n52325084\n899954579\n602362846\n467520178\n762046694\n126298544\n985768966\n130141784\n593303043\n877653874\n810955909\n450334475\n39132484\n362742020\n692135728\n953731531\n340979723\n5430039\n68335486\n403841478\n315379413\n385232909\n739385279\n577960782\n115405935\n449799498\n637708640\n25697130\n833626504\n370419114\n872035766\n876695221\n524356694\n383148191\n415655618\n952747456\n188404147\n910682365\n515635800\n987454369\n185035181\n123045625\n794146735\n613292234\n828538072\n748488370\n677909885\n230673047\n506997508\n685085081\n565107987\n242846249\n297960830\n688884427\n996206806\n465259617\n423503606\n857379298\n151669530\n839781142\n939108704\n742649512\n328471234\n228652822\n119718058\n702302988\n36178591\n108786250\n654999567\n369627461\n451625677\n265528028\n51627544\n913818041\n884238577\n604005813\n163579136\n288550006\n434955330\n52976336\n108128701\n134087979\n345009351\n366298551\n691597542\n143986604\n916250093\n603159835\n184516192\n990332097\n513273216\n934210734\n26846308\n27412100\n946743656\n7365176\n818637154\n54387776\n853493258\n617892080\n474351089\n959438353\n973160382\n464164136\n191623622\n540211288\n563337321\n902421258\n110163866\n393175342\n290774369\n519506045\n462669034\n40151845\n522176951\n609817002\n47984904\n175897090\n10489132\n197165664\n196030721\n448396543\n680564072\n742437376\n264972549\n305626586\n32614105\n123108384\n494549828\n137228493\n794924394\n798505165\n850981246\n200695696\n543220069\n739795700\n609093191\n122182715\n116700107\n164820639\n34041870\n349750989\n602113478\n778263276\n95452682\n689117706\n415055885\n610453153\n2356526\n951410030\n185121842\n786460825\n78317904\n674616338\n710603440\n748534527\n453670577\n67520196\n379260557\n500700397\n430626620\n314791364\n91827961\n459265168\n606530672\n649211416\n79325132\n216324378\n867086096\n291970124\n141723867\n393651340\n848421807\n926973590\n798734979\n211594070\n821694479\n899241530\n355566545\n707399048\n579409358\n87820182\n672516579\n779692286\n343020002\n291048253\n473319726\n805189588\n526928956\n665482685\n672636413\n646258677\n844764647\n738111226\n215426084\n8748140\n1084171\n834872235\n832583568\n228566718\n820051777\n853249014\n807850466\n944245142\n817029685\n807460071\n32231091\n335146807\n755858589\n349516505\n749204404\n974875081\n218339178\n724478757\n875269830\n397034054\n719637543\n320268491\n158492042\n689107028\n235590739\n406784726\n390424668\n97932898\n424435085\n687265095\n342993873\n851898157\n578833344\n351074892\n378114722\n363100595\n276254812\n154963664\n724103871\n17011762\n94438297\n27121960\n365327970\n204524431\n113872391\n445329254\n668245377\n8044256\n494516472\n369710428\n846052039\n900472100\n710403705\n539072036\n97669186\n287194795\n487147943\n80895044\n832031598\n334637743\n144341935\n884556083\n852265634\n105664562\n728396886\n509658289\n307674761\n96552978\n854439762\n345915639\n565895438\n947020737\n221814616\n6623114\n792994188\n362883848\n928355277\n398428271\n323018765\n930803160\n737808559\n570952749\n838997061\n439057439\n277645595\n700629655\n829758278\n136041555\n966506478\n508053032\n452311546\n55510069\n388518886\n486613309\n685236001\n599749367\n846838985\n94288000\n2951341\n797239947\n854395010\n386865002\n607072332\n162956441\n560333376\n600337751\n791486865\n799109951\n71297533\n794841526\n553226329\n263799414\n270486877\n643140461\n976515870\n232179903\n62922536\n770187642\n305354399\n752934497\n242038729\n610874079\n988796280\n116213248\n133407200\n994962353\n24574509\n145604540\n191613034\n7871359\n297411433\n45103636\n142549688\n827031812\n409484087\n307040995\n34782418\n472530536\n426175140\n867598429\n312816267\n463014807\n556591355\n985216574\n436024035\n834832095\n157950588\n385728018\n825135067\n388758164\n213191361\n897560545\n20539061\n602597894\n123004620\n104975700\n242498900\n548129715\n858741209\n418987597\n325647460\n368510851\n12114223\n385878917\n66327273\n218447712\n401126048\n567400217\n113650213\n6150895\n91956623\n119816342\n561065942\n27672631\n30520872\n301879712\n129024777\n147119210\n671964187\n878670757\n721839314\n611307909\n483338729\n336461123\n577634904\n683730275\n62816242\n131188024\n997589547\n82667487\n763613821\n695198269\n886250590\n60169952\n604664948\n711146626\n494830814\n210405488\n526937041\n801367280\n709907810\n794499359\n97392861\n499259007\n827505014\n772655520\n187694425\n74190359\n815540454\n547758411\n706298409\n615226281\n767423883\n306400893\n14006339\n328805237\n547273942\n153762507\n656707222\n5413995\n798683985\n708925332\n461860782\n133858590\n345926908\n548389741\n579643484\n82195983\n428980674\n568664353\n32631128\n261730312\n854827922\n427269818\n85982385\n435625905\n585912126\n5659594\n70207891\n15485021\n204306074\n738913586\n22692495\n288141133\n5477760\n515994920\n787637048\n726648822\n47234059\n441347057\n104549675\n317843893\n3558969\n272225508\n947024260\n281025677\n881996780\n787733053\n985817437\n797310248\n95364050\n760770882\n158562730\n84064010\n405751985\n6112077\n232638724\n184392502\n265861687\n571370836\n275850689\n952802984\n767275830\n113041402\n949991467\n113137251\n413441963\n609457283\n444638612\n945527158\n889036127\n986437497\n274336653\n921816283\n19222110\n736535134\n643335244\n748362684\n67376336\n108889184\n444431438\n611037394\n438664198\n317798829\n453072108\n953373728\n769835643\n831758147\n388101493\n707036326\n925591645\n840318068\n373289391\n868141064\n636044344\n616774263\n221457366\n444773305\n61828755\n359975778\n444546661\n193202928\n959416053\n598364282\n835648094\n194447672\n759379404\n187408321\n206220319\n53762002\n73527868\n772859865\n120249773\n255806178\n72155546\n537467901\n699872239\n777865668\n500918561\n802341681\n906796248\n980564211\n346266613\n815360742\n674822481\n880281554\n877217089\n912361362\n24154741\n887402125\n293569654\n255220806\n764322797\n519152246\n165723955\n36204720\n754840133\n412195689\n783779222\n312676650\n263955535\n746928877\n237314798\n672660701\n54467086\n393360194\n43194499\n706647648\n835531440\n174423761\n18052386\n404336689\n841552329\n435773775\n923679569\n916311441\n841139444\n145770301\n830074514\n801665300\n69375236\n699050552\n59577921\n598721939\n758725765\n939115890\n863424614\n823564133\n903357830\n818743941\n701673245\n982602452\n243244748\n198695169\n132617492\n961629292\n934662743\n33826990\n594521309\n671310293\n980479947\n77525205\n29722347\n120359332\n535873091\n665704340\n103024704\n664363840\n195561314\n942103902\n336430997\n864403449\n301878582\n316936647\n787860983\n988453300\n1103102\n359949325\n999951097\n118532684\n900171220\n155384619\n209159975\n68436513\n747414847\n169465413\n434959783\n127817907\n544995363\n512390900\n137511244\n252153150\n745835933\n195557806\n883144946\n403218779\n587095555\n420714341\n429746450\n554159703\n918630703\n166270225\n420526242\n208946431\n419982386\n658293234\n98617688\n757573566\n901460120\n343090449\n327567342\n423712920\n80352402\n508685872\n351035191\n710860022\n972844687\n807632985\n436525629\n882091645\n234645461\n699366549\n868668426\n909482890\n683412305\n368049166\n842509016\n334943015\n832597512\n462923526\n22431595\n198162127\n556811413\n743151499\n175432155\n786261175\n224671421\n569400735\n524101527\n389523716\n194921943\n933613740\n376198972\n584248830\n174834913\n485833109\n457316483\n67236582\n261914766\n453075233\n5895596\n889209851\n404345698\n992966592\n487170321\n309518457\n871296959\n196984214\n441367858\n454152082\n570240150\n599763910\n91263179\n143101129\n505166104\n116932744\n927267044\n81461643\n971830176\n582228371\n576718852\n113126060\n225354826\n524874108\n489390701\n327126891\n463503911\n187027695\n251490078\n545906844\n6170311\n418281335\n133500121\n202298173\n351859824\n331177551\n970953467\n879765737\n797815358\n142296865\n872802945\n885770792\n586139554\n533074703\n877837458\n601484910\n951339135\n141073217\n988691252\n852878712\n672248280\n565358287\n509058468\n963901449\n822487209\n983365345\n387189297\n615047463\n263900817\n620379678\n481221375\n257314437\n444757022\n788160381\n725468185\n324717050\n763495517\n854346588\n927423868\n776622744\n292835136\n795078662\n36900007\n141819307\n643324000\n913772189\n906700240\n160053982\n23345204\n520803061\n786780476\n362628740\n935722415\n663865118\n403475248\n248215331\n341808830\n55329499\n855549963\n825194663\n390388129\n483821932\n15202989\n552257771\n165114277\n319861029\n545825376\n430033869\n296747315\n768174285\n826601652\n622235915\n821129349\n784132435\n599772827\n93647565\n976578538\n931053566\n651414907\n251788957\n67295116\n891308291\n519992199\n43524724\n375579475\n702877206\n742738516\n31265228\n927369129\n4108004\n909922165\n623856282\n930446334\n828697505\n487498927\n537432198\n99811918\n147256933\n839191001\n403639732\n72118045\n907188601\n132390134\n874099487\n847528303\n149141164\n502110493\n507789975\n119176061\n182893997\n850291916\n500028261\n664551330\n844834684\n122126851\n177793866\n824832299\n742587322\n283243911\n656633612\n915734372\n879758989\n477497942\n954601776\n141705689\n88133694\n646745462\n81838141\n64084894\n978585725\n306107123\n519064883\n637993881\n170387910\n906981333\n589416739\n778148183\n161084645\n520216482\n665565451\n709297155\n475542782\n660869774\n245948748\n547666582\n517315826\n513267713\n841721813\n343711489\n821064614\n50518703\n250492757\n963801973\n150594084\n299016809\n256854297\n301118623\n74820203\n225201513\n888722391\n801540066\n112051045\n691834317\n182884148\n477855993\n529913992\n649762629\n606143802\n943925680\n890282785\n109794620\n629708761\n715716905\n998098682\n49764844\n819673839\n943695989\n531737215\n20996745\n143667108\n841448122\n38754146\n446466195\n242556161\n510515335\n827144994\n957346541\n968910677\n906332559\n629794136\n3130883\n81126240\n629679256\n219826370\n949910944\n759787204\n805755760\n305163532\n692516482\n910613068\n350961128\n613566821\n794167074\n955129807\n426388118\n152152381\n719510724\n129401425\n241894985\n342452318\n339917860\n692955194\n694111071\n793582987\n875797826\n474224458\n771731003\n474818962\n233045276\n929248438\n23012256\n219913326\n263896789\n759584862\n699961053\n123078919\n353718986\n513342220\n93960948\n239864492\n575694819\n288976385\n11172602\n",
"1000\n509482636\n650442077\n81304316\n120731521\n910093866\n214667702\n147523748\n235487185\n813836295\n823245516\n50232985\n304688818\n303932865\n129145263\n585934958\n241913385\n651701118\n974073720\n989154153\n42921231\n615703446\n551588863\n660195763\n9651519\n590498309\n983129770\n722847566\n584033877\n857087136\n536270097\n102637014\n590908951\n442338916\n594854719\n186868635\n873135945\n833147078\n902640920\n654539446\n78824762\n957831569\n530841685\n2209564\n67612150\n338538981\n140455951\n351719818\n125580356\n800085125\n281177782\n290941861\n832673029\n732137738\n750744677\n299343401\n303435107\n707648558\n477956634\n73903632\n852778252\n338204480\n960948585\n231438429\n692774680\n955179560\n55683002\n147520163\n968330317\n889640267\n48412829\n925581624\n671895121\n72265908\n37934608\n350489138\n916378066\n960905812\n660036258\n121947225\n867594531\n247302581\n33605109\n805947223\n375598519\n22949707\n754844737\n489575117\n72219169\n45488462\n606578143\n447056506\n426494910\n947005518\n113512516\n278069877\n595990061\n941208813\n531959483\n668591514\n383117881\n699331675\n282541108\n375138053\n726348600\n443853839\n286361816\n372171779\n618692776\n46746872\n488742323\n167256080\n16825831\n471367047\n991864567\n499692742\n320450798\n75042137\n98987771\n535107606\n685099827\n812944009\n652076463\n633142414\n236160627\n394957747\n975980373\n822016419\n867636176\n947230096\n799931455\n200317152\n269094589\n72179935\n947373824\n861180524\n614365509\n539718181\n72526333\n326834069\n630108078\n984586783\n588544933\n158090263\n378858316\n975783078\n801046641\n408991658\n213719990\n136143361\n530076273\n229735742\n786097909\n628143413\n176716833\n109911624\n448711342\n676423564\n665492351\n835092875\n600300167\n159812577\n261018663\n779045054\n995506240\n428265097\n633767369\n2361077\n820994907\n672049388\n163160317\n46297427\n170467376\n301986528\n983701429\n740785784\n69565803\n961330247\n557968135\n502437917\n568354209\n321912001\n863677208\n980847977\n27458254\n574970294\n996786592\n265400911\n62655772\n581652388\n279203386\n112619221\n651233754\n354634140\n68853742\n524235482\n847809167\n367751338\n131881114\n115838708\n74060581\n781845255\n20747986\n819033082\n118815098\n913027210\n123256429\n396549682\n961828147\n129335067\n67195939\n371924092\n396397248\n754257336\n207061105\n152466782\n354293617\n433747209\n429826932\n759337037\n829733572\n366420407\n592147687\n580034625\n6748049\n184001893\n936443392\n43907308\n801926636\n373585874\n763067324\n893254005\n9352685\n10446198\n61766373\n665908924\n39596925\n933054739\n718487393\n110146484\n894132295\n738387193\n558636159\n199402823\n288740028\n333687797\n210985049\n323296760\n308097824\n410134465\n500525806\n643759337\n640546567\n330612352\n61588462\n823242401\n145362813\n862583453\n925460508\n783782156\n361988388\n117648359\n630997660\n696502148\n971321060\n969837760\n455431004\n590245734\n826165259\n523325932\n593387846\n948550475\n516704831\n627305570\n127475054\n77632293\n243357909\n100592082\n20183986\n77303303\n595182727\n50344377\n822466742\n993763889\n2439111\n778124925\n563283666\n641673\n840259297\n385525201\n563873402\n174916397\n62238463\n803487193\n625159829\n216840653\n161089206\n596873209\n544987940\n387632539\n267777396\n556437294\n543396994\n772794301\n165799265\n95036103\n130125394\n672223726\n945775436\n121264585\n718074733\n617020812\n70239115\n540266789\n496142621\n783109267\n937644840\n554903608\n536540156\n346551333\n512586261\n480363697\n874705820\n300748799\n656026589\n450917039\n885963631\n886604753\n570136559\n213097393\n672627789\n294411329\n161963229\n47288461\n794390278\n204648361\n49280254\n472008070\n28119886\n957601083\n158934550\n536404403\n212434309\n265593236\n94760\n592614507\n835943784\n869142208\n489306156\n53662716\n759215493\n934427211\n163304180\n962331815\n211452335\n587037981\n807455543\n956129002\n39989307\n85368065\n848167900\n954525935\n14529642\n179636757\n940434051\n188532651\n922965446\n798948055\n497795115\n993675927\n524061791\n76068177\n518160288\n466851245\n256707998\n196658757\n266379360\n681966359\n481451088\n823133541\n315752807\n425318706\n505897713\n528183332\n272943647\n338788331\n36314107\n238920015\n527351636\n533918277\n377787560\n159456162\n67590105\n554221113\n950748566\n598410856\n825321085\n574582816\n926894787\n267389185\n119838545\n934231763\n25893298\n396945979\n32457245\n48053571\n182499719\n666112511\n520703760\n472215989\n582034645\n261345844\n628621407\n413523630\n834550912\n81462614\n988149773\n135271967\n916942844\n715711430\n906080357\n686002416\n950371803\n708606056\n745143764\n299691665\n68644627\n304606964\n721308921\n493831126\n942905861\n930054028\n677661504\n351100874\n460406783\n673204934\n611456529\n833711422\n650152300\n712893358\n787384487\n776823389\n517591997\n505519003\n812559083\n831979902\n820170491\n55378971\n332638447\n754428782\n941070380\n352799699\n302174920\n2522112\n25639085\n64967969\n994945501\n741342952\n843953791\n201860096\n785938046\n881905846\n259405322\n433426638\n336957436\n329232907\n499576464\n513650099\n32936147\n654508537\n706820839\n451385290\n520311013\n106864321\n565393569\n747655629\n921321200\n288296717\n472894401\n892299481\n999053360\n62652454\n171499349\n466487563\n941142978\n218566865\n256246872\n829544883\n490091671\n16524026\n693897713\n502642368\n502691099\n528616789\n322508278\n147886512\n890010799\n187880625\n701782699\n674712183\n967082935\n252243823\n329197177\n899062361\n846144229\n509329563\n432131593\n45972591\n714690851\n726174500\n458335013\n5801116\n655671911\n932294834\n831665940\n631474678\n330712866\n603443620\n659123393\n959294339\n345813318\n993670038\n779472781\n741862981\n994146606\n199216569\n98948924\n675302304\n147828347\n705527871\n549695997\n59051599\n135858893\n398377304\n466416403\n745156865\n874267585\n525267735\n662628749\n98657928\n872596053\n349116822\n474183164\n77702745\n73057253\n305684508\n858625526\n976574476\n862783532\n993220974\n674505081\n988190688\n675446739\n634767525\n986501213\n197727825\n54336053\n338572210\n344548341\n208038062\n185410132\n982396148\n277764487\n551363852\n380306953\n907608793\n604622504\n145273951\n516563459\n398750013\n642473038\n289651964\n628210620\n306264875\n668531687\n377605499\n601428002\n142370012\n102184560\n15157961\n2375955\n277953226\n576016571\n47307535\n321870769\n963787211\n49972783\n812633545\n729075316\n27129424\n697679198\n633551360\n873768888\n940505624\n598363835\n828135365\n629546542\n136785819\n151740830\n38120228\n175237191\n11372287\n801062447\n881546880\n668714701\n306038143\n152814250\n751737359\n803480606\n721355900\n283407172\n898690179\n33332289\n515628777\n76322581\n498961022\n907334640\n291900327\n116129328\n516059994\n881335759\n60983928\n607161471\n868019387\n738502652\n351671925\n675030125\n75186968\n946969934\n722356015\n912470808\n716130023\n498921960\n250819606\n14702175\n138819014\n963910850\n980489816\n95909855\n344180922\n120890457\n286363931\n407718584\n53390538\n272783361\n585441403\n891056501\n228737550\n396257914\n559954445\n880999155\n53035214\n157111387\n313662333\n443556767\n942827426\n966184403\n183002028\n518485286\n841029110\n231966630\n773410519\n785156963\n993533160\n272060469\n527601214\n433608429\n244835119\n158256795\n30277986\n514662004\n653250533\n245287854\n177439359\n515987864\n462143076\n583406554\n51087703\n223741162\n966923258\n70423544\n138093925\n307854489\n822274194\n905093307\n276522235\n147670951\n207656946\n429348241\n510815761\n788341255\n470450216\n969458892\n530247469\n605155854\n371869180\n827878684\n610476269\n745254551\n14205127\n374867866\n834670398\n735276396\n962562148\n580787999\n783802992\n505275260\n804033996\n77859622\n769109125\n712975776\n25100166\n951678344\n399707946\n562583800\n122895686\n214701829\n514192457\n351508685\n872035319\n869182492\n959455564\n908038246\n379988127\n637163732\n457362969\n848526784\n543838382\n601267836\n597943704\n209444589\n409493084\n812640987\n854153010\n968925709\n158975376\n222566978\n559765593\n1930871\n826069833\n66984790\n325013916\n103567665\n199974772\n957164870\n269953607\n624793572\n503610195\n943477732\n10975470\n928597482\n967296639\n696483297\n654492303\n640879781\n635972749\n560960738\n406992650\n383132269\n941150791\n349879956\n622178200\n851113351\n273500784\n112655295\n110045832\n556861551\n438337225\n264814552\n945138294\n795849820\n319754411\n901380297\n942085155\n21350168\n995583948\n734303446\n642577034\n96932869\n358108044\n118312388\n53914821\n494473154\n641664809\n945036463\n231859843\n126125050\n803531402\n220696852\n547716389\n354422068\n445139519\n774336519\n316053427\n975967972\n406689032\n575191844\n425410148\n688375987\n833886534\n445776030\n380371248\n988214851\n81554273\n381178939\n323788186\n977560025\n601423812\n717561276\n931671014\n84541428\n839781730\n948991220\n334371465\n963974890\n702422676\n693387387\n161140461\n310832354\n479127361\n422959498\n509394510\n523695815\n13173073\n209005464\n619053790\n671858236\n452339720\n381546854\n271788430\n250409035\n704169959\n995201717\n752597970\n28480374\n573871958\n716922623\n935248278\n78075360\n686242844\n341890492\n634726506\n90191100\n304538559\n719109726\n832278987\n551924785\n11069509\n800336122\n559104480\n273635509\n229494723\n30258863\n400165523\n810629491\n406678083\n391172001\n980360534\n424938341\n201166686\n869214418\n702939619\n791713800\n318239202\n57582758\n425755743\n54340211\n408455716\n203078774\n793422729\n329825267\n511048976\n58631053\n864580632\n925405836\n12393485\n577564277\n289798513\n943776016\n729267364\n107396506\n919892276\n687787393\n531321771\n687984165\n897888901\n451154832\n941970701\n245205437\n939740487\n623608158\n55193553\n511285408\n884860023\n311230500\n373928829\n84661068\n57474969\n200338474\n627453443\n465292918\n983193513\n439788747\n38224682\n930795562\n255721560\n797464467\n539839136\n105417004\n655753094\n149253868\n41939194\n290476756\n605587875\n983491406\n151509097\n290867358\n934888528\n681111831\n4300881\n417929803\n520269105\n756903985\n385230488\n53082938\n397917462\n534690270\n467772029\n699939157\n109460260\n891279989\n44320485\n510645307\n71004524\n165206557\n77714755\n68005543\n94036631\n511868666\n950259001\n167130262\n49686352\n854846215\n527816489\n549864287\n946921762\n60212844\n118647005\n674080620\n296725602\n403243894\n654815947\n785397188\n381640028\n837763841\n39681729\n210871920\n569421304\n869804710\n679655255\n293431806\n878989344\n426976309\n93556510\n446217160\n558895990\n271415146\n419075788\n807873590\n185406570\n129433387\n133467725\n657818608\n711513094\n211607549\n48236025\n894616670\n82439450\n19059469\n943607721\n841313173\n918149957\n676306791\n850372187\n701659318\n955435143\n263202969\n629066584\n660066301\n981267339\n278837034\n604695878\n230987129\n343322748\n84332974\n631262639\n855036907\n437809646\n987728894\n710913342\n868993920\n",
"1000\n509331373\n255648483\n362355555\n993656827\n203048091\n277733548\n385759492\n999731172\n569736870\n85458944\n228087606\n3163561\n275957973\n608441525\n552663082\n741629093\n565062057\n825288159\n21195534\n898521370\n136739300\n162992224\n14254617\n206646289\n416201438\n536409601\n92893315\n830413257\n259371740\n16497597\n835897957\n892024046\n664784609\n824974956\n992739874\n971688189\n343336509\n168130468\n827763058\n607729954\n478191160\n868098460\n919998923\n539623655\n631311498\n883113893\n28794641\n206402713\n824290680\n436435157\n509012381\n189317240\n431554660\n879974115\n798153337\n380258984\n894490037\n308506046\n828670678\n829713765\n33524158\n799791186\n990299723\n969163405\n65868534\n98355920\n298618671\n214703652\n751735398\n770522079\n838173537\n837378873\n11975494\n556131674\n849292588\n529804328\n954123428\n692045441\n436277929\n13965032\n427654715\n758107917\n499266562\n954481899\n274416597\n472338857\n145206061\n936827429\n55966226\n612698637\n234984108\n948555744\n605260914\n783225180\n738310984\n425275136\n566712950\n447655619\n905852506\n944574173\n52086394\n828871630\n119050515\n574713435\n620337260\n122689462\n43662348\n979851210\n454664461\n591859415\n30014415\n586695281\n490147577\n956136168\n160428269\n225923285\n134642513\n282031474\n606557783\n311769766\n54341676\n639981751\n575168068\n818903143\n875510199\n141948543\n22297211\n525762700\n745958329\n105183731\n237004850\n551428186\n77273065\n663657038\n846854569\n710595701\n618465154\n516071212\n715489272\n467238138\n316767708\n302890637\n146675856\n662964457\n298451350\n343119479\n815474552\n440143504\n558174647\n825801447\n851188589\n538025843\n339785205\n610906256\n382111479\n171506210\n374896610\n963383393\n705454605\n111410562\n664654771\n790271337\n697083685\n362182597\n27331588\n386674699\n349229685\n223587958\n539507277\n822830099\n658254047\n233098006\n667997908\n143800067\n367315195\n598464074\n365368591\n94145351\n398545839\n358404274\n8986477\n711846843\n378476058\n200527586\n865278953\n131572414\n15581329\n675470990\n42354075\n820930782\n594300520\n462380637\n635514400\n299940043\n948166386\n503771949\n160206143\n787618897\n214681185\n167228749\n350569941\n481337853\n67476536\n999854357\n492623518\n973991035\n746950998\n609102445\n130231060\n507572321\n962936357\n634571501\n839409499\n135355737\n531769000\n407723607\n137812099\n659268428\n456317710\n460727947\n421653568\n35465470\n215167258\n746723079\n280338879\n76401029\n24340324\n504624539\n811688164\n226829791\n337903326\n987516828\n87299954\n518979171\n551819717\n245191647\n62359363\n687969846\n450325688\n684545602\n881115249\n649839652\n900669356\n730718010\n866083711\n417850825\n340369499\n486813506\n109367099\n473006702\n632258741\n623557825\n416150609\n36514011\n96835476\n514320127\n556678508\n656900811\n111580664\n376075431\n448475110\n646652221\n16607707\n539033080\n88548288\n24892239\n752016542\n993838213\n104118939\n520914889\n873177438\n383036289\n682402351\n219234051\n732223739\n48679837\n118217779\n50013812\n354724308\n436823678\n596433887\n603754034\n433800557\n178963128\n356169683\n900017406\n510812595\n735130293\n654492674\n440211398\n344881685\n161195956\n36633032\n949737783\n144437557\n344191390\n651213546\n14998284\n820555683\n86849974\n984808706\n23437500\n717634513\n808177853\n4187510\n305599640\n579732690\n227093805\n480219330\n595813298\n910932946\n639087153\n572045011\n869291679\n853981606\n235622328\n937701049\n706512044\n703918659\n66569904\n794475862\n849962422\n50286124\n990892211\n982787213\n407943001\n175812357\n88252654\n937331349\n935415085\n586633329\n448920320\n893749523\n747589130\n596768734\n143464035\n368980085\n662982893\n253917789\n546256328\n437496965\n27466621\n69981869\n950409375\n546982433\n903725458\n555016796\n645794638\n281208342\n450176368\n529311789\n265955036\n785900059\n243458337\n847905618\n48223428\n889802671\n984840623\n205479106\n333613360\n107406030\n725574731\n322339438\n250772506\n370576115\n363267919\n940985633\n75940510\n519944666\n392121233\n547329809\n299622949\n706831049\n977372173\n384775122\n635293751\n886459594\n632320306\n303893360\n819572148\n588962772\n945163175\n420928560\n735157896\n325320068\n954097035\n248458290\n130253449\n676960464\n99236056\n58678894\n521160679\n709202674\n828180482\n33440541\n541923907\n430037436\n2310471\n177363645\n243462673\n920780770\n795224302\n544091620\n355567828\n374575016\n207707742\n76172826\n922608611\n96589511\n29741072\n80682994\n769978315\n82162797\n871223579\n111170194\n919757089\n770086911\n114239535\n759659968\n607880175\n855471860\n305613769\n462811380\n285077420\n260164677\n311004241\n73064883\n788309331\n81387181\n513443569\n649849951\n719377236\n240256036\n713923886\n927599407\n579423063\n318160117\n82788583\n5778052\n61131483\n378343516\n120377839\n260727793\n185360258\n144163830\n599920188\n422860245\n988732986\n406818410\n956551656\n494180364\n15710573\n54578657\n914146571\n756487573\n976528585\n91493495\n132862407\n782948403\n27099826\n200225612\n84969229\n1189742\n668624165\n931883238\n356422909\n861019494\n55417946\n548982458\n951503508\n401819168\n686153595\n989366196\n311760645\n48528662\n163612015\n841147359\n71893926\n81000442\n17263323\n820552957\n686646686\n41199451\n388130624\n403544816\n417444700\n957077572\n950219768\n655224871\n861344502\n429763881\n54026293\n427403191\n32615116\n553907821\n187120996\n26503751\n712507542\n538522136\n91047068\n219698399\n739682214\n849217636\n624473484\n773245893\n520158841\n696793171\n774481100\n805446427\n548654735\n738430348\n490846017\n164302779\n565916032\n145660455\n131376432\n16679142\n592157485\n951613391\n455526515\n48015464\n335131597\n854611532\n878466602\n231186103\n539995112\n225034576\n230495879\n676818586\n69079937\n385314966\n118517264\n641007280\n631364795\n424489152\n241581744\n165874352\n416443452\n515875385\n926095950\n80625021\n588722331\n992134802\n392177680\n702938311\n976634024\n70510534\n452651215\n321876018\n52007147\n851354721\n35239080\n705197822\n90625975\n377935516\n498669007\n648793242\n139138249\n34326187\n833299514\n524052898\n719699753\n11444541\n222339191\n26316771\n717418336\n676762081\n59980262\n357124992\n130414006\n873570903\n907939016\n505325751\n859540006\n959466894\n305365329\n936635007\n762509553\n108731396\n87455802\n429541667\n614242889\n419423708\n6010309\n669707595\n606834652\n463235975\n771890864\n14119135\n870180189\n547879867\n600125754\n730324353\n337954040\n46770792\n683861983\n128948951\n227099048\n568338431\n849827382\n135056271\n515012\n65855290\n875764019\n112933989\n853476009\n121084357\n836466391\n62663462\n710898218\n260417439\n264207881\n693140805\n311804081\n631073881\n36968628\n708940007\n915407287\n677408695\n397107305\n596379680\n47084398\n866574504\n76674188\n965968937\n63536033\n550717266\n250554286\n997919869\n985034634\n525642109\n866669039\n518040293\n804482707\n383798231\n603459663\n574370681\n509025496\n764128458\n547863960\n332776805\n932328041\n596679762\n441207865\n119537158\n163787748\n499724603\n62842398\n777695696\n939166444\n358698272\n448339789\n519795821\n244870745\n963926757\n100355125\n893906174\n85455200\n726453391\n850688756\n372879787\n633281357\n630795761\n805056722\n86946328\n18037923\n161257048\n915922643\n749062399\n942584473\n30356986\n256222550\n420765029\n927272253\n375913086\n74330122\n578344734\n522037430\n57983789\n723432819\n476059040\n747683392\n33546521\n175646120\n87403636\n114078898\n768608749\n686187152\n553358688\n340873480\n721674998\n997132551\n991870303\n241710281\n533099477\n294214069\n141581696\n737859437\n278575655\n506666319\n768146272\n710174574\n983034613\n271027507\n139574276\n565793622\n28895452\n107636956\n666168132\n101138487\n174969419\n598991804\n644992113\n32459962\n679910637\n290669786\n554875798\n423524899\n67767109\n795451247\n63388941\n19121889\n52120794\n968323616\n777016560\n262345927\n257147212\n929173734\n914945775\n510711092\n822265606\n760754791\n35604926\n850229417\n449607575\n707026066\n753151825\n747186771\n276771962\n256769126\n224037046\n644878345\n913457427\n118366380\n813874732\n469256168\n21543199\n737984898\n594102448\n73964407\n874223670\n787188337\n775097626\n223076894\n539989217\n332861091\n201439196\n154322687\n334234254\n805353260\n775893200\n916291010\n497755627\n330001111\n171491797\n339561099\n139324001\n654388991\n845094864\n845617411\n245034025\n560690063\n152725219\n402876982\n930576904\n82607621\n111833372\n328371493\n699789482\n741356189\n66428043\n557701682\n673517053\n207885848\n774633088\n212425089\n903728923\n613253051\n169989391\n651523441\n928436255\n611941877\n607924450\n806505558\n815212863\n336903775\n574836120\n534820408\n507517748\n838824173\n35199883\n485122657\n608555374\n318639578\n698638662\n372489859\n522212402\n58158319\n361791242\n99182824\n311492310\n479202205\n887766379\n120619324\n610591341\n177398595\n830867323\n448408054\n667125669\n162077310\n817164188\n713664565\n657254874\n619866571\n654270394\n206222505\n736114698\n226422113\n135413901\n716235121\n910916626\n157893133\n213178060\n880914418\n776344102\n52149969\n897376648\n224749469\n733669831\n85215370\n429306682\n605429875\n682372833\n77512438\n22051158\n246608409\n897170774\n266496218\n144127705\n140250946\n846780664\n468474373\n973720303\n491725568\n707627134\n117883466\n80569935\n662891936\n79590910\n949579123\n270935178\n942188200\n960131256\n526975448\n446873722\n649411509\n940417123\n904023762\n480548603\n41841081\n434587799\n525237540\n509528797\n278786364\n900568828\n188627554\n370516520\n361654761\n952830311\n433464492\n973169614\n826230140\n820684672\n107284450\n829663318\n540048849\n335096108\n51244129\n705309297\n816702660\n753601830\n720486225\n699164976\n628314669\n907532778\n474522039\n330723936\n789497110\n923939791\n994895301\n897631559\n420975132\n517893493\n277794974\n63758854\n793798746\n207092045\n318087949\n17344647\n246785558\n933934143\n673148672\n665861102\n590239991\n936546438\n628317790\n753083645\n601285518\n895125078\n37318118\n726559943\n494024573\n692298523\n187956029\n821614087\n548093193\n244915955\n369383807\n5887599\n754804272\n602576089\n756527992\n862754491\n298225107\n835620672\n881049758\n696616055\n738272362\n130542595\n887282579\n431843679\n649452927\n489045809\n972977988\n900539245\n691426080\n764095837\n206506593\n422718193\n748748669\n112175290\n425632605\n132243492\n763874820\n786841168\n235195544\n561580715\n89527854\n101685052\n771152786\n494144071\n553217762\n119813845\n519098863\n61612101\n427446847\n766341508\n442277084\n703127935\n661773525\n609810056\n285630895\n765580634\n184782235\n373653277\n748425905\n982448050\n2597761\n710879381\n298211393\n605129474\n75984153\n899065154\n893086180\n336201564\n303290305\n67057578\n755265605\n766265239\n160424008\n154308658\n98448851\n67413754\n92160916\n51497726\n86354335\n805829807\n195284041\n783847665\n462998144\n",
"2\n3\n6\n\nSAMPLE\n",
"1000\n509869197\n704921863\n747550363\n299599178\n307311852\n292108723\n323673613\n406319034\n5990172\n892556229\n812345922\n189962849\n544886888\n836735222\n79035005\n635127190\n588939927\n354303480\n599514650\n49434020\n908869585\n113013398\n833715652\n721245910\n582288889\n239457458\n970221549\n670225566\n929342441\n809824450\n115643291\n730266943\n520547810\n791744213\n36294266\n905452335\n868254897\n608655708\n211856882\n943808469\n274704928\n668963267\n188719611\n770234879\n306170431\n435598799\n337245364\n873471509\n237424065\n361627523\n495041245\n806539431\n591420147\n444075500\n864334589\n85128422\n115455286\n717950562\n31949868\n696695367\n71269132\n110602139\n109874925\n418103696\n295405102\n684436871\n408060752\n7369767\n457089277\n543552634\n886764721\n318138861\n873022631\n76162320\n746034269\n234023671\n193264027\n986306939\n227531994\n254927272\n332767933\n783216337\n589686683\n20129690\n957846665\n784560157\n346045533\n394636469\n18711954\n397890417\n80144955\n523995210\n104524950\n695387045\n557137755\n578626779\n967400451\n293767934\n85841699\n425503730\n320628794\n771653629\n528781564\n944398056\n446475409\n604319639\n349989197\n103804260\n674555870\n487413991\n109912853\n469367145\n946153778\n37607638\n150071649\n108386352\n376364822\n17302346\n328928878\n684728362\n12182688\n182182752\n781299076\n224148348\n574951192\n675739278\n49599417\n979922124\n292128639\n451498045\n60996871\n263403279\n55096873\n240772068\n590035342\n437590569\n600669042\n917043768\n264457451\n592696501\n66533295\n533575812\n710041833\n106444046\n151186365\n516065348\n971320437\n604979586\n704300191\n36527287\n526868988\n11987922\n410621657\n453214575\n845945537\n464880406\n492555270\n620043126\n474146625\n463591779\n516341531\n170677184\n680745930\n297053715\n829775564\n72179944\n593137674\n245780738\n225793572\n102039769\n83526684\n964848498\n559670583\n405097815\n955798909\n934567197\n575469015\n788855851\n529330600\n582111513\n405782680\n728906722\n134149940\n947679064\n548898270\n890943212\n472172974\n859081547\n50984835\n849226113\n766946423\n871665261\n92068620\n647762501\n349730851\n56750332\n113170070\n171934669\n340459855\n5426784\n452337515\n344487419\n184122015\n14753972\n9371186\n528296285\n23861071\n601045142\n795705527\n42105607\n939896400\n742166889\n13864834\n891110576\n137576068\n194166478\n328319140\n967376251\n887038541\n625264307\n179706165\n752586887\n842208400\n931844617\n61707175\n464064365\n662256072\n130042897\n640084067\n940405660\n711365121\n872108992\n959920963\n494452064\n287205179\n661671831\n841218865\n126211628\n672455394\n544452218\n180591253\n802779154\n816954011\n328703380\n189750763\n920937367\n279666427\n305014727\n339034494\n878608361\n673149749\n683962241\n20888923\n478986401\n555715838\n302787877\n212684770\n180123969\n184684134\n872353417\n773004644\n760454192\n71501054\n713547906\n50954481\n339066435\n415440741\n636277004\n232123589\n470840558\n733098532\n73327672\n555649347\n539661060\n53073546\n240066118\n816939347\n82245532\n468654490\n499075655\n40875230\n381399211\n730932403\n174419568\n947580642\n249107136\n297989936\n178068962\n5919837\n710435891\n286925911\n262981849\n207670031\n442364056\n17382692\n886207873\n696612753\n682775648\n405173202\n868440798\n585610161\n225501140\n482102446\n239992985\n587793023\n612544555\n147198994\n658506455\n180351968\n76083446\n774786371\n286781410\n981837196\n473392818\n33646818\n152562966\n30278238\n80188554\n695472410\n51287443\n847095248\n460720360\n294138859\n84431013\n692811658\n222281386\n54788143\n701301672\n32542342\n478278843\n194302994\n120872492\n131909809\n243728160\n87853478\n25218664\n234499390\n598738679\n40074938\n815793456\n504995731\n400957387\n880198444\n627870959\n685645976\n254652024\n1642091\n828802860\n903812992\n26200720\n707529046\n616802097\n482359624\n60512557\n67859875\n793278209\n841457501\n989483226\n924296435\n900947481\n110197584\n752969988\n838535966\n486272135\n246091884\n12773460\n82644347\n167796061\n295448130\n407608460\n995632711\n406379547\n23032156\n347468846\n693937943\n824400565\n135788705\n573115008\n672862075\n937088844\n7117204\n507230230\n301476441\n603801\n203744593\n246424420\n99834931\n179649011\n146387022\n896594940\n178388775\n447417475\n635375712\n116494474\n565005288\n664267803\n728951102\n880044600\n189698498\n42519512\n660850567\n923136706\n736735001\n707532626\n883874937\n141663047\n164545827\n710243887\n494557\n869551745\n723039794\n312938806\n375044133\n502222580\n244152537\n423519363\n329110970\n243277539\n104200912\n544247680\n37888374\n927821720\n813966587\n658675733\n877923667\n50399559\n395523196\n96450894\n493101394\n415718379\n214475349\n2710384\n42442935\n960013382\n693350777\n693319831\n173210409\n100081785\n33556895\n350001938\n317942247\n509111007\n846924415\n530110003\n442248439\n428595200\n739357556\n42045337\n926938517\n209263068\n299249511\n79813297\n392270138\n902492497\n514381512\n588376196\n469611158\n752312975\n887924123\n269951672\n237884614\n659623618\n776641326\n398239030\n289928932\n195148275\n649512150\n691310543\n969749125\n320129979\n771100732\n619272500\n407137325\n667201347\n286513816\n779352132\n68502658\n66017628\n102307718\n498882013\n726914017\n2495350\n930237571\n614985051\n8038560\n605687580\n718653474\n960889984\n600918842\n27368847\n426694265\n2597709\n503101637\n779174234\n19150846\n538801093\n838897486\n912984061\n545534826\n989210953\n643171418\n496810162\n265052612\n651245420\n550704602\n37710438\n291638795\n15528298\n931662613\n943345828\n734644816\n291919096\n77192498\n294174292\n679953444\n217030808\n2636857\n806674660\n716730303\n850409692\n332005846\n652818230\n215118501\n74747813\n594735237\n119314528\n155721439\n220739001\n256114625\n754353201\n463876740\n10713757\n470566972\n784293337\n156569087\n582257048\n704305778\n337331776\n178314346\n189508844\n149972021\n227034790\n842741645\n97254957\n915182573\n988704011\n712931812\n433680858\n107761902\n618651907\n359861596\n879877214\n523925650\n935430044\n44953015\n758546195\n68566547\n346703824\n721115071\n176374050\n791208684\n625592958\n260892588\n807586176\n797290406\n554975783\n956489154\n798096670\n220952942\n349949945\n444095903\n414151583\n444234968\n249545978\n83672849\n835251192\n759262926\n584150002\n661316364\n161852297\n537241764\n46671334\n573562577\n959607090\n307252074\n80516104\n319445512\n211585878\n38398941\n564599288\n637464157\n857251237\n353735730\n1662401\n815765617\n37105658\n657615790\n243330842\n852580800\n314596003\n103362921\n699422245\n11654864\n48463005\n60114823\n32499258\n547262282\n957792894\n87734740\n383976525\n98175854\n567216696\n324180053\n121217746\n137755440\n268291808\n612225190\n867694967\n580943013\n448543416\n794671156\n630397613\n201446814\n282358413\n452066842\n90253602\n768817226\n101996577\n564502527\n11202037\n441541757\n81905288\n45140883\n621076384\n660244655\n476991950\n40328813\n142090693\n702637428\n7756957\n167753253\n930361494\n550275265\n57390647\n344429820\n363539262\n206480133\n771101200\n981525589\n324277490\n965745178\n390882034\n194948679\n235482052\n81953370\n291963864\n36512047\n625117721\n656615137\n605225047\n534795924\n889111387\n896944897\n410761360\n653719249\n326159305\n26767765\n61727319\n9528346\n22200751\n52043120\n455952925\n772237393\n395781104\n136143356\n884379651\n827552884\n222819190\n858112796\n594668541\n205258643\n923259013\n644865103\n690899133\n497632196\n402979941\n513525170\n80738091\n902897367\n669676881\n90624454\n352372069\n350544678\n56742612\n983420037\n306397734\n754009253\n332497418\n531638026\n708314649\n935529836\n367769739\n648050501\n895179557\n805463038\n827835812\n683022792\n263955116\n385499331\n129076312\n427075508\n967697876\n204526388\n146763690\n346094261\n66124325\n102467963\n690248668\n302685176\n988460123\n908873490\n385548513\n955678186\n53059376\n356298341\n914888765\n345640249\n25479222\n673117815\n940343730\n24895024\n444436624\n698198496\n771458258\n540148454\n654769923\n804968047\n744069250\n774591463\n512833721\n344456623\n459629870\n500530025\n714668070\n550198013\n113403703\n158024619\n275579615\n691829560\n896029476\n57666142\n679706991\n369862531\n107479873\n380461578\n358907514\n670102796\n13430691\n36920116\n686695050\n706569566\n877594686\n609279420\n750262458\n430235843\n396357046\n78582322\n30626143\n484976955\n100321727\n918778435\n147330889\n141589626\n284946500\n207275884\n467290148\n397803551\n767671740\n177166198\n219938231\n475571344\n786523895\n345239167\n726944996\n730063183\n597824557\n354424607\n842199905\n582165372\n310990886\n641703625\n449933335\n739623452\n215992115\n725192789\n138587405\n804934488\n534430550\n43237870\n849391598\n400769164\n11701763\n689210865\n40199331\n320274146\n46631847\n496097015\n16609225\n125837292\n262149990\n111517707\n672344552\n829014371\n370614855\n221274872\n318176521\n358490611\n460052429\n953124417\n874632960\n223674419\n992657297\n583816557\n352073550\n982690559\n930962870\n920183469\n493804623\n143082527\n753813483\n130254535\n340825453\n914485216\n212546927\n10880315\n122423624\n77594156\n395485577\n257284588\n90568512\n205251102\n589613646\n940080478\n688482181\n471205445\n423303400\n994388123\n756521721\n402970381\n707237663\n14495310\n750102473\n36335228\n239513249\n114804652\n874550572\n986462950\n702125224\n989078924\n926031075\n783367130\n622193574\n109504162\n836044676\n417350405\n726648927\n48998794\n36477144\n831599227\n657712927\n875912394\n252285187\n817498145\n884028930\n582339751\n94295085\n560737750\n954200628\n635158421\n113839337\n475983123\n264842600\n269057390\n594459982\n788071044\n223981233\n61216667\n810030997\n85207653\n299607063\n439835047\n668905149\n211930392\n386194805\n873585815\n804177587\n698097325\n11657121\n86396404\n951592297\n894095884\n919523743\n936304203\n497654026\n769876751\n522660296\n936558056\n469194103\n185320531\n830859561\n317952120\n675046518\n143800339\n726274112\n985030257\n452077870\n275601198\n54575034\n853254810\n550876425\n778055952\n758441875\n817131367\n162042018\n254586596\n216266231\n37293100\n306082417\n896927368\n116151457\n94885870\n313934203\n717908563\n326072682\n718378651\n636907117\n439401958\n625525494\n274508780\n667271118\n459155006\n902521585\n796359748\n93275939\n611820104\n501865506\n330873347\n153164133\n189769999\n451140592\n702639021\n34530508\n326742680\n241616795\n754976509\n556783474\n66676946\n239143329\n133106373\n27026478\n908045643\n149922093\n742282314\n806329169\n352514000\n588495348\n679102588\n594692132\n601752580\n155101524\n539245831\n723674471\n596924323\n256577298\n147467504\n290194284\n359952045\n252569910\n514774085\n389512253\n2263302\n177690489\n441762480\n644113095\n936802559\n637976143\n872265351\n440363022\n745742606\n774494564\n824832095\n739158694\n640351584\n348500358\n850690951\n409771152\n43678929\n819819263\n240353503\n997664335\n",
"1000\n509768355\n10070376\n749068153\n832388171\n32592846\n765808378\n864991989\n249148354\n990740862\n586548217\n165926576\n87268433\n575398171\n391276970\n390187090\n252443113\n531180553\n255113106\n101692537\n335661988\n824571068\n853948979\n687260346\n617564843\n416929764\n892482808\n932746595\n834478486\n11682472\n364987028\n123666951\n499354582\n286350392\n180168611\n141886001\n971153831\n306703604\n599799042\n327339290\n531422837\n239116780\n893801117\n467245848\n800737091\n501352109\n646531969\n788628584\n211525198\n18550188\n180960315\n356249467\n93463447\n822687186\n49411490\n530207875\n87183129\n141693850\n36639254\n54310930\n916329956\n152321042\n52325084\n899954579\n602362846\n467520178\n762046694\n126298544\n985768966\n130141784\n593303043\n877653874\n810955909\n450334475\n39132484\n362742020\n692135728\n953731531\n340979723\n5430039\n68335486\n403841478\n315379413\n385232909\n739385279\n577960782\n115405935\n449799498\n637708640\n25697130\n833626504\n370419114\n872035766\n876695221\n524356694\n383148191\n415655618\n952747456\n188404147\n910682365\n515635800\n987454369\n185035181\n123045625\n794146735\n613292234\n828538072\n748488370\n677909885\n230673047\n506997508\n685085081\n565107987\n242846249\n297960830\n688884427\n996206806\n465259617\n423503606\n857379298\n151669530\n839781142\n939108704\n742649512\n328471234\n228652822\n119718058\n702302988\n36178591\n108786250\n654999567\n369627461\n451625677\n265528028\n51627544\n913818041\n884238577\n604005813\n163579136\n288550006\n434955330\n52976336\n108128701\n134087979\n345009351\n366298551\n691597542\n143986604\n916250093\n603159835\n184516192\n990332097\n513273216\n934210734\n26846308\n27412100\n946743656\n7365176\n818637154\n54387776\n853493258\n617892080\n474351089\n959438353\n973160382\n464164136\n191623622\n540211288\n563337321\n902421258\n110163866\n393175342\n290774369\n519506045\n462669034\n40151845\n522176951\n609817002\n47984904\n175897090\n10489132\n197165664\n196030721\n448396543\n680564072\n742437376\n264972549\n305626586\n32614105\n123108384\n494549828\n137228493\n794924394\n798505165\n850981246\n200695696\n543220069\n739795700\n609093191\n122182715\n116700107\n164820639\n34041870\n349750989\n602113478\n778263276\n95452682\n689117706\n415055885\n610453153\n2356526\n951410030\n185121842\n786460825\n78317904\n674616338\n710603440\n748534527\n453670577\n67520196\n379260557\n500700397\n430626620\n314791364\n91827961\n459265168\n606530672\n649211416\n79325132\n216324378\n867086096\n291970124\n141723867\n393651340\n848421807\n926973590\n798734979\n211594070\n821694479\n899241530\n355566545\n707399048\n579409358\n87820182\n672516579\n779692286\n343020002\n291048253\n473319726\n805189588\n526928956\n665482685\n672636413\n646258677\n844764647\n738111226\n215426084\n8748140\n1084171\n834872235\n832583568\n228566718\n820051777\n853249014\n807850466\n944245142\n817029685\n807460071\n32231091\n335146807\n755858589\n349516505\n749204404\n974875081\n218339178\n724478757\n875269830\n397034054\n719637543\n320268491\n158492042\n689107028\n235590739\n406784726\n390424668\n97932898\n424435085\n687265095\n342993873\n851898157\n578833344\n351074892\n378114722\n363100595\n276254812\n154963664\n724103871\n17011762\n94438297\n27121960\n365327970\n204524431\n113872391\n445329254\n668245377\n8044256\n494516472\n369710428\n846052039\n900472100\n710403705\n539072036\n97669186\n287194795\n487147943\n80895044\n832031598\n334637743\n144341935\n884556083\n852265634\n105664562\n728396886\n509658289\n307674761\n96552978\n854439762\n345915639\n565895438\n947020737\n221814616\n6623114\n792994188\n362883848\n928355277\n398428271\n323018765\n930803160\n737808559\n570952749\n838997061\n439057439\n277645595\n700629655\n829758278\n136041555\n966506478\n508053032\n452311546\n55510069\n388518886\n486613309\n685236001\n599749367\n846838985\n94288000\n2951341\n797239947\n854395010\n386865002\n607072332\n162956441\n560333376\n600337751\n791486865\n799109951\n71297533\n794841526\n553226329\n263799414\n270486877\n643140461\n976515870\n232179903\n62922536\n770187642\n305354399\n752934497\n242038729\n610874079\n988796280\n116213248\n133407200\n994962353\n24574509\n145604540\n191613034\n7871359\n297411433\n45103636\n142549688\n827031812\n409484087\n307040995\n34782418\n472530536\n426175140\n867598429\n312816267\n463014807\n556591355\n985216574\n436024035\n834832095\n157950588\n385728018\n825135067\n388758164\n213191361\n897560545\n20539061\n602597894\n123004620\n104975700\n242498900\n548129715\n858741209\n418987597\n325647460\n368510851\n12114223\n385878917\n66327273\n218447712\n401126048\n567400217\n113650213\n6150895\n91956623\n119816342\n561065942\n27672631\n30520872\n301879712\n129024777\n147119210\n671964187\n878670757\n721839314\n611307909\n483338729\n336461123\n577634904\n683730275\n62816242\n131188024\n997589547\n82667487\n763613821\n695198269\n886250590\n60169952\n604664948\n711146626\n494830814\n210405488\n526937041\n801367280\n709907810\n794499359\n97392861\n499259007\n827505014\n772655520\n187694425\n74190359\n815540454\n547758411\n706298409\n615226281\n767423883\n306400893\n14006339\n328805237\n547273942\n153762507\n656707222\n5413995\n798683985\n708925332\n461860782\n133858590\n345926908\n548389741\n579643484\n82195983\n428980674\n568664353\n32631128\n261730312\n854827922\n427269818\n85982385\n435625905\n585912126\n5659594\n70207891\n15485021\n204306074\n738913586\n22692495\n288141133\n5477760\n515994920\n787637048\n726648822\n47234059\n441347057\n104549675\n317843893\n3558969\n272225508\n947024260\n281025677\n881996780\n787733053\n985817437\n797310248\n95364050\n760770882\n158562730\n84064010\n405751985\n6112077\n232638724\n184392502\n265861687\n571370836\n275850689\n952802984\n767275830\n113041402\n949991467\n113137251\n413441963\n609457283\n444638612\n945527158\n889036127\n986437497\n274336653\n921816283\n19222110\n736535134\n643335244\n748362684\n67376336\n108889184\n444431438\n611037394\n438664198\n317798829\n453072108\n953373728\n769835643\n831758147\n388101493\n707036326\n925591645\n840318068\n373289391\n868141064\n636044344\n616774263\n221457366\n444773305\n61828755\n359975778\n444546661\n193202928\n959416053\n598364282\n835648094\n194447672\n759379404\n187408321\n206220319\n53762002\n73527868\n772859865\n120249773\n255806178\n72155546\n537467901\n699872239\n777865668\n500918561\n802341681\n906796248\n980564211\n346266613\n815360742\n674822481\n880281554\n877217089\n912361362\n24154741\n887402125\n293569654\n255220806\n764322797\n519152246\n165723955\n36204720\n754840133\n412195689\n783779222\n312676650\n263955535\n746928877\n237314798\n672660701\n54467086\n393360194\n43194499\n706647648\n835531440\n174423761\n18052386\n404336689\n841552329\n435773775\n923679569\n916311441\n841139444\n145770301\n830074514\n801665300\n69375236\n699050552\n59577921\n598721939\n758725765\n939115890\n863424614\n823564133\n903357830\n818743941\n701673245\n982602452\n243244748\n198695169\n132617492\n961629292\n934662743\n33826990\n594521309\n671310293\n980479947\n77525205\n29722347\n120359332\n535873091\n665704340\n103024704\n664363840\n195561314\n942103902\n336430997\n864403449\n301878582\n316936647\n787860983\n988453300\n1103102\n359949325\n999951097\n118532684\n900171220\n155384619\n209159975\n68436513\n747414847\n169465413\n434959783\n127817907\n544995363\n512390900\n137511244\n252153150\n745835933\n195557806\n883144946\n403218779\n587095555\n420714341\n429746450\n554159703\n918630703\n166270225\n420526242\n208946431\n419982386\n658293234\n98617688\n757573566\n901460120\n343090449\n327567342\n423712920\n80352402\n508685872\n351035191\n710860022\n972844687\n807632985\n436525629\n882091645\n234645461\n699366549\n868668426\n909482890\n683412305\n368049166\n842509016\n334943015\n832597512\n462923526\n22431595\n198162127\n556811413\n743151499\n175432155\n786261175\n224671421\n569400735\n524101527\n389523716\n194921943\n933613740\n376198972\n584248830\n174834913\n58574134\n457316483\n67236582\n261914766\n453075233\n5895596\n889209851\n404345698\n992966592\n487170321\n309518457\n871296959\n196984214\n441367858\n454152082\n570240150\n599763910\n91263179\n143101129\n505166104\n116932744\n927267044\n81461643\n971830176\n582228371\n576718852\n113126060\n225354826\n524874108\n489390701\n327126891\n463503911\n187027695\n251490078\n545906844\n6170311\n418281335\n133500121\n202298173\n351859824\n331177551\n970953467\n879765737\n797815358\n142296865\n872802945\n885770792\n586139554\n533074703\n877837458\n601484910\n951339135\n141073217\n988691252\n852878712\n672248280\n565358287\n509058468\n963901449\n822487209\n983365345\n387189297\n615047463\n263900817\n620379678\n481221375\n257314437\n444757022\n788160381\n725468185\n324717050\n763495517\n854346588\n927423868\n776622744\n292835136\n795078662\n36900007\n141819307\n643324000\n913772189\n906700240\n160053982\n23345204\n520803061\n786780476\n362628740\n935722415\n663865118\n403475248\n248215331\n341808830\n55329499\n855549963\n825194663\n390388129\n483821932\n15202989\n552257771\n165114277\n319861029\n545825376\n430033869\n296747315\n768174285\n826601652\n622235915\n821129349\n784132435\n599772827\n93647565\n976578538\n931053566\n651414907\n251788957\n67295116\n891308291\n519992199\n43524724\n375579475\n702877206\n742738516\n31265228\n927369129\n4108004\n909922165\n623856282\n930446334\n828697505\n487498927\n537432198\n99811918\n147256933\n839191001\n403639732\n72118045\n907188601\n132390134\n874099487\n847528303\n149141164\n502110493\n507789975\n119176061\n182893997\n850291916\n500028261\n664551330\n844834684\n122126851\n177793866\n824832299\n742587322\n283243911\n656633612\n915734372\n879758989\n477497942\n954601776\n141705689\n88133694\n646745462\n81838141\n64084894\n978585725\n306107123\n519064883\n637993881\n170387910\n906981333\n589416739\n778148183\n161084645\n520216482\n665565451\n709297155\n475542782\n660869774\n245948748\n547666582\n517315826\n513267713\n841721813\n343711489\n821064614\n50518703\n250492757\n963801973\n150594084\n299016809\n256854297\n301118623\n74820203\n225201513\n888722391\n801540066\n112051045\n691834317\n182884148\n477855993\n529913992\n649762629\n606143802\n943925680\n890282785\n109794620\n629708761\n715716905\n998098682\n49764844\n819673839\n943695989\n531737215\n20996745\n143667108\n841448122\n38754146\n446466195\n242556161\n510515335\n827144994\n957346541\n968910677\n906332559\n629794136\n3130883\n81126240\n629679256\n219826370\n949910944\n759787204\n805755760\n305163532\n692516482\n910613068\n350961128\n613566821\n794167074\n955129807\n426388118\n152152381\n719510724\n129401425\n241894985\n342452318\n339917860\n692955194\n694111071\n793582987\n875797826\n474224458\n771731003\n474818962\n233045276\n929248438\n23012256\n219913326\n263896789\n759584862\n699961053\n123078919\n353718986\n513342220\n93960948\n239864492\n575694819\n288976385\n11172602\n",
"1000\n509482636\n650442077\n81304316\n120731521\n910093866\n214667702\n147523748\n235487185\n813836295\n823245516\n50232985\n304688818\n303932865\n129145263\n585934958\n241913385\n651701118\n974073720\n989154153\n42921231\n615703446\n551588863\n660195763\n9651519\n590498309\n983129770\n722847566\n584033877\n857087136\n536270097\n102637014\n590908951\n442338916\n594854719\n186868635\n873135945\n833147078\n902640920\n654539446\n78824762\n957831569\n530841685\n2209564\n67612150\n338538981\n140455951\n351719818\n125580356\n800085125\n281177782\n290941861\n832673029\n732137738\n750744677\n299343401\n303435107\n707648558\n477956634\n73903632\n852778252\n338204480\n960948585\n231438429\n692774680\n955179560\n55683002\n147520163\n968330317\n889640267\n48412829\n925581624\n671895121\n72265908\n37934608\n350489138\n916378066\n960905812\n660036258\n121947225\n867594531\n247302581\n33605109\n805947223\n375598519\n22949707\n754844737\n489575117\n72219169\n45488462\n606578143\n447056506\n426494910\n947005518\n113512516\n278069877\n595990061\n941208813\n531959483\n668591514\n383117881\n699331675\n282541108\n375138053\n726348600\n443853839\n286361816\n372171779\n618692776\n46746872\n488742323\n167256080\n16825831\n471367047\n991864567\n499692742\n320450798\n75042137\n98987771\n535107606\n685099827\n812944009\n652076463\n633142414\n236160627\n394957747\n975980373\n822016419\n867636176\n947230096\n799931455\n200317152\n269094589\n72179935\n947373824\n861180524\n614365509\n539718181\n72526333\n326834069\n630108078\n984586783\n588544933\n158090263\n378858316\n975783078\n801046641\n408991658\n213719990\n136143361\n530076273\n229735742\n786097909\n628143413\n176716833\n109911624\n448711342\n676423564\n665492351\n835092875\n600300167\n159812577\n261018663\n779045054\n995506240\n428265097\n633767369\n2361077\n820994907\n672049388\n163160317\n46297427\n170467376\n301986528\n983701429\n740785784\n69565803\n961330247\n557968135\n502437917\n568354209\n321912001\n863677208\n980847977\n27458254\n574970294\n996786592\n265400911\n62655772\n581652388\n279203386\n112619221\n651233754\n354634140\n68853742\n524235482\n847809167\n367751338\n131881114\n115838708\n74060581\n781845255\n20747986\n819033082\n118815098\n913027210\n123256429\n396549682\n961828147\n129335067\n67195939\n371924092\n396397248\n754257336\n207061105\n152466782\n354293617\n433747209\n429826932\n759337037\n829733572\n366420407\n592147687\n580034625\n6748049\n184001893\n936443392\n43907308\n801926636\n373585874\n763067324\n893254005\n9352685\n10446198\n61766373\n665908924\n39596925\n933054739\n718487393\n110146484\n894132295\n738387193\n558636159\n199402823\n288740028\n333687797\n210985049\n323296760\n308097824\n410134465\n500525806\n643759337\n640546567\n330612352\n61588462\n823242401\n145362813\n862583453\n925460508\n783782156\n361988388\n117648359\n630997660\n696502148\n971321060\n969837760\n455431004\n590245734\n826165259\n523325932\n593387846\n948550475\n516704831\n627305570\n127475054\n77632293\n243357909\n100592082\n20183986\n77303303\n595182727\n50344377\n822466742\n993763889\n2439111\n778124925\n563283666\n641673\n840259297\n385525201\n563873402\n174916397\n62238463\n803487193\n625159829\n216840653\n161089206\n596873209\n544987940\n387632539\n267777396\n556437294\n543396994\n772794301\n165799265\n95036103\n130125394\n672223726\n945775436\n121264585\n718074733\n617020812\n70239115\n540266789\n496142621\n783109267\n937644840\n554903608\n536540156\n346551333\n512586261\n480363697\n874705820\n300748799\n656026589\n450917039\n885963631\n886604753\n570136559\n213097393\n672627789\n294411329\n161963229\n47288461\n794390278\n204648361\n49280254\n472008070\n28119886\n957601083\n158934550\n536404403\n212434309\n265593236\n94760\n592614507\n835943784\n869142208\n489306156\n53662716\n759215493\n934427211\n163304180\n962331815\n211452335\n587037981\n807455543\n956129002\n39989307\n85368065\n848167900\n954525935\n14529642\n179636757\n940434051\n188532651\n922965446\n798948055\n497795115\n993675927\n524061791\n76068177\n518160288\n466851245\n256707998\n196658757\n266379360\n681966359\n481451088\n823133541\n315752807\n425318706\n505897713\n528183332\n272943647\n338788331\n36314107\n238920015\n527351636\n533918277\n377787560\n159456162\n67590105\n554221113\n950748566\n598410856\n825321085\n574582816\n926894787\n267389185\n119838545\n934231763\n25893298\n396945979\n32457245\n48053571\n182499719\n666112511\n520703760\n472215989\n582034645\n261345844\n628621407\n413523630\n834550912\n81462614\n988149773\n135271967\n916942844\n715711430\n906080357\n686002416\n950371803\n708606056\n745143764\n299691665\n68644627\n304606964\n721308921\n493831126\n942905861\n930054028\n677661504\n351100874\n460406783\n673204934\n611456529\n833711422\n650152300\n712893358\n787384487\n776823389\n517591997\n505519003\n812559083\n831979902\n820170491\n55378971\n332638447\n754428782\n941070380\n352799699\n302174920\n2522112\n25639085\n64967969\n994945501\n741342952\n843953791\n201860096\n785938046\n881905846\n259405322\n433426638\n336957436\n329232907\n499576464\n513650099\n6453955\n654508537\n706820839\n451385290\n520311013\n106864321\n565393569\n747655629\n921321200\n288296717\n472894401\n892299481\n999053360\n62652454\n171499349\n466487563\n941142978\n218566865\n256246872\n829544883\n490091671\n16524026\n693897713\n502642368\n502691099\n528616789\n322508278\n147886512\n890010799\n187880625\n701782699\n674712183\n967082935\n252243823\n329197177\n899062361\n846144229\n509329563\n432131593\n45972591\n714690851\n726174500\n458335013\n5801116\n655671911\n932294834\n831665940\n631474678\n330712866\n603443620\n659123393\n959294339\n345813318\n993670038\n779472781\n741862981\n994146606\n199216569\n98948924\n675302304\n147828347\n705527871\n549695997\n59051599\n135858893\n398377304\n466416403\n745156865\n874267585\n525267735\n662628749\n98657928\n872596053\n349116822\n474183164\n77702745\n73057253\n305684508\n858625526\n976574476\n862783532\n993220974\n674505081\n988190688\n675446739\n634767525\n986501213\n197727825\n54336053\n338572210\n344548341\n208038062\n185410132\n982396148\n277764487\n551363852\n380306953\n907608793\n604622504\n145273951\n516563459\n398750013\n642473038\n289651964\n628210620\n306264875\n668531687\n377605499\n601428002\n142370012\n102184560\n15157961\n2375955\n277953226\n576016571\n47307535\n321870769\n963787211\n49972783\n812633545\n729075316\n27129424\n697679198\n633551360\n873768888\n940505624\n598363835\n828135365\n629546542\n136785819\n151740830\n38120228\n175237191\n11372287\n801062447\n881546880\n668714701\n306038143\n152814250\n751737359\n803480606\n721355900\n283407172\n898690179\n33332289\n515628777\n76322581\n498961022\n907334640\n291900327\n116129328\n516059994\n881335759\n60983928\n607161471\n868019387\n738502652\n351671925\n675030125\n75186968\n946969934\n722356015\n912470808\n716130023\n498921960\n250819606\n14702175\n138819014\n963910850\n980489816\n95909855\n344180922\n120890457\n286363931\n407718584\n53390538\n272783361\n585441403\n891056501\n228737550\n396257914\n559954445\n880999155\n53035214\n157111387\n313662333\n443556767\n942827426\n966184403\n183002028\n518485286\n841029110\n231966630\n773410519\n785156963\n993533160\n272060469\n527601214\n433608429\n244835119\n158256795\n30277986\n514662004\n653250533\n245287854\n177439359\n515987864\n462143076\n583406554\n51087703\n223741162\n966923258\n70423544\n138093925\n307854489\n822274194\n905093307\n276522235\n147670951\n207656946\n429348241\n510815761\n788341255\n470450216\n969458892\n530247469\n605155854\n371869180\n827878684\n610476269\n745254551\n14205127\n374867866\n834670398\n735276396\n962562148\n580787999\n783802992\n505275260\n804033996\n77859622\n769109125\n712975776\n25100166\n951678344\n399707946\n562583800\n122895686\n214701829\n514192457\n351508685\n872035319\n869182492\n959455564\n908038246\n379988127\n637163732\n457362969\n848526784\n543838382\n601267836\n597943704\n209444589\n409493084\n812640987\n854153010\n968925709\n158975376\n222566978\n559765593\n1930871\n826069833\n66984790\n325013916\n103567665\n199974772\n957164870\n269953607\n624793572\n503610195\n943477732\n10975470\n928597482\n967296639\n696483297\n654492303\n640879781\n635972749\n560960738\n406992650\n383132269\n941150791\n349879956\n622178200\n851113351\n273500784\n112655295\n110045832\n556861551\n438337225\n264814552\n945138294\n795849820\n319754411\n901380297\n942085155\n21350168\n995583948\n734303446\n642577034\n96932869\n358108044\n118312388\n53914821\n494473154\n641664809\n945036463\n231859843\n126125050\n803531402\n220696852\n547716389\n354422068\n445139519\n774336519\n316053427\n975967972\n406689032\n575191844\n425410148\n688375987\n833886534\n445776030\n380371248\n988214851\n81554273\n381178939\n323788186\n977560025\n601423812\n717561276\n931671014\n84541428\n839781730\n948991220\n334371465\n963974890\n702422676\n693387387\n161140461\n310832354\n479127361\n422959498\n509394510\n523695815\n13173073\n209005464\n619053790\n671858236\n452339720\n381546854\n271788430\n250409035\n704169959\n995201717\n752597970\n28480374\n573871958\n716922623\n935248278\n78075360\n686242844\n341890492\n634726506\n90191100\n304538559\n719109726\n832278987\n551924785\n11069509\n800336122\n559104480\n273635509\n229494723\n30258863\n400165523\n810629491\n406678083\n391172001\n980360534\n424938341\n201166686\n869214418\n702939619\n791713800\n318239202\n57582758\n425755743\n54340211\n408455716\n203078774\n793422729\n329825267\n511048976\n58631053\n864580632\n925405836\n12393485\n577564277\n289798513\n943776016\n729267364\n107396506\n919892276\n687787393\n531321771\n687984165\n897888901\n451154832\n941970701\n245205437\n939740487\n623608158\n55193553\n511285408\n884860023\n311230500\n373928829\n84661068\n57474969\n200338474\n627453443\n465292918\n983193513\n439788747\n38224682\n930795562\n255721560\n797464467\n539839136\n105417004\n655753094\n149253868\n41939194\n290476756\n605587875\n983491406\n151509097\n290867358\n934888528\n681111831\n4300881\n417929803\n520269105\n756903985\n385230488\n53082938\n397917462\n534690270\n467772029\n699939157\n109460260\n891279989\n44320485\n510645307\n71004524\n165206557\n77714755\n68005543\n94036631\n511868666\n950259001\n167130262\n49686352\n854846215\n527816489\n549864287\n946921762\n60212844\n118647005\n674080620\n296725602\n403243894\n654815947\n785397188\n381640028\n837763841\n39681729\n210871920\n569421304\n869804710\n679655255\n293431806\n878989344\n426976309\n93556510\n446217160\n558895990\n271415146\n419075788\n807873590\n185406570\n129433387\n133467725\n657818608\n711513094\n211607549\n48236025\n894616670\n82439450\n19059469\n943607721\n841313173\n918149957\n676306791\n850372187\n701659318\n955435143\n263202969\n629066584\n660066301\n981267339\n278837034\n604695878\n230987129\n343322748\n84332974\n631262639\n855036907\n437809646\n987728894\n710913342\n868993920\n",
"1000\n509331373\n255648483\n362355555\n993656827\n203048091\n277733548\n385759492\n999731172\n569736870\n85458944\n228087606\n3163561\n275957973\n608441525\n552663082\n741629093\n565062057\n825288159\n21195534\n898521370\n136739300\n162992224\n14254617\n206646289\n416201438\n536409601\n92893315\n830413257\n259371740\n16497597\n835897957\n892024046\n664784609\n824974956\n992739874\n971688189\n343336509\n168130468\n827763058\n607729954\n478191160\n868098460\n919998923\n539623655\n631311498\n883113893\n28794641\n206402713\n824290680\n436435157\n509012381\n189317240\n431554660\n879974115\n798153337\n380258984\n894490037\n308506046\n828670678\n829713765\n33524158\n799791186\n990299723\n969163405\n65868534\n98355920\n298618671\n214703652\n751735398\n770522079\n838173537\n837378873\n11975494\n556131674\n849292588\n529804328\n954123428\n692045441\n436277929\n13965032\n427654715\n758107917\n499266562\n954481899\n274416597\n472338857\n145206061\n936827429\n55966226\n612698637\n234984108\n948555744\n605260914\n783225180\n738310984\n425275136\n566712950\n447655619\n905852506\n944574173\n52086394\n828871630\n119050515\n574713435\n620337260\n122689462\n43662348\n979851210\n454664461\n591859415\n30014415\n586695281\n490147577\n956136168\n160428269\n225923285\n134642513\n282031474\n606557783\n311769766\n54341676\n639981751\n575168068\n818903143\n875510199\n141948543\n22297211\n525762700\n745958329\n105183731\n237004850\n551428186\n77273065\n663657038\n846854569\n710595701\n618465154\n516071212\n715489272\n467238138\n316767708\n302890637\n146675856\n662964457\n298451350\n343119479\n815474552\n440143504\n558174647\n825801447\n851188589\n538025843\n339785205\n610906256\n382111479\n171506210\n374896610\n963383393\n705454605\n111410562\n664654771\n790271337\n697083685\n362182597\n27331588\n386674699\n349229685\n223587958\n539507277\n822830099\n658254047\n233098006\n667997908\n143800067\n367315195\n598464074\n365368591\n94145351\n398545839\n358404274\n8986477\n711846843\n378476058\n200527586\n865278953\n131572414\n15581329\n675470990\n42354075\n820930782\n594300520\n462380637\n635514400\n299940043\n948166386\n503771949\n160206143\n787618897\n214681185\n167228749\n350569941\n481337853\n67476536\n999854357\n492623518\n973991035\n746950998\n609102445\n130231060\n507572321\n962936357\n634571501\n839409499\n135355737\n531769000\n407723607\n137812099\n659268428\n456317710\n460727947\n421653568\n35465470\n215167258\n746723079\n280338879\n76401029\n24340324\n504624539\n811688164\n226829791\n337903326\n987516828\n87299954\n518979171\n551819717\n245191647\n62359363\n687969846\n450325688\n684545602\n881115249\n649839652\n900669356\n730718010\n866083711\n417850825\n340369499\n486813506\n109367099\n473006702\n632258741\n623557825\n416150609\n36514011\n96835476\n514320127\n556678508\n656900811\n111580664\n376075431\n448475110\n646652221\n16607707\n539033080\n88548288\n24892239\n752016542\n993838213\n104118939\n520914889\n873177438\n383036289\n682402351\n219234051\n732223739\n48679837\n118217779\n50013812\n354724308\n436823678\n596433887\n603754034\n433800557\n178963128\n356169683\n900017406\n510812595\n735130293\n654492674\n440211398\n344881685\n161195956\n36633032\n949737783\n144437557\n344191390\n651213546\n14998284\n820555683\n86849974\n984808706\n23437500\n717634513\n808177853\n4187510\n305599640\n579732690\n227093805\n480219330\n595813298\n910932946\n639087153\n572045011\n869291679\n853981606\n235622328\n937701049\n706512044\n703918659\n66569904\n794475862\n849962422\n50286124\n990892211\n982787213\n407943001\n175812357\n88252654\n937331349\n935415085\n586633329\n448920320\n893749523\n747589130\n596768734\n143464035\n368980085\n662982893\n253917789\n546256328\n437496965\n27466621\n69981869\n950409375\n546982433\n903725458\n555016796\n645794638\n281208342\n450176368\n529311789\n265955036\n785900059\n243458337\n847905618\n48223428\n889802671\n984840623\n205479106\n333613360\n107406030\n725574731\n322339438\n250772506\n370576115\n363267919\n940985633\n75940510\n519944666\n392121233\n547329809\n299622949\n706831049\n977372173\n384775122\n635293751\n886459594\n632320306\n303893360\n819572148\n588962772\n945163175\n420928560\n735157896\n325320068\n954097035\n248458290\n130253449\n676960464\n99236056\n58678894\n521160679\n709202674\n828180482\n33440541\n541923907\n430037436\n2310471\n177363645\n243462673\n920780770\n795224302\n544091620\n355567828\n374575016\n207707742\n76172826\n922608611\n96589511\n29741072\n80682994\n769978315\n82162797\n871223579\n111170194\n919757089\n770086911\n114239535\n759659968\n607880175\n855471860\n305613769\n462811380\n285077420\n260164677\n311004241\n73064883\n788309331\n81387181\n513443569\n649849951\n719377236\n240256036\n713923886\n927599407\n579423063\n318160117\n82788583\n5778052\n61131483\n378343516\n120377839\n260727793\n185360258\n144163830\n599920188\n422860245\n988732986\n406818410\n956551656\n494180364\n15710573\n54578657\n914146571\n756487573\n976528585\n91493495\n132862407\n782948403\n27099826\n200225612\n84969229\n1189742\n668624165\n931883238\n356422909\n861019494\n55417946\n548982458\n951503508\n401819168\n686153595\n989366196\n311760645\n48528662\n163612015\n841147359\n71893926\n81000442\n17263323\n820552957\n686646686\n41199451\n388130624\n403544816\n417444700\n957077572\n950219768\n655224871\n861344502\n429763881\n54026293\n427403191\n32615116\n553907821\n187120996\n26503751\n712507542\n538522136\n91047068\n219698399\n739682214\n849217636\n624473484\n773245893\n520158841\n696793171\n774481100\n805446427\n548654735\n738430348\n490846017\n164302779\n565916032\n145660455\n131376432\n16679142\n592157485\n951613391\n455526515\n48015464\n335131597\n854611532\n878466602\n231186103\n539995112\n225034576\n230495879\n676818586\n69079937\n385314966\n118517264\n641007280\n631364795\n424489152\n241581744\n165874352\n416443452\n515875385\n926095950\n80625021\n588722331\n992134802\n392177680\n702938311\n976634024\n70510534\n452651215\n321876018\n52007147\n851354721\n35239080\n705197822\n90625975\n377935516\n498669007\n648793242\n139138249\n34326187\n833299514\n524052898\n719699753\n11444541\n222339191\n26316771\n717418336\n676762081\n59980262\n357124992\n130414006\n873570903\n907939016\n505325751\n859540006\n959466894\n305365329\n936635007\n762509553\n108731396\n87455802\n429541667\n614242889\n419423708\n6010309\n669707595\n606834652\n463235975\n771890864\n14119135\n870180189\n547879867\n600125754\n730324353\n337954040\n46770792\n683861983\n128948951\n227099048\n568338431\n849827382\n135056271\n515012\n65855290\n875764019\n112933989\n853476009\n121084357\n836466391\n62663462\n710898218\n260417439\n264207881\n693140805\n311804081\n631073881\n36968628\n708940007\n915407287\n677408695\n397107305\n596379680\n47084398\n866574504\n76674188\n965968937\n63536033\n550717266\n250554286\n997919869\n985034634\n525642109\n866669039\n518040293\n804482707\n383798231\n603459663\n574370681\n509025496\n764128458\n547863960\n332776805\n932328041\n596679762\n441207865\n119537158\n163787748\n499724603\n62842398\n777695696\n939166444\n358698272\n448339789\n519795821\n244870745\n963926757\n100355125\n893906174\n85455200\n726453391\n850688756\n372879787\n633281357\n630795761\n805056722\n86946328\n18037923\n161257048\n915922643\n749062399\n942584473\n30356986\n256222550\n420765029\n927272253\n375913086\n74330122\n578344734\n522037430\n57983789\n723432819\n476059040\n747683392\n33546521\n175646120\n87403636\n114078898\n768608749\n686187152\n553358688\n340873480\n721674998\n997132551\n991870303\n241710281\n533099477\n294214069\n141581696\n737859437\n278575655\n506666319\n768146272\n710174574\n983034613\n271027507\n139574276\n565793622\n28895452\n107636956\n666168132\n101138487\n174969419\n598991804\n644992113\n32459962\n679910637\n290669786\n554875798\n423524899\n67767109\n795451247\n63388941\n19121889\n52120794\n968323616\n777016560\n262345927\n257147212\n929173734\n914945775\n510711092\n822265606\n760754791\n35604926\n850229417\n449607575\n707026066\n753151825\n747186771\n276771962\n256769126\n224037046\n644878345\n913457427\n118366380\n813874732\n469256168\n7994545\n737984898\n594102448\n73964407\n874223670\n787188337\n775097626\n223076894\n539989217\n332861091\n201439196\n154322687\n334234254\n805353260\n775893200\n916291010\n497755627\n330001111\n171491797\n339561099\n139324001\n654388991\n845094864\n845617411\n245034025\n560690063\n152725219\n402876982\n930576904\n82607621\n111833372\n328371493\n699789482\n741356189\n66428043\n557701682\n673517053\n207885848\n774633088\n212425089\n903728923\n613253051\n169989391\n651523441\n928436255\n611941877\n607924450\n806505558\n815212863\n336903775\n574836120\n534820408\n507517748\n838824173\n35199883\n485122657\n608555374\n318639578\n698638662\n372489859\n522212402\n58158319\n361791242\n99182824\n311492310\n479202205\n887766379\n120619324\n610591341\n177398595\n830867323\n448408054\n667125669\n162077310\n817164188\n713664565\n657254874\n619866571\n654270394\n206222505\n736114698\n226422113\n135413901\n716235121\n910916626\n157893133\n213178060\n880914418\n776344102\n52149969\n897376648\n224749469\n733669831\n85215370\n429306682\n605429875\n682372833\n77512438\n22051158\n246608409\n897170774\n266496218\n144127705\n140250946\n846780664\n468474373\n973720303\n491725568\n707627134\n117883466\n80569935\n662891936\n79590910\n949579123\n270935178\n942188200\n960131256\n526975448\n446873722\n649411509\n940417123\n904023762\n480548603\n41841081\n434587799\n525237540\n509528797\n278786364\n900568828\n188627554\n370516520\n361654761\n952830311\n433464492\n973169614\n826230140\n820684672\n107284450\n829663318\n540048849\n335096108\n51244129\n705309297\n816702660\n753601830\n720486225\n699164976\n628314669\n907532778\n474522039\n330723936\n789497110\n923939791\n994895301\n897631559\n420975132\n517893493\n277794974\n63758854\n793798746\n207092045\n318087949\n17344647\n246785558\n933934143\n673148672\n665861102\n590239991\n936546438\n628317790\n753083645\n601285518\n895125078\n37318118\n726559943\n494024573\n692298523\n187956029\n821614087\n548093193\n244915955\n369383807\n5887599\n754804272\n602576089\n756527992\n862754491\n298225107\n835620672\n881049758\n696616055\n738272362\n130542595\n887282579\n431843679\n649452927\n489045809\n972977988\n900539245\n691426080\n764095837\n206506593\n422718193\n748748669\n112175290\n425632605\n132243492\n763874820\n786841168\n235195544\n561580715\n89527854\n101685052\n771152786\n494144071\n553217762\n119813845\n519098863\n61612101\n427446847\n766341508\n442277084\n703127935\n661773525\n609810056\n285630895\n765580634\n184782235\n373653277\n748425905\n982448050\n2597761\n710879381\n298211393\n605129474\n75984153\n899065154\n893086180\n336201564\n303290305\n67057578\n755265605\n766265239\n160424008\n154308658\n98448851\n67413754\n92160916\n51497726\n86354335\n805829807\n195284041\n783847665\n462998144\n",
"2\n2\n6\n\nSAMPLE\n"
] |
[
"Rohit\nYuvraj\nRaina\nDhawan\nKohli\nDhawan\nKohli\nDhoni\nRaina\nSir Jadeja\nDhoni\nRaina\nDhawan\nDhoni\nKohli\nKohli\nDhawan\nYuvraj\nDhawan\nRaina\nSir Jadeja\nSir Jadeja\nDhoni\nYuvraj\nDhawan\nRohit\nRohit\nKohli\nSir Jadeja\nDhoni\nSir Jadeja\nYuvraj\nRohit\nRaina\nDhawan\nSir Jadeja\nDhoni\nKohli\nDhoni\nRohit\nDhawan\nKohli\nRaina\nRaina\nKohli\nDhoni\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nRohit\nDhoni\nDhawan\nSir Jadeja\nDhoni\nYuvraj\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nDhawan\nSir Jadeja\nSir Jadeja\nDhoni\nDhawan\nYuvraj\nDhoni\nRohit\nSir Jadeja\nDhawan\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nRaina\nSir Jadeja\nRaina\nRohit\nSir Jadeja\nRohit\nKohli\nRaina\nDhawan\nKohli\nRohit\nRaina\nYuvraj\nRaina\nDhawan\nRaina\nKohli\nRohit\nDhoni\nYuvraj\nDhawan\nDhawan\nRohit\nDhawan\nYuvraj\nDhoni\nKohli\nRaina\nRohit\nRohit\nSir Jadeja\nKohli\nYuvraj\nDhoni\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nDhawan\nDhoni\nRaina\nDhawan\nKohli\nYuvraj\nRaina\nYuvraj\nRaina\nSir Jadeja\nDhawan\nYuvraj\nRaina\nRohit\nDhawan\nSir Jadeja\nRohit\nRohit\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nDhawan\nRohit\nRohit\nYuvraj\nDhoni\nKohli\nRohit\nRohit\nKohli\nYuvraj\nDhawan\nRohit\nRaina\nDhoni\nSir Jadeja\nDhoni\nSir Jadeja\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nYuvraj\nYuvraj\nDhawan\nDhoni\nDhawan\nDhawan\nRohit\nSir Jadeja\nDhoni\nKohli\nRohit\nDhawan\nDhoni\nRohit\nSir Jadeja\nDhawan\nRaina\nRohit\nDhawan\nDhoni\nYuvraj\nRohit\nRohit\nDhawan\nSir Jadeja\nRohit\nDhoni\nDhoni\nDhoni\nRaina\nDhoni\nYuvraj\nKohli\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nYuvraj\nYuvraj\nSir Jadeja\nYuvraj\nYuvraj\nRohit\nDhawan\nRohit\nRaina\nDhawan\nRaina\nYuvraj\nRohit\nRaina\nSir Jadeja\nSir Jadeja\nDhawan\nRaina\nKohli\nRohit\nSir Jadeja\nKohli\nYuvraj\nRaina\nDhoni\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nRohit\nKohli\nRohit\nYuvraj\nDhoni\nRohit\nRohit\nDhawan\nKohli\nDhoni\nRohit\nYuvraj\nDhawan\nYuvraj\nRaina\nDhoni\nKohli\nRaina\nSir Jadeja\nDhawan\nKohli\nYuvraj\nSir Jadeja\nYuvraj\nYuvraj\nKohli\nRohit\nDhawan\nKohli\nDhoni\nYuvraj\nRaina\nDhoni\nRaina\nRaina\nDhawan\nYuvraj\nDhoni\nYuvraj\nDhoni\nKohli\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhawan\nDhawan\nDhoni\nRohit\nDhoni\nKohli\nSir Jadeja\nRohit\nKohli\nRaina\nYuvraj\nYuvraj\nRohit\nRohit\nDhawan\nYuvraj\nRaina\nYuvraj\nDhawan\nRohit\nDhoni\nSir Jadeja\nDhawan\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nDhoni\nDhawan\nSir Jadeja\nRohit\nRohit\nDhawan\nKohli\nDhawan\nKohli\nYuvraj\nKohli\nRaina\nDhawan\nRohit\nRohit\nDhawan\nKohli\nRohit\nKohli\nYuvraj\nDhoni\nDhoni\nSir Jadeja\nDhawan\nYuvraj\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nRohit\nRohit\nRaina\nRohit\nRohit\nRohit\nYuvraj\nDhoni\nSir Jadeja\nDhawan\nKohli\nDhoni\nRohit\nRaina\nSir Jadeja\nKohli\nYuvraj\nRohit\nDhoni\nDhoni\nSir Jadeja\nDhoni\nYuvraj\nKohli\nRohit\nRohit\nDhawan\nRaina\nDhoni\nRohit\nSir Jadeja\nSir Jadeja\nSir Jadeja\nRaina\nDhoni\nRohit\nRohit\nDhoni\nKohli\nYuvraj\nDhawan\nDhoni\nRohit\nDhoni\nYuvraj\nYuvraj\nYuvraj\nDhoni\nDhawan\nDhawan\nYuvraj\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nKohli\nDhoni\nRohit\nRaina\nYuvraj\nDhawan\nSir Jadeja\nYuvraj\nDhawan\nKohli\nSir Jadeja\nDhawan\nKohli\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nKohli\nSir Jadeja\nYuvraj\nYuvraj\nSir Jadeja\nDhawan\nKohli\nYuvraj\nRohit\nDhoni\nYuvraj\nKohli\nRaina\nRohit\nRohit\nDhoni\nKohli\nRohit\nDhoni\nDhawan\nKohli\nSir Jadeja\nDhoni\nKohli\nSir Jadeja\nDhoni\nRaina\nRaina\nRohit\nDhoni\nDhoni\nYuvraj\nYuvraj\nRohit\nYuvraj\nYuvraj\nYuvraj\nRaina\nDhawan\nYuvraj\nKohli\nRohit\nDhoni\nRohit\nSir Jadeja\nDhoni\nRaina\nYuvraj\nSir Jadeja\nDhoni\nDhawan\nKohli\nRaina\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nRaina\nSir Jadeja\nDhawan\nRohit\nKohli\nRaina\nRaina\nDhawan\nRaina\nKohli\nYuvraj\nRohit\nKohli\nRaina\nKohli\nDhoni\nKohli\nDhawan\nRaina\nDhawan\nRohit\nDhoni\nRohit\nYuvraj\nKohli\nSir Jadeja\nKohli\nRohit\nKohli\nYuvraj\nRohit\nDhawan\nSir Jadeja\nDhoni\nKohli\nRohit\nRaina\nKohli\nDhawan\nDhoni\nSir Jadeja\nDhawan\nRohit\nKohli\nRohit\nRohit\nKohli\nDhawan\nDhawan\nDhawan\nRohit\nSir Jadeja\nRohit\nYuvraj\nDhawan\nKohli\nDhawan\nYuvraj\nDhoni\nYuvraj\nDhoni\nYuvraj\nDhoni\nKohli\nKohli\nDhoni\nDhawan\nDhawan\nRohit\nKohli\nSir Jadeja\nRohit\nRaina\nSir Jadeja\nYuvraj\nRohit\nRaina\nKohli\nDhawan\nYuvraj\nYuvraj\nYuvraj\nRaina\nDhawan\nSir Jadeja\nDhoni\nRaina\nSir Jadeja\nRohit\nYuvraj\nDhoni\nDhoni\nKohli\nYuvraj\nSir Jadeja\nRohit\nSir Jadeja\nYuvraj\nRaina\nDhawan\nYuvraj\nYuvraj\nYuvraj\nRaina\nKohli\nRohit\nDhoni\nRaina\nDhawan\nRohit\nRaina\nSir Jadeja\nYuvraj\nSir Jadeja\nDhoni\nSir Jadeja\nRohit\nKohli\nDhoni\nRaina\nDhawan\nKohli\nKohli\nDhawan\nRaina\nDhawan\nRohit\nKohli\nKohli\nKohli\nDhoni\nKohli\nDhawan\nKohli\nDhoni\nYuvraj\nDhoni\nDhoni\nDhawan\nKohli\nRohit\nDhoni\nKohli\nDhoni\nYuvraj\nRaina\nRaina\nRohit\nRohit\nDhawan\nRohit\nYuvraj\nRaina\nRaina\nDhawan\nKohli\nRohit\nDhawan\nRohit\nKohli\nDhoni\nDhawan\nSir Jadeja\nRaina\nKohli\nDhoni\nDhawan\nSir Jadeja\nYuvraj\nRaina\nDhoni\nDhawan\nYuvraj\nSir Jadeja\nKohli\nYuvraj\nKohli\nKohli\nRohit\nKohli\nDhawan\nYuvraj\nRohit\nKohli\nSir Jadeja\nDhawan\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nRaina\nRohit\nKohli\nRohit\nRaina\nRaina\nRohit\nKohli\nDhawan\nDhawan\nKohli\nKohli\nKohli\nRohit\nSir Jadeja\nSir Jadeja\nDhoni\nKohli\nKohli\nDhoni\nRohit\nKohli\nYuvraj\nDhoni\nSir Jadeja\nRaina\nRaina\nDhawan\nSir Jadeja\nDhoni\nSir Jadeja\nDhoni\nDhawan\nDhoni\nSir Jadeja\nKohli\nYuvraj\nRohit\nDhoni\nRohit\nKohli\nSir Jadeja\nKohli\nYuvraj\nYuvraj\nYuvraj\nSir Jadeja\nRohit\nKohli\nRaina\nKohli\nRohit\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nSir Jadeja\nDhoni\nDhoni\nYuvraj\nRohit\nRaina\nRohit\nDhoni\nRohit\nDhoni\nDhawan\nYuvraj\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nSir Jadeja\nRaina\nRohit\nDhoni\nYuvraj\nSir Jadeja\nYuvraj\nDhoni\nYuvraj\nRohit\nRaina\nSir Jadeja\nYuvraj\nRaina\nDhawan\nKohli\nRaina\nRaina\nRaina\nRohit\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nDhawan\nSir Jadeja\nKohli\nDhawan\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nRaina\nDhoni\nRaina\nYuvraj\nKohli\nDhoni\nDhawan\nYuvraj\nYuvraj\nSir Jadeja\nKohli\nRaina\nDhoni\nRaina\nKohli\nRohit\nRohit\nRaina\nSir Jadeja\nDhawan\nDhawan\nDhawan\nDhoni\nSir Jadeja\nRaina\nRaina\nYuvraj\nSir Jadeja\nRohit\nRaina\nYuvraj\nYuvraj\nYuvraj\nDhawan\nYuvraj\nDhoni\nDhawan\nKohli\nKohli\nSir Jadeja\nRaina\nDhoni\nYuvraj\nDhawan\nRaina\nRohit\nYuvraj\nDhoni\nRaina\nRaina\nYuvraj\nKohli\nKohli\nRaina\nRohit\nRohit\nRohit\nRohit\nSir Jadeja\nYuvraj\nDhoni\nRaina\nSir Jadeja\nKohli\nYuvraj\nSir Jadeja\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nRaina\nRohit\nYuvraj\nSir Jadeja\nDhoni\nYuvraj\nRohit\nKohli\nRaina\nRohit\nYuvraj\nDhoni\nDhawan\nRohit\nYuvraj\nRohit\nDhoni\nRohit\nRaina\nDhoni\nYuvraj\nSir Jadeja\nRaina\nDhawan\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nYuvraj\nRohit\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nDhoni\nDhoni\nYuvraj\nRaina\nDhawan\nDhoni\nKohli\nSir Jadeja\nRohit\nDhoni\nSir Jadeja\nDhawan\nRaina\nDhawan\nRohit\nKohli\nSir Jadeja\nRohit\nRohit\nDhawan\nDhawan\nRaina\nSir Jadeja\nRohit\nDhoni\nYuvraj\nDhawan\nSir Jadeja\nKohli\nDhoni\nRaina\nSir Jadeja\nRaina\nYuvraj\nRaina\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nSir Jadeja\nRohit\nRaina\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nDhoni\nKohli\nYuvraj\nDhawan\nYuvraj\nRohit\nSir Jadeja\nDhawan\nSir Jadeja\nDhoni\nDhawan\nRaina\nRaina\nDhoni\nKohli\nRohit\nDhoni\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nRaina\nKohli\nYuvraj\nKohli\nYuvraj\nKohli\nSir Jadeja\nKohli\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nRaina\nRaina\nKohli\nRohit\nKohli\nKohli\nRaina\nSir Jadeja\nYuvraj\nDhawan\nKohli\nRohit\nRaina\nDhawan\nRohit\nRohit\nRohit\nDhoni\nSir Jadeja\nDhawan\nRaina\nDhoni\nYuvraj\nDhawan\nYuvraj\nDhawan\nDhawan\nKohli\nDhawan\nYuvraj\nDhawan\nRohit\nDhawan\nDhawan\nYuvraj\nRohit\nRohit\nRaina\nDhawan\nYuvraj\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nDhoni\nSir Jadeja\nRaina\nRaina\nDhoni\nRaina\nKohli\nYuvraj\nDhoni\nDhoni\nYuvraj\nDhoni\nRohit\nRohit\n",
"Rohit\nKohli\nRaina\nDhoni\nRohit\nRaina\nDhoni\nRohit\nRohit\nDhawan\nKohli\nYuvraj\nDhawan\nRaina\nRaina\nRohit\nRohit\nRohit\nDhoni\nYuvraj\nDhoni\nDhoni\nYuvraj\nKohli\nDhoni\nSir Jadeja\nSir Jadeja\nDhoni\nRaina\nYuvraj\nRohit\nRohit\nDhawan\nYuvraj\nDhawan\nRohit\nKohli\nDhawan\nKohli\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nRohit\nKohli\nRaina\nDhoni\nDhawan\nYuvraj\nYuvraj\nRaina\nDhoni\nRaina\nRohit\nYuvraj\nDhawan\nDhawan\nDhoni\nSir Jadeja\nKohli\nDhoni\nSir Jadeja\nDhawan\nSir Jadeja\nRaina\nRohit\nRohit\nRohit\nDhawan\nSir Jadeja\nDhoni\nSir Jadeja\nKohli\nYuvraj\nYuvraj\nRohit\nYuvraj\nYuvraj\nDhawan\nDhoni\nKohli\nRaina\nRaina\nDhawan\nSir Jadeja\nSir Jadeja\nKohli\nDhoni\nDhoni\nRaina\nDhoni\nSir Jadeja\nRohit\nRaina\nDhoni\nRohit\nRaina\nSir Jadeja\nRohit\nRohit\nRaina\nRohit\nRaina\nKohli\nDhoni\nRaina\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nDhawan\nRohit\nDhawan\nYuvraj\nRohit\nSir Jadeja\nDhoni\nDhoni\nKohli\nDhoni\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhoni\nKohli\nRaina\nSir Jadeja\nRohit\nDhoni\nSir Jadeja\nSir Jadeja\nKohli\nKohli\nDhawan\nDhoni\nDhoni\nDhoni\nRohit\nYuvraj\nYuvraj\nYuvraj\nDhawan\nSir Jadeja\nDhawan\nYuvraj\nRohit\nRohit\nSir Jadeja\nDhoni\nSir Jadeja\nRohit\nRohit\nDhoni\nDhoni\nDhoni\nKohli\nRohit\nRohit\nRohit\nSir Jadeja\nRaina\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nRohit\nSir Jadeja\nKohli\nRohit\nKohli\nRaina\nYuvraj\nYuvraj\nRaina\nRaina\nSir Jadeja\nYuvraj\nRaina\nRohit\nKohli\nRohit\nRohit\nRohit\nDhawan\nRaina\nRaina\nDhoni\nRaina\nDhawan\nRaina\nKohli\nRohit\nSir Jadeja\nKohli\nDhawan\nYuvraj\nDhawan\nRaina\nRaina\nYuvraj\nDhoni\nKohli\nDhawan\nRohit\nRaina\nRaina\nKohli\nYuvraj\nYuvraj\nRaina\nSir Jadeja\nDhawan\nRaina\nRohit\nDhoni\nKohli\nYuvraj\nSir Jadeja\nKohli\nKohli\nKohli\nDhoni\nDhoni\nDhawan\nDhawan\nRaina\nDhoni\nSir Jadeja\nRaina\nDhoni\nDhoni\nSir Jadeja\nYuvraj\nYuvraj\nDhawan\nYuvraj\nYuvraj\nRaina\nYuvraj\nDhawan\nRohit\nRaina\nRohit\nKohli\nYuvraj\nKohli\nDhoni\nYuvraj\nDhoni\nDhawan\nDhawan\nDhoni\nDhoni\nSir Jadeja\nDhoni\nDhoni\nDhoni\nRohit\nDhoni\nDhoni\nRohit\nKohli\nRaina\nYuvraj\nRaina\nRohit\nSir Jadeja\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nKohli\nKohli\nYuvraj\nRohit\nDhoni\nRaina\nRaina\nDhoni\nYuvraj\nYuvraj\nDhoni\nDhawan\nYuvraj\nRaina\nYuvraj\nDhawan\nKohli\nYuvraj\nDhawan\nRaina\nDhoni\nYuvraj\nDhoni\nSir Jadeja\nSir Jadeja\nKohli\nRohit\nRohit\nRaina\nDhoni\nSir Jadeja\nYuvraj\nDhawan\nRaina\nDhawan\nRohit\nKohli\nDhoni\nKohli\nDhawan\nSir Jadeja\nDhoni\nDhoni\nYuvraj\nRohit\nKohli\nRaina\nDhoni\nYuvraj\nDhawan\nRohit\nSir Jadeja\nDhoni\nRaina\nYuvraj\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nYuvraj\nDhawan\nDhoni\nSir Jadeja\nDhawan\nYuvraj\nDhoni\nDhawan\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nRohit\nYuvraj\nDhawan\nDhoni\nRaina\nRaina\nRaina\nDhoni\nRaina\nKohli\nKohli\nDhawan\nDhawan\nRaina\nRaina\nDhawan\nRaina\nDhawan\nRohit\nDhawan\nKohli\nRohit\nSir Jadeja\nRohit\nRaina\nKohli\nRaina\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nRohit\nRaina\nDhawan\nRaina\nRohit\nDhawan\nYuvraj\nDhawan\nDhoni\nDhoni\nKohli\nDhawan\nRohit\nDhoni\nDhoni\nKohli\nSir Jadeja\nDhawan\nRohit\nDhoni\nDhoni\nKohli\nRaina\nDhoni\nRaina\nDhoni\nSir Jadeja\nKohli\nDhawan\nRohit\nDhoni\nRohit\nDhawan\nDhoni\nDhoni\nKohli\nYuvraj\nRaina\nRaina\nRohit\nSir Jadeja\nRaina\nDhawan\nSir Jadeja\nRaina\nYuvraj\nRohit\nDhawan\nSir Jadeja\nRohit\nDhawan\nRohit\nDhawan\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nRohit\nYuvraj\nDhawan\nYuvraj\nRohit\nRohit\nRohit\nKohli\nRaina\nYuvraj\nSir Jadeja\nRohit\nKohli\nYuvraj\nRohit\nDhoni\nRohit\nRaina\nYuvraj\nRaina\nRaina\nRohit\nDhoni\nRaina\nRaina\nDhawan\nDhoni\nDhawan\nYuvraj\nKohli\nRaina\nKohli\nSir Jadeja\nKohli\nDhawan\nKohli\nKohli\nYuvraj\nRaina\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhawan\nKohli\nDhoni\nDhawan\nRohit\nRohit\nDhoni\nDhoni\nYuvraj\nDhoni\nDhawan\nYuvraj\nDhawan\nRohit\nDhoni\nRaina\nYuvraj\nDhawan\nYuvraj\nRohit\nRaina\nYuvraj\nRaina\nSir Jadeja\nDhoni\nKohli\nSir Jadeja\nDhawan\nRohit\nDhawan\nSir Jadeja\nRaina\nRohit\nRaina\nRaina\nRaina\nKohli\nYuvraj\nDhoni\nRaina\nSir Jadeja\nYuvraj\nRohit\nDhawan\nDhawan\nRohit\nRaina\nSir Jadeja\nRohit\nSir Jadeja\nDhoni\nKohli\nSir Jadeja\nRohit\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nKohli\nYuvraj\nKohli\nRaina\nDhawan\nDhoni\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nSir Jadeja\nRohit\nRaina\nDhoni\nRaina\nYuvraj\nSir Jadeja\nDhoni\nRaina\nDhoni\nKohli\nKohli\nSir Jadeja\nSir Jadeja\nRohit\nYuvraj\nSir Jadeja\nRaina\nRohit\nDhawan\nDhoni\nRaina\nRaina\nRaina\nDhoni\nDhoni\nDhawan\nRaina\nRohit\nRohit\nDhawan\nDhawan\nYuvraj\nRaina\nRohit\nRaina\nSir Jadeja\nRohit\nYuvraj\nDhoni\nYuvraj\nSir Jadeja\nSir Jadeja\nSir Jadeja\nRaina\nSir Jadeja\nDhawan\nRohit\nRaina\nRohit\nKohli\nDhawan\nRaina\nDhoni\nRaina\nKohli\nRohit\nRaina\nRohit\nYuvraj\nDhoni\nRaina\nYuvraj\nYuvraj\nDhoni\nYuvraj\nDhawan\nDhoni\nDhoni\nDhoni\nSir Jadeja\nSir Jadeja\nDhoni\nDhawan\nDhoni\nRaina\nDhawan\nYuvraj\nRohit\nDhawan\nRaina\nSir Jadeja\nDhoni\nDhoni\nSir Jadeja\nDhoni\nYuvraj\nRohit\nRohit\nRaina\nRohit\nRohit\nSir Jadeja\nDhawan\nDhawan\nYuvraj\nRohit\nKohli\nRohit\nRohit\nRohit\nKohli\nDhoni\nKohli\nRaina\nRohit\nYuvraj\nDhoni\nDhawan\nKohli\nRaina\nRohit\nDhawan\nYuvraj\nRohit\nRohit\nSir Jadeja\nKohli\nDhoni\nDhawan\nRaina\nYuvraj\nDhoni\nRohit\nDhawan\nRohit\nDhawan\nRohit\nRaina\nRaina\nSir Jadeja\nDhoni\nDhawan\nDhoni\nDhoni\nDhawan\nSir Jadeja\nKohli\nDhoni\nDhoni\nDhoni\nKohli\nRaina\nRaina\nSir Jadeja\nYuvraj\nKohli\nDhoni\nKohli\nRohit\nYuvraj\nYuvraj\nRohit\nDhoni\nSir Jadeja\nSir Jadeja\nSir Jadeja\nYuvraj\nDhoni\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nKohli\nDhoni\nSir Jadeja\nYuvraj\nRaina\nDhawan\nRaina\nYuvraj\nRaina\nSir Jadeja\nDhawan\nRohit\nRaina\nRaina\nSir Jadeja\nRaina\nDhawan\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nRaina\nSir Jadeja\nDhoni\nRohit\nRohit\nKohli\nDhoni\nRaina\nSir Jadeja\nSir Jadeja\nDhawan\nDhawan\nYuvraj\nDhawan\nRohit\nSir Jadeja\nSir Jadeja\nKohli\nRohit\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRohit\nRohit\nKohli\nSir Jadeja\nRaina\nRohit\nDhawan\nRaina\nDhoni\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nSir Jadeja\nRaina\nDhawan\nSir Jadeja\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nDhawan\nRohit\nDhawan\nRohit\nDhoni\nYuvraj\nDhawan\nRohit\nRohit\nDhoni\nRohit\nRaina\nKohli\nRohit\nKohli\nRohit\nRohit\nSir Jadeja\nRaina\nYuvraj\nKohli\nRaina\nDhoni\nSir Jadeja\nRaina\nDhawan\nRaina\nDhawan\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nKohli\nRaina\nRohit\nRaina\nYuvraj\nSir Jadeja\nKohli\nDhoni\nRohit\nYuvraj\nSir Jadeja\nDhoni\nDhoni\nRaina\nRohit\nRohit\nDhawan\nKohli\nKohli\nDhawan\nDhoni\nDhawan\nRaina\nDhoni\nKohli\nDhoni\nRaina\nDhawan\nRaina\nRohit\nSir Jadeja\nKohli\nRohit\nDhawan\nSir Jadeja\nRohit\nYuvraj\nRaina\nYuvraj\nRaina\nRohit\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nSir Jadeja\nDhoni\nRohit\nDhawan\nRaina\nDhawan\nDhoni\nDhoni\nDhawan\nSir Jadeja\nRohit\nSir Jadeja\nDhoni\nDhawan\nRohit\nRohit\nRohit\nYuvraj\nDhoni\nRohit\nKohli\nDhoni\nRohit\nYuvraj\nDhoni\nRaina\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nRohit\nRohit\nDhawan\nYuvraj\nKohli\nKohli\nRohit\nRohit\nKohli\nRohit\nKohli\nYuvraj\nSir Jadeja\nDhawan\nRaina\nKohli\nRohit\nKohli\nYuvraj\nRohit\nKohli\nRohit\nDhawan\nRohit\nRohit\nDhoni\nYuvraj\nDhoni\nDhoni\nRohit\nRohit\nDhawan\nDhawan\nRohit\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nSir Jadeja\nYuvraj\nYuvraj\nRohit\nRohit\nKohli\nKohli\nRohit\nSir Jadeja\nSir Jadeja\nKohli\nYuvraj\nRohit\nRaina\nDhoni\nRohit\nRohit\nYuvraj\nDhawan\nDhoni\nKohli\nSir Jadeja\nRohit\nRohit\nDhoni\nRohit\nRohit\nSir Jadeja\nKohli\nRaina\nKohli\nKohli\nSir Jadeja\nRohit\nRaina\nDhoni\nKohli\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nRaina\nRohit\nDhoni\nKohli\nYuvraj\nRohit\nRohit\nYuvraj\nYuvraj\nYuvraj\nYuvraj\nRaina\nSir Jadeja\nRohit\nRaina\nRohit\nSir Jadeja\nSir Jadeja\nYuvraj\nSir Jadeja\nRohit\nRaina\nYuvraj\nRohit\nYuvraj\nRohit\nRaina\nRohit\nDhawan\nDhawan\nYuvraj\n",
"Rohit\nKohli\nKohli\nRohit\nSir Jadeja\nDhoni\nDhawan\nRohit\nDhoni\nDhoni\nRaina\nKohli\nKohli\nRohit\nDhawan\nRohit\nKohli\nRohit\nRohit\nYuvraj\nKohli\nDhawan\nKohli\nKohli\nDhawan\nRohit\nYuvraj\nDhawan\nDhoni\nRohit\nDhoni\nDhawan\nSir Jadeja\nDhawan\nRaina\nSir Jadeja\nDhoni\nSir Jadeja\nKohli\nKohli\nRohit\nRohit\nDhawan\nDhawan\nYuvraj\nDhawan\nYuvraj\nRohit\nRaina\nDhawan\nDhawan\nDhoni\nYuvraj\nRaina\nDhawan\nKohli\nYuvraj\nRohit\nDhawan\nDhoni\nYuvraj\nRohit\nSir Jadeja\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nRaina\nSir Jadeja\nYuvraj\nDhawan\nKohli\nYuvraj\nSir Jadeja\nRohit\nKohli\nRohit\nDhoni\nRohit\nDhawan\nDhoni\nRaina\nYuvraj\nRaina\nRohit\nDhawan\nYuvraj\nKohli\nSir Jadeja\nDhoni\nRohit\nSir Jadeja\nDhawan\nDhawan\nRohit\nRohit\nKohli\nRaina\nYuvraj\nDhawan\nRaina\nYuvraj\nSir Jadeja\nDhawan\nRaina\nKohli\nRaina\nRohit\nKohli\nDhawan\nRohit\nRohit\nRohit\nKohli\nDhawan\nRaina\nRohit\nYuvraj\nDhoni\nKohli\nKohli\nRohit\nRaina\nRohit\nDhoni\nDhoni\nRohit\nRaina\nRaina\nDhawan\nDhawan\nRohit\nDhoni\nKohli\nDhawan\nDhawan\nKohli\nKohli\nRohit\nDhawan\nKohli\nRaina\nRohit\nRaina\nDhoni\nDhoni\nDhawan\nRohit\nSir Jadeja\nRaina\nKohli\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nKohli\nDhoni\nDhawan\nKohli\nRohit\nRaina\nRohit\nDhoni\nKohli\nKohli\nDhoni\nYuvraj\nKohli\nRaina\nYuvraj\nDhawan\nRohit\nRaina\nDhawan\nRohit\nDhawan\nRohit\nDhawan\nKohli\nDhoni\nRohit\nSir Jadeja\nDhawan\nRohit\nRohit\nRohit\nDhawan\nDhawan\nSir Jadeja\nKohli\nYuvraj\nDhawan\nRohit\nDhoni\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRaina\nKohli\nDhoni\nRohit\nSir Jadeja\nRohit\nRaina\nRohit\nRohit\nDhawan\nRaina\nRaina\nRaina\nDhoni\nKohli\nYuvraj\nDhoni\nDhoni\nRaina\nDhoni\nYuvraj\nDhawan\nDhawan\nDhoni\nYuvraj\nSir Jadeja\nYuvraj\nRaina\nRaina\nRaina\nSir Jadeja\nDhawan\nKohli\nRohit\nKohli\nKohli\nSir Jadeja\nYuvraj\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nRaina\nDhawan\nKohli\nDhoni\nKohli\nKohli\nDhoni\nRohit\nKohli\nKohli\nKohli\nRohit\nDhoni\nDhawan\nDhoni\nSir Jadeja\nRaina\nYuvraj\nRohit\nKohli\nYuvraj\nRohit\nRohit\nSir Jadeja\nDhawan\nDhoni\nRohit\nDhawan\nRohit\nRohit\nKohli\nRohit\nKohli\nRohit\nRaina\nKohli\nKohli\nDhawan\nDhoni\nDhoni\nRohit\nKohli\nRaina\nDhawan\nKohli\nDhoni\nRaina\nDhawan\nYuvraj\nRohit\nRaina\nKohli\nDhoni\nKohli\nDhawan\nDhawan\nRaina\nRohit\nDhawan\nDhawan\nRaina\nKohli\nRaina\nRohit\nYuvraj\nRohit\nRohit\nYuvraj\nKohli\nDhawan\nDhawan\nRohit\nRaina\nSir Jadeja\nDhawan\nRohit\nYuvraj\nRohit\nRohit\nSir Jadeja\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nSir Jadeja\nDhawan\nDhoni\nYuvraj\nDhawan\nKohli\nRaina\nRaina\nDhoni\nRaina\nRohit\nSir Jadeja\nRohit\nKohli\nRohit\nDhoni\nRohit\nRaina\nDhawan\nDhoni\nDhoni\nRohit\nDhoni\nRaina\nSir Jadeja\nKohli\nRohit\nDhoni\nDhawan\nDhoni\nRohit\nKohli\nYuvraj\nDhoni\nRohit\nSir Jadeja\nYuvraj\nRohit\nRaina\nSir Jadeja\nRaina\nRohit\nRohit\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nRaina\nRohit\nYuvraj\nRohit\nDhoni\nKohli\nDhoni\nRohit\nRohit\nDhawan\nYuvraj\nDhawan\nRohit\nRohit\nRohit\nRaina\nKohli\nDhawan\nDhawan\nRohit\nDhawan\nDhoni\nDhawan\nSir Jadeja\nRohit\nRohit\nSir Jadeja\nDhoni\nRaina\nRohit\nRaina\nYuvraj\nKohli\nRohit\nRohit\nDhawan\nRohit\nKohli\nDhoni\nDhoni\nKohli\nRohit\nDhawan\nSir Jadeja\nYuvraj\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nRaina\nDhawan\nDhawan\nKohli\nYuvraj\nRohit\nRohit\nSir Jadeja\nYuvraj\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nDhoni\nKohli\nYuvraj\nRaina\nRaina\nRohit\nRohit\nDhoni\nDhoni\nDhoni\nSir Jadeja\nKohli\nRaina\nRohit\nYuvraj\nKohli\nKohli\nDhoni\nRohit\nRohit\nRaina\nDhoni\nDhoni\nRaina\nSir Jadeja\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nRohit\nRohit\nKohli\nYuvraj\nSir Jadeja\nRohit\nDhoni\nDhawan\nRaina\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nRohit\nRohit\nYuvraj\nSir Jadeja\nRohit\nSir Jadeja\nRohit\nDhoni\nRohit\nRohit\nYuvraj\nRohit\nRohit\nRohit\nKohli\nDhawan\nSir Jadeja\nRaina\nYuvraj\nYuvraj\nRohit\nRohit\nKohli\nSir Jadeja\nDhoni\nRohit\nDhoni\nYuvraj\nYuvraj\nYuvraj\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nDhoni\nKohli\nKohli\nDhawan\nKohli\nRohit\nYuvraj\nRohit\nRaina\nRaina\nRohit\nRaina\nRaina\nYuvraj\nDhawan\nYuvraj\nDhawan\nRohit\nDhawan\nRaina\nSir Jadeja\nRaina\nSir Jadeja\nRohit\nKohli\nRaina\nSir Jadeja\nYuvraj\nRohit\nKohli\nDhawan\nKohli\nDhoni\nRohit\nDhoni\nRohit\nYuvraj\nRohit\nYuvraj\nKohli\nRohit\nRaina\nDhoni\nYuvraj\nYuvraj\nDhoni\nRaina\nRohit\nDhawan\nDhawan\nRaina\nSir Jadeja\nKohli\nDhawan\nRohit\nRaina\nKohli\nDhawan\nKohli\nKohli\nKohli\nRaina\nDhawan\nDhawan\nDhoni\nRohit\nKohli\nDhawan\nDhawan\nRaina\nKohli\nRohit\nRaina\nDhoni\nYuvraj\nDhoni\nYuvraj\nKohli\nSir Jadeja\nRohit\nDhawan\nDhoni\nKohli\nDhawan\nKohli\nKohli\nYuvraj\nYuvraj\nRaina\nSir Jadeja\nKohli\nKohli\nKohli\nRaina\nRaina\nYuvraj\nDhawan\nSir Jadeja\nRohit\nRohit\nKohli\nRohit\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nSir Jadeja\nRohit\nKohli\nDhoni\nRaina\nYuvraj\nYuvraj\nDhawan\nRohit\nYuvraj\nSir Jadeja\nYuvraj\nRohit\nRohit\nRohit\nDhawan\nRohit\nRohit\nRaina\nYuvraj\nRohit\nDhawan\nDhoni\nDhoni\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nSir Jadeja\nDhoni\nKohli\nKohli\nSir Jadeja\nRohit\nRohit\nYuvraj\nRohit\nDhoni\nSir Jadeja\nRaina\nRaina\nRohit\nDhawan\nRohit\nDhoni\nRohit\nKohli\nRohit\nRohit\nKohli\nRohit\nYuvraj\nRohit\nSir Jadeja\nDhawan\nDhoni\nSir Jadeja\nRohit\nDhawan\nDhawan\nKohli\nDhoni\nSir Jadeja\nDhawan\nDhawan\nDhoni\nDhoni\nRohit\nRaina\nRohit\nRohit\nRohit\nKohli\nRaina\nDhoni\nKohli\nRaina\nSir Jadeja\nRaina\nDhoni\nYuvraj\nRohit\nDhawan\nRaina\nRohit\nRaina\nKohli\nRaina\nYuvraj\nRaina\nRohit\nRaina\nDhawan\nRohit\nDhoni\nRohit\nYuvraj\nDhoni\nDhoni\nRohit\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nDhoni\nDhawan\nDhawan\nDhawan\nDhoni\nDhoni\nDhoni\nDhoni\nRohit\nKohli\nSir Jadeja\nDhawan\nRohit\nDhoni\nRohit\nKohli\nDhoni\nRaina\nRohit\nDhawan\nKohli\nRohit\nRohit\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nKohli\nKohli\nKohli\nDhawan\nDhoni\nRaina\nRohit\nYuvraj\nKohli\nDhoni\nDhawan\nSir Jadeja\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nRohit\nRaina\nKohli\nSir Jadeja\nRohit\nYuvraj\nRohit\nYuvraj\nKohli\nRaina\nYuvraj\nRohit\nDhoni\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nRaina\nSir Jadeja\nDhawan\nYuvraj\nSir Jadeja\nRaina\nKohli\nRohit\nDhoni\nDhawan\nDhoni\nYuvraj\nDhoni\nSir Jadeja\nRaina\nRohit\nKohli\nRaina\nKohli\nRohit\nDhawan\nYuvraj\nSir Jadeja\nYuvraj\nDhoni\nRohit\nKohli\nRohit\nYuvraj\nYuvraj\nKohli\nKohli\nRohit\nDhoni\nRohit\nRohit\nDhoni\nDhoni\nKohli\nYuvraj\nSir Jadeja\nRaina\nDhawan\nRohit\nYuvraj\nRohit\nRaina\nSir Jadeja\nDhawan\nYuvraj\nSir Jadeja\nKohli\nYuvraj\nYuvraj\nKohli\nYuvraj\nKohli\nYuvraj\nDhoni\nDhawan\nYuvraj\nRaina\nDhawan\nDhawan\nSir Jadeja\nRohit\nRaina\nDhoni\nDhoni\nRaina\nRohit\nDhoni\nRaina\nDhoni\nYuvraj\nRaina\nKohli\nSir Jadeja\nDhoni\nDhoni\nDhoni\nDhoni\nRaina\nKohli\nRohit\nSir Jadeja\nDhoni\nSir Jadeja\nRaina\nDhawan\nDhawan\nRohit\nYuvraj\nDhoni\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nSir Jadeja\nSir Jadeja\nRohit\nRohit\nRohit\nKohli\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nRaina\nYuvraj\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nSir Jadeja\nRohit\nRaina\nDhawan\nDhoni\nKohli\nDhawan\nKohli\nDhawan\nKohli\nRohit\nKohli\nDhawan\nSir Jadeja\nYuvraj\nDhawan\nDhoni\nRohit\nRaina\nRaina\nDhoni\nRaina\nRohit\nSir Jadeja\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nRohit\nDhawan\nKohli\nKohli\nDhawan\nRaina\nRohit\nRohit\nKohli\nRaina\nDhoni\nRohit\nDhawan\nRohit\nRohit\nRohit\nYuvraj\nDhawan\nDhoni\nKohli\nRaina\nRaina\nDhoni\nKohli\nDhoni\nDhawan\nDhoni\nYuvraj\nDhawan\nSir Jadeja\nDhoni\nRaina\nSir Jadeja\nDhawan\nDhawan\nDhoni\nDhoni\nRaina\nRohit\nRohit\nKohli\nYuvraj\nDhoni\nRaina\nSir Jadeja\nKohli\nKohli\nRohit\nDhoni\nSir Jadeja\nYuvraj\nDhoni\nYuvraj\nRohit\nRohit\nKohli\nKohli\nRohit\nDhawan\nKohli\nSir Jadeja\nYuvraj\nYuvraj\nKohli\nDhoni\nSir Jadeja\nRohit\nYuvraj\nDhoni\n",
"Rohit\nRohit\nYuvraj\nRohit\nDhoni\nDhawan\nRaina\nRohit\nDhawan\nYuvraj\nSir Jadeja\nDhoni\nDhawan\nKohli\nDhawan\nRaina\nDhawan\nDhoni\nYuvraj\nSir Jadeja\nDhawan\nKohli\nSir Jadeja\nDhoni\nDhoni\nRohit\nRaina\nDhoni\nRohit\nRohit\nDhoni\nSir Jadeja\nKohli\nDhoni\nRohit\nRohit\nYuvraj\nYuvraj\nDhoni\nKohli\nRohit\nDhoni\nSir Jadeja\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nDhoni\nDhoni\nSir Jadeja\nRohit\nRaina\nDhoni\nSir Jadeja\nRaina\nRaina\nSir Jadeja\nKohli\nDhoni\nDhoni\nRohit\nRaina\nRohit\nRohit\nRohit\nRaina\nDhawan\nDhoni\nRaina\nRaina\nDhoni\nDhoni\nRaina\nDhawan\nDhoni\nRohit\nRohit\nYuvraj\nSir Jadeja\nSir Jadeja\nDhoni\nRaina\nRohit\nRohit\nDhawan\nRohit\nDhawan\nSir Jadeja\nSir Jadeja\nKohli\nRohit\nRohit\nKohli\nRaina\nRaina\nDhoni\nDhawan\nSir Jadeja\nSir Jadeja\nRohit\nDhoni\nDhoni\nRohit\nDhawan\nKohli\nRohit\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRohit\nDhawan\nRohit\nRohit\nKohli\nSir Jadeja\nDhawan\nDhawan\nKohli\nKohli\nDhoni\nKohli\nDhawan\nDhoni\nSir Jadeja\nDhawan\nYuvraj\nRohit\nRaina\nDhoni\nRohit\nDhawan\nKohli\nKohli\nDhoni\nYuvraj\nKohli\nRohit\nYuvraj\nSir Jadeja\nKohli\nKohli\nDhawan\nKohli\nDhawan\nYuvraj\nDhoni\nSir Jadeja\nDhawan\nDhoni\nDhoni\nDhawan\nYuvraj\nKohli\nRaina\nYuvraj\nRaina\nRohit\nYuvraj\nSir Jadeja\nKohli\nRaina\nYuvraj\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nSir Jadeja\nDhawan\nDhoni\nKohli\nSir Jadeja\nKohli\nDhawan\nYuvraj\nDhawan\nYuvraj\nRaina\nRaina\nYuvraj\nDhawan\nYuvraj\nRaina\nRaina\nDhoni\nRohit\nRohit\nYuvraj\nYuvraj\nDhoni\nDhawan\nSir Jadeja\nKohli\nDhawan\nRohit\nRohit\nKohli\nRaina\nDhoni\nKohli\nYuvraj\nRohit\nDhawan\nRohit\nRohit\nRohit\nRaina\nKohli\nRohit\nRohit\nRohit\nKohli\nDhoni\nDhawan\nRohit\nDhoni\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nDhoni\nDhawan\nDhoni\nRaina\nDhawan\nKohli\nRaina\nRohit\nDhoni\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nRohit\nDhawan\nRohit\nRohit\nYuvraj\nSir Jadeja\nYuvraj\nSir Jadeja\nKohli\nSir Jadeja\nYuvraj\nDhoni\nDhoni\nYuvraj\nRohit\nSir Jadeja\nRohit\nKohli\nKohli\nDhoni\nDhawan\nRaina\nRohit\nDhawan\nKohli\nSir Jadeja\nRaina\nSir Jadeja\nKohli\nRohit\nDhawan\nYuvraj\nRaina\nRaina\nRohit\nDhoni\nRohit\nSir Jadeja\nRaina\nYuvraj\nSir Jadeja\nYuvraj\nRaina\nRohit\nRaina\nYuvraj\nSir Jadeja\nDhawan\nDhawan\nDhoni\nYuvraj\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nKohli\nSir Jadeja\nYuvraj\nKohli\nDhawan\nRohit\nDhawan\nYuvraj\nKohli\nRohit\nDhoni\nYuvraj\nRohit\nRaina\nYuvraj\nDhoni\nRohit\nKohli\nDhawan\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nKohli\nDhawan\nDhoni\nDhoni\nRohit\nSir Jadeja\nYuvraj\nYuvraj\nRohit\nRaina\nDhoni\nRaina\nRohit\nRohit\nDhoni\nYuvraj\nYuvraj\nSir Jadeja\nSir Jadeja\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nDhawan\nYuvraj\nKohli\nRohit\nDhawan\nSir Jadeja\nSir Jadeja\nDhawan\nRohit\nDhawan\nSir Jadeja\nDhawan\nKohli\nDhawan\nSir Jadeja\nRohit\nRohit\nRaina\nRohit\nDhoni\nRaina\nSir Jadeja\nRohit\nDhoni\nKohli\nDhoni\nYuvraj\nKohli\nRohit\nRaina\nYuvraj\nRohit\nKohli\nRohit\nRaina\nDhawan\nDhawan\nYuvraj\nRohit\nRaina\nKohli\nSir Jadeja\nKohli\nKohli\nDhoni\nDhawan\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nRohit\nRohit\nYuvraj\nRaina\nSir Jadeja\nRohit\nYuvraj\nDhoni\nRohit\nDhawan\nDhoni\nDhawan\nYuvraj\nRohit\nSir Jadeja\nRaina\nDhawan\nYuvraj\nRaina\nDhoni\nKohli\nSir Jadeja\nRaina\nRohit\nKohli\nRaina\nKohli\nDhoni\nSir Jadeja\nSir Jadeja\nRaina\nSir Jadeja\nRaina\nKohli\nDhoni\nKohli\nSir Jadeja\nDhawan\nRohit\nKohli\nDhawan\nRaina\nKohli\nRohit\nKohli\nYuvraj\nRohit\nYuvraj\nSir Jadeja\nDhawan\nKohli\nKohli\nRaina\nRohit\nRaina\nRohit\nRohit\nRaina\nDhawan\nDhawan\nDhoni\nRohit\nDhoni\nRohit\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nRohit\nYuvraj\nRohit\nRaina\nDhoni\nRaina\nYuvraj\nKohli\nKohli\nSir Jadeja\nYuvraj\nDhoni\nSir Jadeja\nDhawan\nRohit\nRaina\nYuvraj\nRohit\nKohli\nRaina\nKohli\nDhoni\nDhawan\nKohli\nDhawan\nDhoni\nYuvraj\nKohli\nRaina\nDhoni\nDhoni\nRohit\nRohit\nKohli\nDhoni\nDhoni\nDhoni\nDhoni\nRohit\nDhawan\nRaina\nDhoni\nYuvraj\nDhawan\nYuvraj\nSir Jadeja\nRaina\nDhoni\nKohli\nRaina\nRohit\nYuvraj\nRaina\nDhoni\nDhawan\nRaina\nRohit\nKohli\nDhawan\nDhawan\nRohit\nRohit\nDhawan\nRohit\nSir Jadeja\nRaina\nKohli\nDhoni\nSir Jadeja\nSir Jadeja\nDhawan\nSir Jadeja\nSir Jadeja\nYuvraj\nDhawan\nRaina\nRohit\nKohli\nKohli\nDhoni\nRohit\nKohli\nDhoni\nRohit\nSir Jadeja\nKohli\nDhawan\nRohit\nRaina\nYuvraj\nRohit\nDhawan\nSir Jadeja\nKohli\nDhoni\nDhoni\nDhawan\nYuvraj\nYuvraj\nRaina\nRohit\nKohli\nDhawan\nDhawan\nDhoni\nRohit\nYuvraj\nYuvraj\nSir Jadeja\nDhoni\nYuvraj\nYuvraj\nRohit\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhoni\nRohit\nKohli\nSir Jadeja\nRaina\nDhoni\nYuvraj\nDhoni\nKohli\nDhoni\nRaina\nKohli\nKohli\nSir Jadeja\nRaina\nSir Jadeja\nDhoni\nDhawan\nDhawan\nYuvraj\nYuvraj\nRaina\nYuvraj\nRohit\nSir Jadeja\nDhawan\nDhoni\nDhawan\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nDhoni\nRohit\nDhoni\nRohit\nYuvraj\nRohit\nRohit\nYuvraj\nKohli\nKohli\nDhawan\nYuvraj\nSir Jadeja\nYuvraj\nRaina\nDhawan\nRaina\nDhoni\nKohli\nRohit\nRohit\nDhawan\nRohit\nRohit\nRohit\nRohit\nDhoni\nRohit\nRaina\nRaina\nDhawan\nDhawan\nRohit\nRaina\nDhawan\nKohli\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nKohli\nRohit\nRohit\nRaina\nSir Jadeja\nYuvraj\nSir Jadeja\nRohit\nRohit\nRohit\nRaina\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nRaina\nKohli\nKohli\nRaina\nYuvraj\nDhawan\nKohli\nSir Jadeja\nRaina\nRohit\nRohit\nRohit\nDhoni\nSir Jadeja\nRaina\nDhawan\nDhawan\nRohit\nSir Jadeja\nYuvraj\nRohit\nRaina\nRohit\nYuvraj\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nDhawan\nYuvraj\nYuvraj\nRohit\nRohit\nRohit\nRohit\nDhawan\nDhawan\nYuvraj\nDhawan\nRohit\nRaina\nYuvraj\nRohit\nDhawan\nDhawan\nDhawan\nSir Jadeja\nDhoni\nKohli\nDhoni\nYuvraj\nDhawan\nKohli\nRohit\nYuvraj\nDhawan\nDhawan\nDhoni\nDhawan\nRaina\nRohit\nKohli\nDhoni\nRohit\nRaina\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhoni\nRaina\nDhawan\nDhoni\nSir Jadeja\nYuvraj\nRaina\nRaina\nDhawan\nRohit\nSir Jadeja\nKohli\nSir Jadeja\nRohit\nDhoni\nSir Jadeja\nYuvraj\nYuvraj\nDhawan\nDhawan\nSir Jadeja\nRaina\nRaina\nSir Jadeja\nDhawan\nKohli\nDhoni\nKohli\nKohli\nDhoni\nRaina\nSir Jadeja\nRohit\nKohli\nYuvraj\nYuvraj\nDhawan\nKohli\nDhoni\nDhoni\nRohit\nDhawan\nKohli\nDhoni\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nYuvraj\nRaina\nRohit\nDhawan\nYuvraj\nDhoni\nRaina\nDhoni\nSir Jadeja\nKohli\nYuvraj\nKohli\nSir Jadeja\nKohli\nKohli\nDhoni\nDhoni\nYuvraj\nDhawan\nRohit\nRohit\nDhoni\nDhawan\nRohit\nKohli\nKohli\nYuvraj\nRaina\nRohit\nSir Jadeja\nYuvraj\nRaina\nKohli\nRohit\nSir Jadeja\nRohit\nKohli\nYuvraj\nDhoni\nSir Jadeja\nKohli\nKohli\nDhoni\nYuvraj\nKohli\nKohli\nKohli\nDhoni\nYuvraj\nSir Jadeja\nDhawan\nYuvraj\nSir Jadeja\nKohli\nDhoni\nSir Jadeja\nRaina\nDhoni\nSir Jadeja\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nKohli\nYuvraj\nKohli\nYuvraj\nRohit\nSir Jadeja\nRohit\nDhawan\nDhawan\nDhoni\nSir Jadeja\nRohit\nRohit\nYuvraj\nRohit\nKohli\nKohli\nKohli\nRohit\nDhawan\nRohit\nRohit\nRohit\nSir Jadeja\nKohli\nRohit\nSir Jadeja\nRohit\nKohli\nDhoni\nRohit\nRohit\nDhawan\nSir Jadeja\nRaina\nRaina\nYuvraj\nRohit\nDhoni\nRohit\nDhoni\nDhoni\nDhoni\nDhoni\nDhawan\nKohli\nDhoni\nYuvraj\nDhoni\nRaina\nYuvraj\nYuvraj\nKohli\nSir Jadeja\nRohit\nKohli\nRaina\nSir Jadeja\nRohit\nSir Jadeja\nDhoni\nRohit\nDhawan\nRohit\nRaina\nDhoni\nKohli\nDhawan\nRohit\nSir Jadeja\nYuvraj\nKohli\nDhawan\nSir Jadeja\nKohli\nRaina\nDhawan\nSir Jadeja\nDhawan\nYuvraj\nRohit\nYuvraj\nRaina\nDhoni\nDhawan\nRohit\nRaina\nRaina\nRaina\nDhawan\nRaina\nDhoni\nDhawan\nDhoni\nSir Jadeja\nYuvraj\nRaina\nRohit\nSir Jadeja\nDhoni\nKohli\nRohit\nRohit\nSir Jadeja\nYuvraj\nRaina\nDhoni\nDhoni\nRaina\nSir Jadeja\nDhoni\nRohit\nRaina\nRaina\nRohit\nDhawan\nYuvraj\nDhoni\nRaina\nRohit\nDhawan\nRohit\nRohit\nRohit\nDhoni\nRaina\nSir Jadeja\nYuvraj\nKohli\nKohli\nDhawan\nRaina\nRaina\nRaina\nRaina\nRohit\nKohli\nYuvraj\nDhawan\nKohli\nKohli\nSir Jadeja\nSir Jadeja\nYuvraj\nKohli\nRohit\nRaina\nRaina\nKohli\nKohli\nRaina\nDhawan\nYuvraj\nDhoni\nYuvraj\nDhoni\nRaina\nRaina\nSir Jadeja\n",
"Kohli\nDhoni\n",
"Rohit\nYuvraj\nRaina\nDhawan\nKohli\nDhawan\nKohli\nDhoni\nRaina\nSir Jadeja\nDhoni\nRaina\nDhawan\nDhoni\nKohli\nKohli\nDhawan\nYuvraj\nDhawan\nRaina\nSir Jadeja\nSir Jadeja\nDhoni\nYuvraj\nDhawan\nRohit\nRohit\nKohli\nSir Jadeja\nDhoni\nSir Jadeja\nYuvraj\nRohit\nRaina\nDhawan\nSir Jadeja\nDhoni\nKohli\nDhoni\nRohit\nDhawan\nKohli\nRaina\nRaina\nKohli\nDhoni\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nRohit\nDhoni\nDhawan\nSir Jadeja\nDhoni\nYuvraj\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nDhawan\nSir Jadeja\nSir Jadeja\nDhoni\nDhawan\nYuvraj\nDhoni\nRohit\nSir Jadeja\nDhawan\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nRaina\nSir Jadeja\nRaina\nRohit\nSir Jadeja\nRohit\nKohli\nRaina\nDhawan\nKohli\nRohit\nRaina\nYuvraj\nRaina\nDhawan\nRaina\nKohli\nRohit\nDhoni\nYuvraj\nDhawan\nDhawan\nRohit\nDhawan\nYuvraj\nDhoni\nKohli\nRaina\nRohit\nRohit\nSir Jadeja\nKohli\nYuvraj\nDhoni\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nDhawan\nDhoni\nRaina\nDhawan\nKohli\nYuvraj\nRaina\nYuvraj\nRaina\nSir Jadeja\nDhawan\nYuvraj\nRaina\nRohit\nDhawan\nSir Jadeja\nRohit\nRohit\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nDhawan\nRohit\nRohit\nYuvraj\nDhoni\nKohli\nRohit\nRohit\nKohli\nYuvraj\nDhawan\nRohit\nRaina\nDhoni\nSir Jadeja\nDhoni\nSir Jadeja\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nYuvraj\nYuvraj\nDhawan\nDhoni\nDhawan\nDhawan\nRohit\nSir Jadeja\nDhoni\nKohli\nRohit\nDhawan\nDhoni\nRohit\nSir Jadeja\nDhawan\nRaina\nRohit\nDhawan\nDhoni\nYuvraj\nRohit\nRohit\nDhawan\nSir Jadeja\nRohit\nDhoni\nDhoni\nDhoni\nRaina\nDhoni\nYuvraj\nKohli\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nYuvraj\nYuvraj\nSir Jadeja\nYuvraj\nYuvraj\nRohit\nDhawan\nRohit\nRaina\nDhawan\nRaina\nYuvraj\nRohit\nRaina\nSir Jadeja\nSir Jadeja\nDhawan\nRaina\nKohli\nRohit\nSir Jadeja\nKohli\nYuvraj\nRaina\nDhoni\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nRohit\nKohli\nRohit\nYuvraj\nDhoni\nRohit\nRohit\nDhawan\nKohli\nDhoni\nRohit\nYuvraj\nDhawan\nYuvraj\nRaina\nDhoni\nKohli\nRaina\nSir Jadeja\nDhawan\nKohli\nYuvraj\nSir Jadeja\nYuvraj\nYuvraj\nKohli\nRohit\nDhawan\nKohli\nDhoni\nYuvraj\nRaina\nDhoni\nRaina\nRaina\nDhawan\nYuvraj\nDhoni\nYuvraj\nDhoni\nKohli\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhawan\nDhawan\nDhoni\nRohit\nDhoni\nKohli\nSir Jadeja\nRohit\nKohli\nRaina\nYuvraj\nYuvraj\nRohit\nRohit\nDhawan\nYuvraj\nRaina\nYuvraj\nDhawan\nRohit\nDhoni\nSir Jadeja\nDhawan\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nDhoni\nDhawan\nSir Jadeja\nRohit\nRohit\nDhawan\nKohli\nDhawan\nKohli\nYuvraj\nKohli\nRaina\nDhawan\nRohit\nRohit\nDhawan\nKohli\nRohit\nKohli\nYuvraj\nDhoni\nDhoni\nSir Jadeja\nDhawan\nYuvraj\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nRohit\nRohit\nRaina\nRohit\nRohit\nRohit\nYuvraj\nDhoni\nSir Jadeja\nDhawan\nKohli\nDhoni\nRohit\nRaina\nSir Jadeja\nKohli\nYuvraj\nRohit\nDhoni\nDhoni\nSir Jadeja\nDhoni\nYuvraj\nKohli\nRohit\nRohit\nDhawan\nRaina\nDhoni\nRohit\nSir Jadeja\nSir Jadeja\nSir Jadeja\nRaina\nDhoni\nRohit\nRohit\nDhoni\nKohli\nYuvraj\nDhawan\nDhoni\nRohit\nDhoni\nYuvraj\nYuvraj\nYuvraj\nDhoni\nDhawan\nDhawan\nYuvraj\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nKohli\nDhoni\nRohit\nRaina\nYuvraj\nDhawan\nSir Jadeja\nYuvraj\nSir Jadeja\nKohli\nSir Jadeja\nDhawan\nKohli\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nKohli\nSir Jadeja\nYuvraj\nYuvraj\nSir Jadeja\nDhawan\nKohli\nYuvraj\nRohit\nDhoni\nYuvraj\nKohli\nRaina\nRohit\nRohit\nDhoni\nKohli\nRohit\nDhoni\nDhawan\nKohli\nSir Jadeja\nDhoni\nKohli\nSir Jadeja\nDhoni\nRaina\nRaina\nRohit\nDhoni\nDhoni\nYuvraj\nYuvraj\nRohit\nYuvraj\nYuvraj\nYuvraj\nRaina\nDhawan\nYuvraj\nKohli\nRohit\nDhoni\nRohit\nSir Jadeja\nDhoni\nRaina\nYuvraj\nSir Jadeja\nDhoni\nDhawan\nKohli\nRaina\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nRaina\nSir Jadeja\nDhawan\nRohit\nKohli\nRaina\nRaina\nDhawan\nRaina\nKohli\nYuvraj\nRohit\nKohli\nRaina\nKohli\nDhoni\nKohli\nDhawan\nRaina\nDhawan\nRohit\nDhoni\nRohit\nYuvraj\nKohli\nSir Jadeja\nKohli\nRohit\nKohli\nYuvraj\nRohit\nDhawan\nSir Jadeja\nDhoni\nKohli\nRohit\nRaina\nKohli\nDhawan\nDhoni\nSir Jadeja\nDhawan\nRohit\nKohli\nRohit\nRohit\nKohli\nDhawan\nDhawan\nDhawan\nRohit\nSir Jadeja\nRohit\nYuvraj\nDhawan\nKohli\nDhawan\nYuvraj\nDhoni\nYuvraj\nDhoni\nYuvraj\nDhoni\nKohli\nKohli\nDhoni\nDhawan\nDhawan\nRohit\nKohli\nSir Jadeja\nRohit\nRaina\nSir Jadeja\nYuvraj\nRohit\nRaina\nKohli\nDhawan\nYuvraj\nYuvraj\nYuvraj\nRaina\nDhawan\nSir Jadeja\nDhoni\nRaina\nSir Jadeja\nRohit\nYuvraj\nDhoni\nDhoni\nKohli\nYuvraj\nSir Jadeja\nRohit\nSir Jadeja\nYuvraj\nRaina\nDhawan\nYuvraj\nYuvraj\nYuvraj\nRaina\nKohli\nRohit\nDhoni\nRaina\nDhawan\nRohit\nRaina\nSir Jadeja\nYuvraj\nSir Jadeja\nDhoni\nSir Jadeja\nRohit\nKohli\nDhoni\nRaina\nDhawan\nKohli\nKohli\nDhawan\nRaina\nDhawan\nRohit\nKohli\nKohli\nKohli\nDhoni\nKohli\nDhawan\nKohli\nDhoni\nYuvraj\nDhoni\nDhoni\nDhawan\nKohli\nRohit\nDhoni\nKohli\nDhoni\nYuvraj\nRaina\nRaina\nRohit\nRohit\nDhawan\nRohit\nYuvraj\nRaina\nRaina\nDhawan\nKohli\nRohit\nDhawan\nRohit\nKohli\nDhoni\nDhawan\nSir Jadeja\nRaina\nKohli\nDhoni\nDhawan\nSir Jadeja\nYuvraj\nRaina\nDhoni\nDhawan\nYuvraj\nSir Jadeja\nKohli\nYuvraj\nKohli\nKohli\nRohit\nKohli\nDhawan\nYuvraj\nRohit\nKohli\nSir Jadeja\nDhawan\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nRaina\nRohit\nKohli\nRohit\nRaina\nRaina\nRohit\nKohli\nDhawan\nDhawan\nKohli\nKohli\nKohli\nRohit\nSir Jadeja\nSir Jadeja\nDhoni\nKohli\nKohli\nDhoni\nRohit\nKohli\nYuvraj\nDhoni\nSir Jadeja\nRaina\nRaina\nDhawan\nSir Jadeja\nDhoni\nSir Jadeja\nDhoni\nDhawan\nDhoni\nSir Jadeja\nKohli\nYuvraj\nRohit\nDhoni\nRohit\nKohli\nSir Jadeja\nKohli\nYuvraj\nYuvraj\nYuvraj\nSir Jadeja\nRohit\nKohli\nRaina\nKohli\nRohit\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nSir Jadeja\nDhoni\nDhoni\nYuvraj\nRohit\nRaina\nRohit\nDhoni\nRohit\nDhoni\nDhawan\nYuvraj\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nSir Jadeja\nRaina\nRohit\nDhoni\nYuvraj\nSir Jadeja\nYuvraj\nDhoni\nYuvraj\nRohit\nRaina\nSir Jadeja\nYuvraj\nRaina\nDhawan\nKohli\nRaina\nRaina\nRaina\nRohit\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nDhawan\nSir Jadeja\nKohli\nDhawan\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nRaina\nDhoni\nRaina\nYuvraj\nKohli\nDhoni\nDhawan\nYuvraj\nYuvraj\nSir Jadeja\nKohli\nRaina\nDhoni\nRaina\nKohli\nRohit\nRohit\nRaina\nSir Jadeja\nDhawan\nDhawan\nDhawan\nDhoni\nSir Jadeja\nRaina\nRaina\nYuvraj\nSir Jadeja\nRohit\nRaina\nYuvraj\nYuvraj\nYuvraj\nDhawan\nYuvraj\nDhoni\nDhawan\nKohli\nKohli\nSir Jadeja\nRaina\nDhoni\nYuvraj\nDhawan\nRaina\nRohit\nYuvraj\nDhoni\nRaina\nRaina\nYuvraj\nKohli\nKohli\nRaina\nRohit\nRohit\nRohit\nRohit\nSir Jadeja\nYuvraj\nDhoni\nRaina\nSir Jadeja\nKohli\nYuvraj\nSir Jadeja\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhawan\nRaina\nRohit\nYuvraj\nSir Jadeja\nDhoni\nYuvraj\nRohit\nKohli\nRaina\nRohit\nYuvraj\nDhoni\nDhawan\nRohit\nYuvraj\nRohit\nDhoni\nRohit\nRaina\nDhoni\nYuvraj\nSir Jadeja\nRaina\nDhawan\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nYuvraj\nRohit\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nDhoni\nDhoni\nYuvraj\nRaina\nDhawan\nDhoni\nKohli\nSir Jadeja\nRohit\nDhoni\nSir Jadeja\nDhawan\nRaina\nDhawan\nRohit\nKohli\nSir Jadeja\nRohit\nRohit\nDhawan\nDhawan\nRaina\nSir Jadeja\nRohit\nDhoni\nYuvraj\nDhawan\nSir Jadeja\nKohli\nDhoni\nRaina\nSir Jadeja\nRaina\nYuvraj\nRaina\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nSir Jadeja\nRohit\nRaina\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nDhoni\nKohli\nYuvraj\nDhawan\nYuvraj\nRohit\nSir Jadeja\nDhawan\nSir Jadeja\nDhoni\nDhawan\nRaina\nRaina\nDhoni\nKohli\nRohit\nDhoni\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nRaina\nKohli\nYuvraj\nKohli\nYuvraj\nKohli\nSir Jadeja\nKohli\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nRaina\nRaina\nKohli\nRohit\nKohli\nKohli\nRaina\nSir Jadeja\nYuvraj\nDhawan\nKohli\nRohit\nRaina\nDhawan\nRohit\nRohit\nRohit\nDhoni\nSir Jadeja\nDhawan\nRaina\nDhoni\nYuvraj\nDhawan\nYuvraj\nDhawan\nDhawan\nKohli\nDhawan\nYuvraj\nDhawan\nRohit\nDhawan\nDhawan\nYuvraj\nRohit\nRohit\nRaina\nDhawan\nYuvraj\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nDhoni\nSir Jadeja\nRaina\nRaina\nDhoni\nRaina\nKohli\nYuvraj\nDhoni\nDhoni\nYuvraj\nDhoni\nRohit\nRohit\n",
"Rohit\nKohli\nRaina\nDhoni\nRohit\nRaina\nDhoni\nRohit\nRohit\nDhawan\nKohli\nYuvraj\nDhawan\nRaina\nRaina\nRohit\nRohit\nRohit\nDhoni\nYuvraj\nDhoni\nDhoni\nYuvraj\nKohli\nDhoni\nSir Jadeja\nSir Jadeja\nDhoni\nRaina\nYuvraj\nRohit\nRohit\nDhawan\nYuvraj\nDhawan\nRohit\nKohli\nDhawan\nKohli\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nRohit\nKohli\nRaina\nDhoni\nDhawan\nYuvraj\nYuvraj\nRaina\nDhoni\nRaina\nRohit\nYuvraj\nDhawan\nDhawan\nDhoni\nSir Jadeja\nKohli\nDhoni\nSir Jadeja\nDhawan\nSir Jadeja\nRaina\nRohit\nRohit\nRohit\nDhawan\nSir Jadeja\nDhoni\nSir Jadeja\nKohli\nYuvraj\nYuvraj\nRohit\nYuvraj\nYuvraj\nDhawan\nDhoni\nKohli\nRaina\nRaina\nDhawan\nSir Jadeja\nSir Jadeja\nKohli\nDhoni\nDhoni\nRaina\nDhoni\nSir Jadeja\nRohit\nRaina\nDhoni\nRohit\nRaina\nSir Jadeja\nRohit\nRohit\nRaina\nRohit\nRaina\nKohli\nDhoni\nRaina\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nDhawan\nRohit\nDhawan\nYuvraj\nRohit\nSir Jadeja\nDhoni\nDhoni\nKohli\nDhoni\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhoni\nKohli\nRaina\nSir Jadeja\nRohit\nDhoni\nSir Jadeja\nSir Jadeja\nKohli\nKohli\nDhawan\nDhoni\nDhoni\nDhoni\nRohit\nYuvraj\nYuvraj\nYuvraj\nDhawan\nSir Jadeja\nDhawan\nYuvraj\nRohit\nRohit\nSir Jadeja\nDhoni\nSir Jadeja\nRohit\nRohit\nDhoni\nDhoni\nDhoni\nKohli\nRohit\nRohit\nRohit\nSir Jadeja\nRaina\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nRohit\nSir Jadeja\nKohli\nRohit\nKohli\nRaina\nYuvraj\nYuvraj\nRaina\nRaina\nSir Jadeja\nYuvraj\nRaina\nRohit\nKohli\nRohit\nRohit\nRohit\nDhawan\nRaina\nRaina\nDhoni\nRaina\nDhawan\nRaina\nKohli\nRohit\nSir Jadeja\nKohli\nDhawan\nYuvraj\nDhawan\nRaina\nRaina\nYuvraj\nDhoni\nKohli\nDhawan\nRohit\nRaina\nRaina\nKohli\nYuvraj\nYuvraj\nRaina\nSir Jadeja\nDhawan\nRaina\nRohit\nDhoni\nKohli\nYuvraj\nSir Jadeja\nKohli\nKohli\nKohli\nDhoni\nDhoni\nDhawan\nDhawan\nRaina\nDhoni\nSir Jadeja\nRaina\nDhoni\nDhoni\nSir Jadeja\nYuvraj\nYuvraj\nDhawan\nYuvraj\nYuvraj\nRaina\nYuvraj\nDhawan\nRohit\nRaina\nRohit\nKohli\nYuvraj\nKohli\nDhoni\nYuvraj\nDhoni\nDhawan\nDhawan\nDhoni\nDhoni\nSir Jadeja\nDhoni\nDhoni\nDhoni\nRohit\nDhoni\nDhoni\nRohit\nKohli\nRaina\nYuvraj\nRaina\nRohit\nSir Jadeja\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nKohli\nKohli\nYuvraj\nRohit\nDhoni\nRaina\nRaina\nDhoni\nYuvraj\nYuvraj\nDhoni\nDhawan\nYuvraj\nRaina\nYuvraj\nDhawan\nKohli\nYuvraj\nDhawan\nRaina\nDhoni\nYuvraj\nDhoni\nSir Jadeja\nSir Jadeja\nKohli\nRohit\nRohit\nRaina\nDhoni\nSir Jadeja\nYuvraj\nDhawan\nRaina\nDhawan\nRohit\nKohli\nDhoni\nKohli\nDhawan\nSir Jadeja\nDhoni\nDhoni\nYuvraj\nRohit\nKohli\nRaina\nDhoni\nYuvraj\nDhawan\nRohit\nSir Jadeja\nDhoni\nRaina\nYuvraj\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nYuvraj\nDhawan\nDhoni\nSir Jadeja\nDhawan\nYuvraj\nDhoni\nDhawan\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nRohit\nYuvraj\nDhawan\nDhoni\nRaina\nRaina\nRaina\nDhoni\nRaina\nKohli\nKohli\nDhawan\nDhawan\nRaina\nRaina\nDhawan\nRaina\nDhawan\nRohit\nDhawan\nKohli\nRohit\nSir Jadeja\nRohit\nRaina\nKohli\nRaina\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nRohit\nRaina\nDhawan\nRaina\nRohit\nDhawan\nYuvraj\nDhawan\nDhoni\nDhoni\nKohli\nDhawan\nRohit\nDhoni\nDhoni\nKohli\nSir Jadeja\nDhawan\nRohit\nDhoni\nDhoni\nKohli\nRaina\nDhoni\nRaina\nDhoni\nSir Jadeja\nKohli\nDhawan\nRohit\nDhoni\nRohit\nDhawan\nDhoni\nDhoni\nKohli\nYuvraj\nRaina\nRaina\nRohit\nSir Jadeja\nRaina\nDhawan\nSir Jadeja\nRaina\nYuvraj\nRohit\nDhawan\nSir Jadeja\nRohit\nDhawan\nRohit\nDhawan\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nRohit\nYuvraj\nDhawan\nYuvraj\nRohit\nRohit\nRohit\nKohli\nRaina\nYuvraj\nSir Jadeja\nRohit\nKohli\nYuvraj\nRohit\nDhoni\nRohit\nRaina\nYuvraj\nRaina\nRaina\nRohit\nDhoni\nRaina\nRaina\nDhawan\nDhoni\nDhawan\nYuvraj\nKohli\nRaina\nKohli\nSir Jadeja\nKohli\nDhawan\nKohli\nKohli\nYuvraj\nRaina\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhawan\nKohli\nDhoni\nDhawan\nRohit\nRohit\nDhoni\nDhoni\nYuvraj\nDhoni\nDhawan\nYuvraj\nDhawan\nRohit\nDhoni\nRaina\nYuvraj\nDhawan\nYuvraj\nRohit\nRaina\nYuvraj\nRaina\nSir Jadeja\nDhoni\nKohli\nSir Jadeja\nDhawan\nRohit\nDhawan\nSir Jadeja\nRaina\nRohit\nRaina\nRaina\nRaina\nKohli\nYuvraj\nDhoni\nRaina\nSir Jadeja\nYuvraj\nRohit\nDhawan\nDhawan\nRohit\nRaina\nSir Jadeja\nRohit\nSir Jadeja\nDhoni\nKohli\nSir Jadeja\nRohit\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nKohli\nYuvraj\nKohli\nRaina\nDhawan\nDhoni\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nSir Jadeja\nRohit\nRaina\nDhoni\nRaina\nYuvraj\nSir Jadeja\nDhoni\nRaina\nDhoni\nKohli\nKohli\nSir Jadeja\nSir Jadeja\nRohit\nYuvraj\nSir Jadeja\nRaina\nRohit\nDhawan\nDhoni\nRaina\nRaina\nRaina\nDhoni\nDhoni\nDhawan\nRaina\nRohit\nRohit\nDhawan\nDhawan\nYuvraj\nRaina\nRohit\nRaina\nSir Jadeja\nRohit\nYuvraj\nDhoni\nYuvraj\nSir Jadeja\nSir Jadeja\nSir Jadeja\nRaina\nSir Jadeja\nDhawan\nRohit\nRaina\nRohit\nKohli\nDhawan\nRaina\nDhoni\nRaina\nKohli\nRohit\nRaina\nRohit\nYuvraj\nDhoni\nRaina\nYuvraj\nYuvraj\nDhoni\nYuvraj\nDhawan\nDhoni\nDhoni\nDhoni\nSir Jadeja\nSir Jadeja\nDhoni\nDhawan\nDhoni\nRaina\nDhawan\nYuvraj\nRohit\nDhawan\nRaina\nSir Jadeja\nDhoni\nDhoni\nSir Jadeja\nDhoni\nYuvraj\nRohit\nRohit\nRaina\nRohit\nRohit\nSir Jadeja\nDhawan\nDhawan\nYuvraj\nRohit\nKohli\nRohit\nRohit\nRohit\nKohli\nDhoni\nKohli\nRaina\nRohit\nYuvraj\nDhoni\nDhawan\nKohli\nRaina\nRohit\nDhawan\nYuvraj\nRohit\nRohit\nSir Jadeja\nKohli\nDhoni\nDhawan\nRaina\nYuvraj\nDhoni\nRohit\nDhawan\nRohit\nDhawan\nRohit\nRaina\nRaina\nSir Jadeja\nDhoni\nDhawan\nDhoni\nDhoni\nDhawan\nSir Jadeja\nKohli\nDhoni\nDhoni\nDhoni\nKohli\nRaina\nRaina\nSir Jadeja\nYuvraj\nKohli\nDhoni\nKohli\nRohit\nYuvraj\nYuvraj\nRohit\nDhoni\nSir Jadeja\nSir Jadeja\nSir Jadeja\nYuvraj\nDhoni\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nKohli\nDhoni\nSir Jadeja\nYuvraj\nRaina\nDhawan\nRaina\nYuvraj\nRaina\nSir Jadeja\nDhawan\nRohit\nRaina\nRaina\nSir Jadeja\nRaina\nDhawan\nYuvraj\nSir Jadeja\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nRaina\nSir Jadeja\nDhoni\nRohit\nRohit\nKohli\nDhoni\nRaina\nSir Jadeja\nSir Jadeja\nDhawan\nDhawan\nYuvraj\nDhawan\nRohit\nSir Jadeja\nSir Jadeja\nKohli\nRohit\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRohit\nRohit\nKohli\nSir Jadeja\nRaina\nRohit\nDhawan\nRaina\nDhoni\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nSir Jadeja\nRaina\nDhawan\nSir Jadeja\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nDhawan\nRohit\nDhawan\nRohit\nDhoni\nYuvraj\nDhawan\nRohit\nRohit\nDhoni\nRohit\nRaina\nKohli\nRohit\nKohli\nRohit\nRohit\nSir Jadeja\nRaina\nYuvraj\nKohli\nRaina\nDhoni\nSir Jadeja\nRaina\nDhawan\nRaina\nDhawan\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nKohli\nRaina\nRohit\nRaina\nYuvraj\nSir Jadeja\nKohli\nDhoni\nRohit\nYuvraj\nSir Jadeja\nDhoni\nDhoni\nRaina\nRohit\nRohit\nDhawan\nKohli\nKohli\nDhawan\nDhoni\nDhawan\nRaina\nDhoni\nKohli\nDhoni\nRaina\nDhawan\nRaina\nRohit\nSir Jadeja\nKohli\nRohit\nDhawan\nSir Jadeja\nRohit\nYuvraj\nRaina\nYuvraj\nRaina\nRohit\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nSir Jadeja\nDhoni\nRohit\nDhawan\nRaina\nDhawan\nDhoni\nDhoni\nDhawan\nSir Jadeja\nRohit\nSir Jadeja\nDhoni\nDhawan\nRohit\nRohit\nRohit\nYuvraj\nDhoni\nRohit\nKohli\nDhoni\nRohit\nYuvraj\nDhoni\nRaina\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nRohit\nRohit\nDhawan\nYuvraj\nKohli\nKohli\nRohit\nRohit\nKohli\nRohit\nKohli\nYuvraj\nSir Jadeja\nDhawan\nRaina\nKohli\nRohit\nKohli\nYuvraj\nRohit\nKohli\nRohit\nDhawan\nRohit\nRohit\nDhoni\nYuvraj\nDhoni\nDhoni\nRohit\nRohit\nDhawan\nDhawan\nRohit\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nSir Jadeja\nYuvraj\nYuvraj\nRohit\nRohit\nKohli\nKohli\nRohit\nSir Jadeja\nSir Jadeja\nKohli\nYuvraj\nRohit\nRaina\nDhoni\nRohit\nRohit\nYuvraj\nDhawan\nDhoni\nKohli\nSir Jadeja\nRohit\nRohit\nDhoni\nRohit\nRohit\nSir Jadeja\nKohli\nRaina\nKohli\nKohli\nSir Jadeja\nRohit\nRaina\nDhoni\nKohli\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nRaina\nRohit\nDhoni\nKohli\nYuvraj\nRohit\nRohit\nYuvraj\nYuvraj\nYuvraj\nYuvraj\nRaina\nSir Jadeja\nRohit\nRaina\nRohit\nSir Jadeja\nSir Jadeja\nYuvraj\nSir Jadeja\nRohit\nRaina\nYuvraj\nRohit\nYuvraj\nRohit\nRaina\nRohit\nDhawan\nDhawan\nYuvraj\n",
"Rohit\nKohli\nKohli\nRohit\nSir Jadeja\nDhoni\nDhawan\nRohit\nDhoni\nDhoni\nRaina\nKohli\nKohli\nRohit\nDhawan\nRohit\nKohli\nRohit\nRohit\nYuvraj\nKohli\nDhawan\nKohli\nKohli\nDhawan\nRohit\nYuvraj\nDhawan\nDhoni\nRohit\nDhoni\nDhawan\nSir Jadeja\nDhawan\nRaina\nSir Jadeja\nDhoni\nSir Jadeja\nKohli\nKohli\nRohit\nRohit\nDhawan\nDhawan\nYuvraj\nDhawan\nYuvraj\nRohit\nRaina\nDhawan\nDhawan\nDhoni\nYuvraj\nRaina\nDhawan\nKohli\nYuvraj\nRohit\nDhawan\nDhoni\nYuvraj\nRohit\nSir Jadeja\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nRaina\nSir Jadeja\nYuvraj\nDhawan\nKohli\nYuvraj\nSir Jadeja\nRohit\nKohli\nRohit\nDhoni\nRohit\nDhawan\nDhoni\nRaina\nYuvraj\nRaina\nRohit\nDhawan\nYuvraj\nKohli\nSir Jadeja\nDhoni\nRohit\nSir Jadeja\nDhawan\nDhawan\nRohit\nRohit\nKohli\nRaina\nYuvraj\nDhawan\nRaina\nYuvraj\nSir Jadeja\nDhawan\nRaina\nKohli\nRaina\nRohit\nKohli\nDhawan\nRohit\nRohit\nRohit\nKohli\nDhawan\nRaina\nRohit\nYuvraj\nDhoni\nKohli\nKohli\nRohit\nRaina\nRohit\nDhoni\nDhoni\nRohit\nRaina\nRaina\nDhawan\nDhawan\nRohit\nDhoni\nKohli\nDhawan\nDhawan\nKohli\nKohli\nRohit\nDhawan\nKohli\nRaina\nRohit\nRaina\nDhoni\nDhoni\nDhawan\nRohit\nSir Jadeja\nRaina\nKohli\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nKohli\nDhoni\nDhawan\nKohli\nRohit\nRaina\nRohit\nDhoni\nKohli\nKohli\nDhoni\nYuvraj\nKohli\nRaina\nYuvraj\nDhawan\nRohit\nRaina\nDhawan\nRohit\nDhawan\nRohit\nDhawan\nKohli\nDhoni\nRohit\nSir Jadeja\nDhawan\nRohit\nRohit\nRohit\nDhawan\nDhawan\nSir Jadeja\nKohli\nYuvraj\nDhawan\nRohit\nDhoni\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRaina\nKohli\nDhoni\nRohit\nSir Jadeja\nRohit\nRaina\nRohit\nRohit\nDhawan\nRaina\nRaina\nRaina\nDhoni\nKohli\nYuvraj\nDhoni\nDhoni\nRaina\nDhoni\nYuvraj\nDhawan\nDhawan\nDhoni\nYuvraj\nSir Jadeja\nYuvraj\nRaina\nRaina\nRaina\nSir Jadeja\nDhawan\nKohli\nRohit\nKohli\nKohli\nSir Jadeja\nYuvraj\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nRaina\nDhawan\nKohli\nDhoni\nKohli\nKohli\nDhoni\nRohit\nKohli\nKohli\nKohli\nRohit\nDhoni\nDhawan\nDhoni\nSir Jadeja\nRaina\nYuvraj\nRohit\nKohli\nYuvraj\nRohit\nRohit\nSir Jadeja\nDhawan\nDhoni\nRohit\nDhawan\nRohit\nRohit\nKohli\nRohit\nKohli\nRohit\nRaina\nKohli\nKohli\nDhawan\nDhoni\nDhoni\nRohit\nKohli\nRaina\nDhawan\nKohli\nDhoni\nRaina\nDhawan\nYuvraj\nRohit\nRaina\nKohli\nDhoni\nKohli\nDhawan\nDhawan\nRaina\nRohit\nDhawan\nDhawan\nRaina\nKohli\nRaina\nRohit\nYuvraj\nRohit\nRohit\nYuvraj\nKohli\nDhawan\nDhawan\nRohit\nRaina\nSir Jadeja\nDhawan\nRohit\nYuvraj\nRohit\nRohit\nSir Jadeja\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nSir Jadeja\nDhawan\nDhoni\nYuvraj\nDhawan\nKohli\nRaina\nRaina\nDhoni\nRaina\nRohit\nSir Jadeja\nRohit\nKohli\nRohit\nDhoni\nRohit\nRaina\nDhawan\nDhoni\nDhoni\nRohit\nDhoni\nRaina\nSir Jadeja\nKohli\nRohit\nDhoni\nDhawan\nDhoni\nRohit\nKohli\nYuvraj\nDhoni\nRohit\nSir Jadeja\nYuvraj\nRohit\nRaina\nSir Jadeja\nRaina\nRohit\nRohit\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nRaina\nRohit\nYuvraj\nRohit\nDhoni\nKohli\nDhoni\nRohit\nRohit\nDhawan\nYuvraj\nDhawan\nRohit\nRohit\nRohit\nRaina\nKohli\nDhawan\nDhawan\nRohit\nDhawan\nDhoni\nDhawan\nSir Jadeja\nRohit\nRohit\nSir Jadeja\nDhoni\nRaina\nRohit\nRaina\nYuvraj\nKohli\nRohit\nRohit\nDhawan\nRohit\nKohli\nDhoni\nDhoni\nKohli\nRohit\nDhawan\nSir Jadeja\nYuvraj\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nRaina\nDhawan\nDhawan\nKohli\nYuvraj\nRohit\nRohit\nSir Jadeja\nYuvraj\nYuvraj\nSir Jadeja\nYuvraj\nKohli\nDhoni\nKohli\nYuvraj\nRaina\nRaina\nRohit\nRohit\nDhoni\nDhoni\nDhoni\nSir Jadeja\nKohli\nRaina\nRohit\nYuvraj\nKohli\nKohli\nDhoni\nRohit\nRohit\nRaina\nDhoni\nDhoni\nRaina\nSir Jadeja\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nRohit\nDhoni\nKohli\nYuvraj\nSir Jadeja\nRohit\nDhoni\nDhawan\nRaina\nSir Jadeja\nDhawan\nRohit\nSir Jadeja\nRohit\nRohit\nYuvraj\nSir Jadeja\nRohit\nSir Jadeja\nRohit\nDhoni\nRohit\nRohit\nYuvraj\nRohit\nRohit\nRohit\nKohli\nDhawan\nSir Jadeja\nRaina\nYuvraj\nYuvraj\nRohit\nRohit\nKohli\nSir Jadeja\nDhoni\nRohit\nDhoni\nYuvraj\nYuvraj\nYuvraj\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nDhoni\nKohli\nKohli\nDhawan\nKohli\nRohit\nYuvraj\nRohit\nRaina\nRaina\nRohit\nRaina\nRaina\nYuvraj\nDhawan\nYuvraj\nDhawan\nRohit\nDhawan\nRaina\nSir Jadeja\nRaina\nSir Jadeja\nRohit\nKohli\nRaina\nSir Jadeja\nYuvraj\nRohit\nKohli\nDhawan\nKohli\nDhoni\nRohit\nDhoni\nRohit\nYuvraj\nRohit\nYuvraj\nKohli\nRohit\nRaina\nDhoni\nYuvraj\nYuvraj\nDhoni\nRaina\nRohit\nDhawan\nDhawan\nRaina\nSir Jadeja\nKohli\nDhawan\nRohit\nRaina\nKohli\nDhawan\nKohli\nKohli\nKohli\nRaina\nDhawan\nDhawan\nDhoni\nRohit\nKohli\nDhawan\nDhawan\nRaina\nKohli\nRohit\nRaina\nDhoni\nYuvraj\nDhoni\nYuvraj\nKohli\nSir Jadeja\nRohit\nDhawan\nDhoni\nKohli\nDhawan\nKohli\nKohli\nYuvraj\nYuvraj\nRaina\nSir Jadeja\nKohli\nKohli\nKohli\nRaina\nRaina\nYuvraj\nDhawan\nSir Jadeja\nRohit\nRohit\nKohli\nRohit\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nSir Jadeja\nRohit\nKohli\nDhoni\nRaina\nYuvraj\nYuvraj\nDhawan\nRohit\nYuvraj\nSir Jadeja\nYuvraj\nRohit\nRohit\nRohit\nDhawan\nRohit\nRohit\nRaina\nYuvraj\nRohit\nDhawan\nDhoni\nDhoni\nDhawan\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nSir Jadeja\nDhoni\nKohli\nKohli\nSir Jadeja\nRohit\nRohit\nYuvraj\nRohit\nDhoni\nSir Jadeja\nRaina\nRaina\nRohit\nDhawan\nRohit\nDhoni\nRohit\nKohli\nRohit\nRohit\nKohli\nRohit\nYuvraj\nRohit\nSir Jadeja\nDhawan\nDhoni\nSir Jadeja\nRohit\nDhawan\nDhawan\nKohli\nDhoni\nSir Jadeja\nDhawan\nDhawan\nDhoni\nDhoni\nRohit\nRaina\nRohit\nRohit\nRohit\nKohli\nRaina\nDhoni\nKohli\nRaina\nSir Jadeja\nRaina\nDhoni\nYuvraj\nRohit\nDhawan\nRaina\nRohit\nRaina\nKohli\nRaina\nYuvraj\nRaina\nRohit\nRaina\nDhawan\nRohit\nDhoni\nRohit\nYuvraj\nDhoni\nDhoni\nRohit\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nDhoni\nDhawan\nDhawan\nDhawan\nDhoni\nDhoni\nDhoni\nDhoni\nRohit\nKohli\nSir Jadeja\nDhawan\nRohit\nDhoni\nRohit\nKohli\nDhoni\nRaina\nRohit\nDhawan\nKohli\nRohit\nRohit\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nKohli\nKohli\nKohli\nDhawan\nDhoni\nRaina\nRohit\nYuvraj\nKohli\nDhoni\nDhawan\nSir Jadeja\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nRohit\nRaina\nKohli\nSir Jadeja\nRohit\nYuvraj\nRohit\nYuvraj\nKohli\nRaina\nYuvraj\nRohit\nDhoni\nRohit\nKohli\nRohit\nSir Jadeja\nRohit\nRaina\nSir Jadeja\nDhawan\nYuvraj\nSir Jadeja\nRaina\nKohli\nRohit\nDhoni\nDhawan\nDhoni\nYuvraj\nDhoni\nSir Jadeja\nRaina\nRohit\nKohli\nRaina\nKohli\nRohit\nDhawan\nYuvraj\nSir Jadeja\nYuvraj\nDhoni\nRohit\nKohli\nRohit\nYuvraj\nYuvraj\nKohli\nKohli\nRohit\nDhoni\nRohit\nRohit\nDhoni\nDhoni\nKohli\nYuvraj\nSir Jadeja\nRaina\nDhawan\nRohit\nYuvraj\nRohit\nRaina\nSir Jadeja\nDhawan\nYuvraj\nSir Jadeja\nKohli\nYuvraj\nYuvraj\nKohli\nYuvraj\nKohli\nYuvraj\nDhoni\nDhawan\nYuvraj\nRaina\nDhawan\nDhawan\nSir Jadeja\nRohit\nRaina\nDhoni\nDhoni\nRaina\nRohit\nDhoni\nRaina\nDhoni\nYuvraj\nRaina\nKohli\nSir Jadeja\nDhoni\nDhoni\nDhoni\nDhoni\nRaina\nKohli\nRohit\nSir Jadeja\nDhoni\nSir Jadeja\nRaina\nDhawan\nDhawan\nRohit\nYuvraj\nDhoni\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nSir Jadeja\nSir Jadeja\nRohit\nRohit\nRohit\nKohli\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nRaina\nYuvraj\nSir Jadeja\nRaina\nKohli\nSir Jadeja\nRohit\nSir Jadeja\nKohli\nSir Jadeja\nRohit\nRaina\nDhawan\nDhoni\nKohli\nDhawan\nKohli\nDhawan\nKohli\nRohit\nKohli\nDhawan\nSir Jadeja\nYuvraj\nDhawan\nDhoni\nRohit\nRaina\nRaina\nDhoni\nRaina\nRohit\nSir Jadeja\nYuvraj\nSir Jadeja\nSir Jadeja\nYuvraj\nRohit\nDhawan\nKohli\nKohli\nDhawan\nRaina\nRohit\nRohit\nKohli\nRaina\nDhoni\nRohit\nDhawan\nRohit\nRohit\nRohit\nYuvraj\nDhawan\nDhoni\nKohli\nRaina\nRaina\nDhoni\nKohli\nDhoni\nDhawan\nDhoni\nYuvraj\nDhawan\nSir Jadeja\nDhoni\nRaina\nSir Jadeja\nDhawan\nDhawan\nDhoni\nDhoni\nRaina\nRohit\nRohit\nKohli\nYuvraj\nDhoni\nRaina\nSir Jadeja\nKohli\nKohli\nRohit\nDhoni\nSir Jadeja\nYuvraj\nDhoni\nYuvraj\nRohit\nRohit\nKohli\nKohli\nRohit\nDhawan\nKohli\nSir Jadeja\nYuvraj\nYuvraj\nKohli\nDhoni\nSir Jadeja\nRohit\nYuvraj\nDhoni\n",
"Rohit\nRohit\nYuvraj\nRohit\nDhoni\nDhawan\nRaina\nRohit\nDhawan\nYuvraj\nSir Jadeja\nDhoni\nDhawan\nKohli\nDhawan\nRaina\nDhawan\nDhoni\nYuvraj\nSir Jadeja\nDhawan\nKohli\nSir Jadeja\nDhoni\nDhoni\nRohit\nRaina\nDhoni\nRohit\nRohit\nDhoni\nSir Jadeja\nKohli\nDhoni\nRohit\nRohit\nYuvraj\nYuvraj\nDhoni\nKohli\nRohit\nDhoni\nSir Jadeja\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nDhoni\nDhoni\nSir Jadeja\nRohit\nRaina\nDhoni\nSir Jadeja\nRaina\nRaina\nSir Jadeja\nKohli\nDhoni\nDhoni\nRohit\nRaina\nRohit\nRohit\nRohit\nRaina\nDhawan\nDhoni\nRaina\nRaina\nDhoni\nDhoni\nRaina\nDhawan\nDhoni\nRohit\nRohit\nYuvraj\nSir Jadeja\nSir Jadeja\nDhoni\nRaina\nRohit\nRohit\nDhawan\nRohit\nDhawan\nSir Jadeja\nSir Jadeja\nKohli\nRohit\nRohit\nKohli\nRaina\nRaina\nDhoni\nDhawan\nSir Jadeja\nSir Jadeja\nRohit\nDhoni\nDhoni\nRohit\nDhawan\nKohli\nRohit\nYuvraj\nRohit\nSir Jadeja\nDhawan\nRohit\nDhawan\nRohit\nRohit\nKohli\nSir Jadeja\nDhawan\nDhawan\nKohli\nKohli\nDhoni\nKohli\nDhawan\nDhoni\nSir Jadeja\nDhawan\nYuvraj\nRohit\nRaina\nDhoni\nRohit\nDhawan\nKohli\nKohli\nDhoni\nYuvraj\nKohli\nRohit\nYuvraj\nSir Jadeja\nKohli\nKohli\nDhawan\nKohli\nDhawan\nYuvraj\nDhoni\nSir Jadeja\nDhawan\nDhoni\nDhoni\nDhawan\nYuvraj\nKohli\nRaina\nYuvraj\nRaina\nRohit\nYuvraj\nSir Jadeja\nKohli\nRaina\nYuvraj\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nSir Jadeja\nDhawan\nDhoni\nKohli\nSir Jadeja\nKohli\nDhawan\nYuvraj\nDhawan\nYuvraj\nRaina\nRaina\nYuvraj\nDhawan\nYuvraj\nRaina\nRaina\nDhoni\nRohit\nRohit\nYuvraj\nYuvraj\nDhoni\nDhawan\nSir Jadeja\nKohli\nDhawan\nRohit\nRohit\nKohli\nRaina\nDhoni\nKohli\nYuvraj\nRohit\nDhawan\nRohit\nRohit\nRohit\nRaina\nKohli\nRohit\nRohit\nRohit\nKohli\nDhoni\nDhawan\nRohit\nDhoni\nDhawan\nKohli\nSir Jadeja\nSir Jadeja\nDhoni\nDhawan\nDhoni\nRaina\nDhawan\nKohli\nRaina\nRohit\nDhoni\nSir Jadeja\nYuvraj\nRohit\nYuvraj\nRohit\nDhawan\nRohit\nRohit\nYuvraj\nSir Jadeja\nYuvraj\nSir Jadeja\nKohli\nSir Jadeja\nYuvraj\nDhoni\nDhoni\nYuvraj\nRohit\nSir Jadeja\nRohit\nKohli\nKohli\nDhoni\nDhawan\nRaina\nRohit\nDhawan\nKohli\nSir Jadeja\nRaina\nSir Jadeja\nKohli\nRohit\nDhawan\nYuvraj\nRaina\nRaina\nRohit\nDhoni\nRohit\nSir Jadeja\nRaina\nYuvraj\nSir Jadeja\nYuvraj\nRaina\nRohit\nRaina\nYuvraj\nSir Jadeja\nDhawan\nDhawan\nDhoni\nYuvraj\nYuvraj\nSir Jadeja\nRohit\nYuvraj\nKohli\nSir Jadeja\nYuvraj\nKohli\nDhawan\nRohit\nDhawan\nYuvraj\nKohli\nRohit\nDhoni\nYuvraj\nRohit\nRaina\nYuvraj\nDhoni\nRohit\nKohli\nDhawan\nSir Jadeja\nRohit\nDhawan\nSir Jadeja\nKohli\nDhawan\nDhoni\nDhoni\nRohit\nSir Jadeja\nYuvraj\nYuvraj\nRohit\nRaina\nDhoni\nRaina\nRohit\nRohit\nDhoni\nYuvraj\nYuvraj\nSir Jadeja\nSir Jadeja\nDhawan\nSir Jadeja\nSir Jadeja\nRaina\nDhawan\nDhawan\nYuvraj\nKohli\nRohit\nDhawan\nSir Jadeja\nSir Jadeja\nDhawan\nRohit\nDhawan\nSir Jadeja\nDhawan\nKohli\nDhawan\nSir Jadeja\nRohit\nRohit\nRaina\nRohit\nDhoni\nRaina\nSir Jadeja\nRohit\nDhoni\nKohli\nDhoni\nYuvraj\nKohli\nRohit\nRaina\nYuvraj\nRohit\nKohli\nRohit\nRaina\nDhawan\nDhawan\nYuvraj\nRohit\nRaina\nKohli\nSir Jadeja\nKohli\nKohli\nDhoni\nDhawan\nRohit\nDhoni\nYuvraj\nKohli\nRohit\nRohit\nRohit\nYuvraj\nRaina\nSir Jadeja\nRohit\nYuvraj\nDhoni\nRohit\nDhawan\nDhoni\nDhawan\nYuvraj\nRohit\nSir Jadeja\nRaina\nDhawan\nYuvraj\nRaina\nDhoni\nKohli\nSir Jadeja\nRaina\nRohit\nKohli\nRaina\nKohli\nDhoni\nSir Jadeja\nSir Jadeja\nRaina\nSir Jadeja\nRaina\nKohli\nDhoni\nKohli\nSir Jadeja\nDhawan\nRohit\nKohli\nDhawan\nRaina\nKohli\nRohit\nKohli\nYuvraj\nRohit\nYuvraj\nSir Jadeja\nDhawan\nKohli\nKohli\nRaina\nRohit\nRaina\nRohit\nRohit\nRaina\nDhawan\nDhawan\nDhoni\nRohit\nDhoni\nRohit\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRaina\nRohit\nYuvraj\nRohit\nRaina\nDhoni\nRaina\nYuvraj\nKohli\nKohli\nSir Jadeja\nYuvraj\nDhoni\nSir Jadeja\nDhawan\nRohit\nRaina\nYuvraj\nRohit\nKohli\nRaina\nKohli\nDhoni\nDhawan\nKohli\nDhawan\nDhoni\nYuvraj\nKohli\nRaina\nDhoni\nDhoni\nRohit\nRohit\nKohli\nDhoni\nDhoni\nDhoni\nDhoni\nRohit\nDhawan\nRaina\nDhoni\nYuvraj\nDhawan\nYuvraj\nSir Jadeja\nRaina\nDhoni\nKohli\nRaina\nRohit\nYuvraj\nRaina\nDhoni\nDhawan\nRaina\nRohit\nKohli\nDhawan\nDhawan\nRohit\nRohit\nDhawan\nRohit\nSir Jadeja\nRaina\nKohli\nDhoni\nSir Jadeja\nSir Jadeja\nDhawan\nSir Jadeja\nSir Jadeja\nYuvraj\nDhawan\nRaina\nRohit\nKohli\nKohli\nDhoni\nRohit\nKohli\nDhoni\nRohit\nSir Jadeja\nKohli\nDhawan\nRohit\nRaina\nYuvraj\nRohit\nDhawan\nSir Jadeja\nKohli\nDhoni\nDhoni\nDhawan\nYuvraj\nYuvraj\nRaina\nRohit\nKohli\nDhawan\nDhawan\nDhoni\nRohit\nYuvraj\nYuvraj\nSir Jadeja\nDhoni\nYuvraj\nYuvraj\nRohit\nYuvraj\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhoni\nRohit\nKohli\nSir Jadeja\nRaina\nDhoni\nYuvraj\nDhoni\nKohli\nDhoni\nRaina\nKohli\nKohli\nSir Jadeja\nRaina\nSir Jadeja\nDhoni\nDhawan\nDhawan\nYuvraj\nYuvraj\nRaina\nYuvraj\nRohit\nSir Jadeja\nDhawan\nDhoni\nDhawan\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nDhoni\nRohit\nDhoni\nRohit\nYuvraj\nRohit\nRohit\nYuvraj\nKohli\nKohli\nDhawan\nYuvraj\nSir Jadeja\nYuvraj\nRaina\nDhawan\nRaina\nDhoni\nKohli\nRohit\nRohit\nDhawan\nRohit\nRohit\nRohit\nRohit\nDhoni\nRohit\nRaina\nRaina\nDhawan\nDhawan\nRohit\nRaina\nDhawan\nKohli\nSir Jadeja\nDhawan\nSir Jadeja\nRohit\nKohli\nRohit\nRohit\nRaina\nSir Jadeja\nYuvraj\nSir Jadeja\nRohit\nRohit\nRohit\nRaina\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nRaina\nKohli\nKohli\nRaina\nYuvraj\nDhawan\nKohli\nSir Jadeja\nRaina\nRohit\nRohit\nRohit\nDhoni\nSir Jadeja\nRaina\nDhawan\nDhawan\nRohit\nSir Jadeja\nYuvraj\nRohit\nRaina\nRohit\nYuvraj\nYuvraj\nSir Jadeja\nRaina\nYuvraj\nDhawan\nYuvraj\nYuvraj\nRohit\nRohit\nRohit\nRohit\nDhawan\nDhawan\nYuvraj\nDhawan\nRohit\nRaina\nYuvraj\nRohit\nDhawan\nDhawan\nDhawan\nSir Jadeja\nDhoni\nKohli\nDhoni\nYuvraj\nDhawan\nKohli\nRohit\nYuvraj\nDhawan\nDhawan\nDhoni\nDhawan\nRaina\nRohit\nKohli\nDhoni\nRohit\nRaina\nRohit\nRohit\nSir Jadeja\nSir Jadeja\nRohit\nDhoni\nRaina\nDhawan\nDhoni\nSir Jadeja\nYuvraj\nRaina\nRaina\nDhawan\nRohit\nSir Jadeja\nKohli\nSir Jadeja\nRohit\nDhoni\nSir Jadeja\nRohit\nYuvraj\nDhawan\nDhawan\nSir Jadeja\nRaina\nRaina\nSir Jadeja\nDhawan\nKohli\nDhoni\nKohli\nKohli\nDhoni\nRaina\nSir Jadeja\nRohit\nKohli\nYuvraj\nYuvraj\nDhawan\nKohli\nDhoni\nDhoni\nRohit\nDhawan\nKohli\nDhoni\nSir Jadeja\nKohli\nSir Jadeja\nKohli\nYuvraj\nRaina\nRohit\nDhawan\nYuvraj\nDhoni\nRaina\nDhoni\nSir Jadeja\nKohli\nYuvraj\nKohli\nSir Jadeja\nKohli\nKohli\nDhoni\nDhoni\nYuvraj\nDhawan\nRohit\nRohit\nDhoni\nDhawan\nRohit\nKohli\nKohli\nYuvraj\nRaina\nRohit\nSir Jadeja\nYuvraj\nRaina\nKohli\nRohit\nSir Jadeja\nRohit\nKohli\nYuvraj\nDhoni\nSir Jadeja\nKohli\nKohli\nDhoni\nYuvraj\nKohli\nKohli\nKohli\nDhoni\nYuvraj\nSir Jadeja\nDhawan\nYuvraj\nSir Jadeja\nKohli\nDhoni\nSir Jadeja\nRaina\nDhoni\nSir Jadeja\nSir Jadeja\nYuvraj\nYuvraj\nDhoni\nKohli\nYuvraj\nKohli\nYuvraj\nRohit\nSir Jadeja\nRohit\nDhawan\nDhawan\nDhoni\nSir Jadeja\nRohit\nRohit\nYuvraj\nRohit\nKohli\nKohli\nKohli\nRohit\nDhawan\nRohit\nRohit\nRohit\nSir Jadeja\nKohli\nRohit\nSir Jadeja\nRohit\nKohli\nDhoni\nRohit\nRohit\nDhawan\nSir Jadeja\nRaina\nRaina\nYuvraj\nRohit\nDhoni\nRohit\nDhoni\nDhoni\nDhoni\nDhoni\nDhawan\nKohli\nDhoni\nYuvraj\nDhoni\nRaina\nYuvraj\nYuvraj\nKohli\nSir Jadeja\nRohit\nKohli\nRaina\nSir Jadeja\nRohit\nSir Jadeja\nDhoni\nRohit\nDhawan\nRohit\nRaina\nDhoni\nKohli\nDhawan\nRohit\nSir Jadeja\nYuvraj\nKohli\nDhawan\nSir Jadeja\nKohli\nRaina\nDhawan\nSir Jadeja\nDhawan\nYuvraj\nRohit\nYuvraj\nRaina\nDhoni\nDhawan\nRohit\nRaina\nRaina\nRaina\nDhawan\nRaina\nDhoni\nDhawan\nDhoni\nSir Jadeja\nYuvraj\nRaina\nRohit\nSir Jadeja\nDhoni\nKohli\nRohit\nRohit\nSir Jadeja\nYuvraj\nRaina\nDhoni\nDhoni\nRaina\nSir Jadeja\nDhoni\nRohit\nRaina\nRaina\nRohit\nDhawan\nYuvraj\nDhoni\nRaina\nRohit\nDhawan\nRohit\nRohit\nRohit\nDhoni\nRaina\nSir Jadeja\nYuvraj\nKohli\nKohli\nDhawan\nRaina\nRaina\nRaina\nRaina\nRohit\nKohli\nYuvraj\nDhawan\nKohli\nKohli\nSir Jadeja\nSir Jadeja\nYuvraj\nKohli\nRohit\nRaina\nRaina\nKohli\nKohli\nRaina\nDhawan\nYuvraj\nDhoni\nYuvraj\nDhoni\nRaina\nRaina\nSir Jadeja\n",
"Dhawan\nDhoni\n"
] |
CodeContests
|
Chef has learned a new technique for comparing two recipes. A recipe contains a list of ingredients in increasing order of the times they will be processed. An ingredient is represented by a letter 'a'-'z'. The i-th letter in a recipe denotes the i-th ingredient. An ingredient can be used multiple times in a recipe.
The technique is as follows. Compare two recipes by comparing their respective lists. If the sets of ingredients used in both recipes are equal and each ingredient is used the same number of times in both of them (processing order does not matter), they are declared as granama recipes. ("granama" is the Chef-ian word for "similar".)
Chef took two recipes he invented yesterday. He wanted to compare them using the technique. Unfortunately, Chef forgot to keep track of the number of times each ingredient has been used in a recipe. He only compared the ingredients but NOT their frequencies. More precisely, Chef considers two recipes as granama if there are no ingredients which are used in one recipe and not used in the other recipe.
Your task is to report whether Chef has correctly classified the two recipes (as granama or not granama) although he forgot to keep track of the frequencies.
Input
The first line of the input contains a single integer T denoting the number of test cases. The description for T test cases follows. Each test case consists of a single line containing two space-separated strings R and S denoting the two recipes.
Output
For each test case, output a single line containing "YES" (quotes for clarity) if Chef correctly classified the two recipes as granama or not granama. Otherwise, output a single line containing "NO" (quotes for clarity) if Chef declared two recipes as granama when they actually are not.
Constraints
1 ≤ T ≤ 1001 ≤ |R|, |S| ≤ 1000
Example
Input:
3
alex axle
paradise diapers
alice bob
Output:
YES
NO
YES
Explanation:
Example case 1: Chef declared them as granama recipes. They are actually granama because the sets of ingredients and the number of times each ingredient has been used are equal. The Chef got it right!
Example case 2: Chef declared them as granama recipes because both sets of ingredients are equal. But they are NOT granama since ingredient 'a' has been used twice in the first recipe but only once in the second. The Chef was incorrect!
Example case 3: Chef declare them as not granama. They are not granama as the sets of ingredients are different. Hence, the Chef was right!
|
stdin
| null | 2,666 | 1 |
[
"3\nalex axle\nparadise diapers\nalice bob\n"
] |
[
"YES\nNO\nYES\n"
] |
[
"3\nalex axle\nesidarap diapers\nalice bob\n",
"3\nelax axle\nesidarap djapers\nalice bob\n",
"3\nelax axle\nesidarap diapers\nalice bob\n",
"3\nelax ayle\nesidarap djapers\nalice bob\n",
"3\nelax ayle\nesidarap srepajd\nalice bob\n",
"3\nelax ayle\netidarap srepajd\nalice bob\n",
"3\nelax aely\netidarap srepajd\nalice bob\n",
"3\nelax bely\netidarap srepajd\nalice bob\n",
"3\nelax bely\netidarap srepajd\namice bob\n",
"3\nelaw bely\netidarap srepajd\namice bob\n"
] |
[
"YES\nNO\nYES\n",
"YES\nYES\nYES\n",
"YES\nNO\nYES\n",
"YES\nYES\nYES\n",
"YES\nYES\nYES\n",
"YES\nYES\nYES\n",
"YES\nYES\nYES\n",
"YES\nYES\nYES\n",
"YES\nYES\nYES\n",
"YES\nYES\nYES\n"
] |
CodeContests
|
Joisino is about to compete in the final round of a certain programming competition. In this contest, there are N problems, numbered 1 through N. Joisino knows that it takes her T_i seconds to solve problem i(1≦i≦N).
Also, there are M kinds of drinks offered to the contestants, numbered 1 through M. If Joisino takes drink i(1≦i≦M), her brain will be stimulated and the time it takes for her to solve problem P_i will become X_i seconds. It does not affect the time to solve the other problems.
A contestant is allowed to take exactly one of the drinks before the start of the contest. For each drink, Joisino wants to know how many seconds it takes her to solve all the problems if she takes that drink. Here, assume that the time it takes her to solve all the problems is equal to the sum of the time it takes for her to solve individual problems. Your task is to write a program to calculate it instead of her.
Constraints
* All input values are integers.
* 1≦N≦100
* 1≦T_i≦10^5
* 1≦M≦100
* 1≦P_i≦N
* 1≦X_i≦10^5
Input
The input is given from Standard Input in the following format:
N
T_1 T_2 ... T_N
M
P_1 X_1
P_2 X_2
:
P_M X_M
Output
For each drink, calculate how many seconds it takes Joisino to solve all the problems if she takes that drink, and print the results, one per line.
Examples
Input
3
2 1 4
2
1 1
2 3
Output
6
9
Input
5
7 2 3 8 5
3
4 2
1 7
4 13
Output
19
25
30
|
stdin
| null | 1,409 | 1 |
[
"3\n2 1 4\n2\n1 1\n2 3\n",
"5\n7 2 3 8 5\n3\n4 2\n1 7\n4 13\n"
] |
[
"6\n9\n",
"19\n25\n30\n"
] |
[
"3\n2 1 4\n2\n1 1\n0 3\n",
"5\n7 2 3 10 5\n3\n4 2\n1 7\n4 13\n",
"3\n2 1 4\n2\n1 1\n0 6\n",
"5\n7 4 3 10 5\n3\n4 2\n1 7\n4 13\n",
"3\n2 1 4\n2\n1 0\n2 3\n",
"3\n2 1 4\n2\n1 0\n0 3\n",
"5\n7 2 3 10 5\n3\n4 2\n1 7\n4 20\n",
"3\n1 1 4\n2\n1 1\n0 6\n",
"5\n7 4 3 10 5\n3\n4 2\n1 7\n3 13\n",
"3\n2 0 4\n2\n1 0\n0 3\n"
] |
[
"6\n6\n",
"19\n27\n30\n",
"6\n9\n",
"21\n29\n32\n",
"5\n9\n",
"5\n6\n",
"19\n27\n37\n",
"6\n8\n",
"21\n29\n39\n",
"4\n5\n"
] |
CodeContests
|
problem
Cryptography is all the rage at xryuseix's school. Xryuseix, who lives in a grid of cities, has come up with a new cryptography to decide where to meet.
The ciphertext consists of the $ N $ character string $ S $, and the $ S_i $ character determines the direction of movement from the current location. The direction of movement is as follows.
* A ~ M: Go north one square.
* N ~ Z: Go south one square.
* a ~ m: Go east one square.
* n ~ z: Go west one square.
By the way, xryuseix wanted to tell yryuseiy-chan where to meet for a date with a ciphertext, but he noticed that the ciphertext was redundant.
For example, suppose you have the ciphertext "ANA". It goes north by $ 1 $, south by $ 1 $, and then north by $ 1 $. This is equivalent to the ciphertext that goes north by $ 1 $. , "ANA" = "A", which can be simplified. Xryuseix wanted to simplify the ciphertext so that yryuseiy would not make a detour.
So you decided to write a program to simplify the ciphertext instead of xryuseix. Note that "simplify the ciphertext" means "the shortest ciphertext that goes to the same destination as the original ciphertext." To make. "
output
The length of the ciphertext after simplification on the $ 1 $ line, output the ciphertext on the $ 2 $ line. If there are multiple possible ciphertexts as an answer, any of them may be output. Also, each line Output a line break at the end of.
Example
Input
5
ANazA
Output
1
A
|
stdin
| null | 353 | 1 |
[
"5\nANazA\n"
] |
[
"1\nA\n"
] |
[
"5\nAzaNA\n",
"5\nAMazA\n",
"5\nzAaNA\n",
"5\nAzaAN\n",
"5\nzAaNB\n",
"5\nAMAza\n",
"5\nAzaBN\n",
"5\nzAaNC\n",
"5\nAMBza\n",
"5\nNBazA\n"
] |
[
"1\nA\n",
"3\nAAA\n",
"1\nA\n",
"1\nA\n",
"1\nA\n",
"3\nAAA\n",
"1\nA\n",
"1\nA\n",
"3\nAAA\n",
"1\nA\n"
] |
CodeContests
|
Quan_Lank is a great team with some uncommon interests in programming. Sometimes the team loves to solve strings puzzles, sometimes game puzzles and sometimes metrix type puzzles . Yesterday they have added a new interest to their list that is 'number theory' as they have solved some amazing puzzles related to number theory in the school programming contest held yesterday . Out of all the puzzles they got yesterday, one puzzle is still unsolvable . Actualy they are not getting any clue this time. Quan_Lank is a great team in the history of programming but still the team needs your help . so have a look on the puzzle and help the team Quan_Lank .
Puzzle -
Given a positive integer x . You have to find the no. of positive integers d, such that d is the divisor of x, and x and d have at least one common (the same) digit in their decimal representations.
help the team to find the described number.
INPUT :
First line of Input contains no. of test cases T(T ≤ 100).
Each test case contains one line having a single integer x (1 ≤ x ≤ 10^9).
OUTPUT :
For each test case print a single integer - the answer to the problem.
SAMPLE INPUT
2
1
10
SAMPLE OUTPUT
1
2
|
stdin
| null | 324 | 1 |
[
"2\n1\n10\n\nSAMPLE\n"
] |
[
"1\n2\n"
] |
[
"2\n1\n10\n\nSAMQLE\n",
"2\n2\n15\n\nSAMSLE\n",
"2\n2\n2\n\nSAMSLE\n",
"2\n2\n24\n\nSAMSLE\n",
"2\n14\n1\n\nSALPLE\n",
"2\n12\n6\n\nELPMAS\n",
"2\n10\n134\n\nMRL@SD\n",
"2\n4\n378\n\nMRL@SD\n",
"2\n4\n364\n\nMRL@SD\n",
"2\n10\n364\n\nMRL@SD\n"
] |
[
"1\n2\n",
"1\n3\n",
"1\n1\n",
"1\n4\n",
"2\n1\n",
"3\n1\n",
"2\n2\n",
"1\n7\n",
"1\n5\n",
"2\n5\n"
] |
CodeContests
|
Animation is one of methods for making movies and in Japan, it is popular to broadcast as a television program or perform as a movie. Many people, especially the young, love one. And here is an anime lover called Jack. We say he is an mysterious guy with uncertain age. He likes anime which are broadcasted in midnight and early morning especially.
In his room, there is a huge piece of paper on the wall. He writes a timetable of TV anime on it. In his house, he can watch all Japanese TV anime programs that are broadcasted in Japan using a secret and countrywide live system. However he can not watch all anime and must give up to watch some programs because they are "broadcasted at the same time" in a season. Here, programs are "broadcasted at the same time" means that two or more programs have one or more common minutes in broadcasting time. Increasing the number of anime programs in recent makes him nervous. Actually, some people buy DVDs after the program series ends or visit a web site called vhefoo. Anyway, he loves to watch programs on his live system. Of course, he is not able to watch two or more programs at the same time. However, as described above, he must give up some programs broadcasted at the same time. Therefore, he has a set of programs F and he watches programs in a set F absolutely.
Your task is to write a program that reads a timetable and outputs the maximum number of watchable programs, keeping that Jack watches all programs in the set F. Of course, there are multiple choices of programs, so we want the number of programs he can watch. If two or more programs in a set F are broadcasted at the same time, you must give Jack an unfortunate announcement. In this case, your program outputs -1. In addition, each anime program is a program of 30 minutes.
Hint
Second dataset: He can watch program E after watching B. Then he can choose a program either I or J after watching H. Therefore he can watch maximum 4 programs.
Constraints
The number of datasets is less than or equal to 400.
1≤N≤500
Input
Input consists of multiple datasets.
A dataset is given in a following format.
N
PROGRAM1
PROGRAM2
...
PROGRAMN
P
FAV1
FAV2
...
FAVP
N is the number of programs in a season.
PROGRAMi(1≤i≤N)is a string which has the following format.
name weekday start
* name is a program name. This is a a string having between 1 and 32 characters and these names do not overlap each other program. A name consists of alphanumeric characters and '_'(underscore).
* weekday is a broadcasting weekday about the corresponding program. This is an integer. 0 means Sunday and 1 is Monday and so on (2:Tuesday, 3:Wednesday, 4:Thursday, 5:Friday, 6:Saturday).
* start is a starting time of the program broadcasting. This is an integer between 600 and 2929. First one or two digits represent hour and the last two digits represent minute. If the hour has one digit it will be a representation "900" for example. Note: a program may have an integer more than or equal to 2400 as start, if the program begins the next day. For example, a program begins from 2500 on Monday should be interpreted as a program begins from 0100 on Tuesday. There are no input the minute of start exceeds 59. And when the hour of start is equal to 29, there are no input the minute of start exceeds 29.
P is an integer and represents the number of elements in the set F. And FAVi(1≤i≤P≤N) is a string for a program name which Jack watches absolutely. You can assume names which are not given in program descriptions will not appear in the set F.
The last line contains a single 0 which represents the end of input.
Output
For each dataset, output an integer S that represents maximum number of programs Jack can watch in the following format.
S
Example
Input
1
galaxy_angel 0 600
1
galaxy_angel
11
A 0 600
B 0 610
C 0 610
D 0 610
E 0 640
EE 0 700
F 0 710
G 0 710
H 0 710
I 0 740
J 0 750
2
B
H
42
nchj 6 2620
anhnnnmewbktthsrn 4 2515
gntmdsh 1 1800
achnnl 4 2540
hnskirh 0 2200
aonexrcst 0 1700
dgdys 6 2330
hdnnara 4 2525
dnpaonntssotk 4 2555
ddmnwndrlnd 6 2500
C 4 2445
astrttnomch 0 2330
seknnqasr 1 2630
sftnt 4 2630
stnsgt 2 2605
drrnenmknmrmr 4 2610
hnzm 6 2713
yndmsoazzlsn 6 2658
mrahlcalv 4 2615
hshzrhkkrhs 1 900
ortchntsbshni 0 2430
kmnmzshrski 1 2530
sktdnc 4 1800
gykkybrkjhkirkhn 2 2459
trk 0 900
30zzsinhkntiik 3 2700
sngkotmmmirprdx 1 2600
yran 2 2529
tntissygntinybu 1 2614
skiichhtki 5 2505
tgrbnny 6 2558
dnbrsnki 3 1927
yugozxl 1 1930
frbllchrmn 1 1928
fjrg 1 1955
shwmngtr 0 2200
xmn 5 2200
rngnkkrskitikihn 0 2100
szysz 0 1254
prttyrythmaulrdrm 6 1000
sckiesfrntrqst 5 1820
mshdr 1 2255
1
mrahlcalv
0
Output
1
4
31
|
stdin
| null | 4,160 | 1 |
[
"1\ngalaxy_angel 0 600\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 610\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 0 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 2 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1955\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n"
] |
[
"1\n4\n31\n"
] |
[
"1\ngalaxy_angel 0 600\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 610\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 0 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1955\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 600\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 931\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 0 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1955\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 600\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 931\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 0 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 1197\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 931\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 1 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 1197\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 1 610\nD 0 931\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 1 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 600\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 610\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 0 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 2 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyr`n 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1955\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 1197\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 931\nE 0 640\nEE 0 178\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 1 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 1152\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\nkrt 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\niknsrbnd 3 1927\ngxzoluy 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 1197\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 931\nE 0 640\nEE 0 178\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 1 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2080\nhnzm 6 1152\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\nkrt 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\niknsrbnd 3 1927\ngxzoluy 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 1197\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 1 610\nD 0 931\nE 0 640\nEE 0 700\nF 0 710\nG 0 710\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 1 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 4 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 4 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 1 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 865\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n",
"1\ngalaxy_angel 0 1197\n1\ngalaxy_angel\n11\nA 0 600\nB 0 610\nC 0 610\nD 0 931\nE 0 640\nEE 0 700\nF 0 710\nG 0 611\nH 0 710\nI 0 740\nJ 0 750\n2\nB\nH\n42\nnchj 6 2620\nanhnnnmewbktthsrn 4 2515\ngntmdsh 1 1800\nachnnl 4 2540\nhnskirh 0 2200\naonexrcst 0 1700\ndgdys 6 2330\nhdnnara 4 2525\ndnpaonntssotk 4 2555\nddmnwndrlnd 6 2500\nC 3 2445\nastrttnomch 0 2330\nseknnqasr 1 2630\nsftnt 3 2630\nstnsgt 4 2605\ndrrnenmknmrmr 4 2610\nhnzm 6 2713\nyndmsoazzlsn 6 2658\nmrahlcalv 4 2615\nhshzrhkkrhs 1 900\nortchntsbshni 0 2430\nkmnmzshrski 1 2530\nsktdnc 4 1800\ngykkybrkjhkirkhn 2 2459\ntrk 0 900\n30zzsinhkntiik 3 2700\nsngkotmmmirprdx 1 2600\nyran 2 2529\ntntissygntinybu 0 2614\nskiichhtki 5 2505\ntgrbnny 6 2558\ndnbrsnki 3 1927\nyugozxl 1 1930\nfrbllchrmn 1 1928\nfjrg 1 1271\nshwmngtr 0 2200\nxmn 5 2200\nrngnkkrskitikihn 0 2100\nszysz 0 1254\nprttyrythmaulrdrm 6 1000\nsckiesfrntrqst 5 1820\nmshdr 1 2255\n1\nmrahlcalv\n0\n"
] |
[
"1\n4\n30\n",
"1\n5\n30\n",
"1\n5\n31\n",
"1\n5\n32\n",
"1\n6\n32\n",
"1\n4\n31\n",
"1\n6\n33\n",
"1\n6\n34\n",
"1\n6\n31\n",
"1\n5\n33\n"
] |
CodeContests
|
Given is a sequence of integers A_1, A_2, ..., A_N. If its elements are pairwise distinct, print `YES`; otherwise, print `NO`.
Constraints
* 2 ≤ N ≤ 200000
* 1 ≤ A_i ≤ 10^9
* All values in input are integers.
Input
Input is given from Standard Input in the following format:
N
A_1 ... A_N
Output
If the elements of the sequence are pairwise distinct, print `YES`; otherwise, print `NO`.
Examples
Input
5
2 6 1 4 5
Output
YES
Input
6
4 1 3 1 6 2
Output
NO
Input
2
10000000 10000000
Output
NO
|
stdin
| null | 3,114 | 1 |
[
"6\n4 1 3 1 6 2\n",
"2\n10000000 10000000\n",
"5\n2 6 1 4 5\n"
] |
[
"NO\n",
"NO\n",
"YES\n"
] |
[
"6\n4 1 3 1 6 1\n",
"2\n10000100 10000000\n",
"5\n2 9 1 4 5\n",
"6\n4 1 3 1 2 1\n",
"2\n10000100 10001000\n",
"5\n2 9 1 3 5\n",
"6\n4 1 3 1 2 0\n",
"2\n10000100 10101000\n",
"5\n2 9 0 3 5\n",
"6\n4 1 3 2 2 0\n"
] |
[
"NO\n",
"YES\n",
"YES\n",
"NO\n",
"YES\n",
"YES\n",
"NO\n",
"YES\n",
"YES\n",
"NO\n"
] |
CodeContests
|
Anmol likes gems very much.
He has N packets of gems, here the ith packet contains Pi gems. You need to find the minimal number of packets Anmol needs to take to his trip to Market, if he wants to eat there at least M gems. Note that gems are already packed, i.e. he cannot change the amount of gems in any packet.
Input format:
The first line of the input contains an integer t, denoting the number of test cases. Next t lines test cases follows: The first line of each test case contains two space-separated integers N and M. The second line contains N space-separated integers P1, P2, ..., PN.
Output format:
For each test case, output an integer, denoting the minimum number of plates. If it's impossible to take at least M gems, print -1.
Constraints:
1 ≤ T ≤ 5000
1 ≤ N ≤ 7
1 ≤ M, Pi ≤ 10^11SAMPLE INPUT
2
4 8
2 1 7 3
6 12
4 3 1 5 6 2
SAMPLE OUTPUT
2
3
Explanation
Case 1:We want to get 8 in minimum possible way from given 4 numbers. So, at least 2 numbers to be selected(1 and 7) to get sum as 8. Therefore its output would be 2.
Case 2:Here we want to get 12 in minimum possible way from given 6 numbers. So, at least 3 numbers are to be selected to get sum as 12. Therefore its output would be 3.
Problem Setter: Amit Tiwari
|
stdin
| null | 2,154 | 1 |
[
"2\n4 8\n2 1 7 3\n6 12\n4 3 1 5 6 2\n\nSAMPLE\n"
] |
[
"2\n3\n"
] |
[
"3\n4 7\n1 0 3 4\n5 5456\n200 867 3543 664 787\n4 78946\n6763 50000 15000 14454\n",
"2\n4 8\n2 1 7 3\n6 12\n4 3 1 5 0 2\n\nSAMPLE\n",
"3\n4 7\n1 0 3 4\n5 5456\n200 867 3543 664 787\n4 108660\n6763 50000 15000 14454\n",
"2\n4 8\n2 1 7 3\n6 12\n2 3 1 5 0 2\n\nSAMPLE\n",
"2\n4 8\n2 1 7 3\n6 12\n2 1 1 5 0 2\n\nSAMPLE\n",
"3\n4 7\n1 0 3 4\n5 5456\n200 867 3543 664 541\n4 56046\n6763 50000 15000 14454\n",
"2\n4 8\n2 1 7 3\n6 12\n2 1 1 10 0 2\n\nSAMPLE\n",
"2\n4 8\n2 1 7 8\n6 12\n2 1 0 10 0 2\n\nSAMPLE\n",
"2\n4 8\n2 2 2 11\n6 22\n2 1 0 10 0 4\n\nSAMPLE\n",
"3\n4 7\n1 2 3 4\n5 2144\n200 867 3543 664 787\n4 78946\n6763 50000 15000 14454\n"
] |
[
"2\n4\n3\n",
"2\n3\n",
"2\n4\n-1\n",
"2\n4\n",
"2\n-1\n",
"2\n4\n2\n",
"2\n2\n",
"1\n2\n",
"1\n-1\n",
"2\n1\n3\n"
] |
CodeContests
|
Indigo Real-estate Company is now planning to develop a new housing complex. The entire complex is a square, all of whose edges are equally a meters. The complex contains n subdivided blocks, each of which is a b-meter square. Here both a and b are positive integers.
However the project is facing a big problem. In this country, a percentage limit applies to the subdivision of a land, under the pretext of environmental protection. When developing a complex, the total area of the subdivided blocks must not exceed 50% of the area of the complex; in other words, more than or equal to 50% of the newly developed housing complex must be kept for green space. As a business, a green space exceeding 50% of the total area is a dead space. The primary concern of the project is to minimize it.
Of course purchasing and developing a land costs in proportion to its area, so the company also wants to minimize the land area to develop as the secondary concern. You, a member of the project, were assigned this task, but can no longer stand struggling against the problem with your pencil and paper. So you decided to write a program to find the pair of minimum a and b among those which produce the minimum dead space for given n.
Input
The input consists of multiple test cases. Each test case comes in a line, which contains an integer n. You may assume 1 ≤ n ≤ 10000.
The end of input is indicated by a line containing a single zero. This line is not a part of the input and should not be processed.
Output
For each test case, output the case number starting from 1 and the pair of minimum a and b as in the sample output.
You may assume both a and b fit into 64-bit signed integers.
Example
Input
1
2
0
Output
Case 1: 3 2
Case 2: 2 1
|
stdin
| null | 469 | 1 |
[
"1\n2\n0\n"
] |
[
"Case 1: 3 2\nCase 2: 2 1\n"
] |
[
"1\n0\n0\n",
"1\n1\n0\n",
"1\n4\n0\n",
"1\n6\n0\n",
"1\n8\n0\n",
"1\n3\n0\n",
"1\n12\n0\n",
"1\n5\n0\n",
"1\n11\n0\n",
"1\n14\n0\n"
] |
[
"Case 1: 3 2\n",
"Case 1: 3 2\nCase 2: 3 2\n",
"Case 1: 3 2\nCase 2: 3 1\n",
"Case 1: 3 2\nCase 2: 7 2\n",
"Case 1: 3 2\nCase 2: 4 1\n",
"Case 1: 3 2\nCase 2: 5 2\n",
"Case 1: 3 2\nCase 2: 5 1\n",
"Case 1: 3 2\nCase 2: 19 6\n",
"Case 1: 3 2\nCase 2: 197 42\n",
"Case 1: 3 2\nCase 2: 127 24\n"
] |
CodeContests
|
There are three positive integers A, B and C written on a blackboard. E869120 performs the following operation K times:
* Choose one integer written on the blackboard and let the chosen integer be n. Replace the chosen integer with 2n.
What is the largest possible sum of the integers written on the blackboard after K operations?
Constraints
* A, B and C are integers between 1 and 50 (inclusive).
* K is an integer between 1 and 10 (inclusive).
Input
Input is given from Standard Input in the following format:
A B C
K
Output
Print the largest possible sum of the integers written on the blackboard after K operations by E869220.
Examples
Input
5 3 11
1
Output
30
Input
3 3 4
2
Output
22
|
stdin
| null | 3,000 | 1 |
[
"5 3 11\n1\n",
"3 3 4\n2\n"
] |
[
"30\n",
"22\n"
] |
[
"7 3 11\n1\n",
"3 3 4\n4\n",
"7 5 11\n1\n",
"3 3 4\n0\n",
"7 5 11\n0\n",
"4 3 4\n0\n",
"10 5 11\n0\n",
"4 3 1\n0\n",
"10 5 21\n0\n",
"4 1 1\n0\n"
] |
[
"32\n",
"70\n",
"34\n",
"10\n",
"23\n",
"11\n",
"26\n",
"8\n",
"36\n",
"6\n"
] |
CodeContests
|
Time passed and Taro became a high school student. Under the influence of my older brother who was a college student, I began to be interested in computer science. Taro read through computer science textbooks and learned that there was a famous problem called the "longest increase subsequence problem." Taro understood this problem, but was wondering if he could create a similar problem himself. Therefore, Taro created the following problem as a result of trial and error.
* There is a sequence A consisting of n integers
* Decompose the sequence A into m sequences with m-1 delimiters. In addition, each sequence after decomposition must always include one or more numbers.
* If the m numbers created by adding all the integers in each of these m sequences are arranged in the order of the original sequence, it becomes a strict increasing sequence (that is, the resulting sequence is Bi <Bi + 1). I want to do it.
* The goal is to maximize the length m of the final sequence B.
For example, consider the case where the sequence A is {5, -4,10, -3,8}.
Prepare a sequence C that represents the position of the delimiter, and set C = {2,4}.
At this time, the sequence A is divided into the parts (5, -4), (10, -3), (8), and when these interiors are added together, they become 1,7,8, respectively, and the resulting sequence B is {1, 7,8}.
<image>
Taro named this problem the "longest increase subsequence problem" and also considered an algorithm to solve it.
And I contacted you as a member of society to check it. Your job is to create a program to solve the problems created by Taro who has grown up.
Since it is my job to check, it also outputs the position of the m-1 delimiter. In addition, there may be multiple such delimiters for the optimum m, but if this m is output correctly, one of the possible ones should be output.
Constraints
> 1 ≤ n ≤ 4000
> | Ai | ≤ 108
>
* For the integer k, | k | represents the absolute value of k
Input
N + 1 integers are given, separated by line breaks.
> n
> A1
> A2
> ...
> An
>
* n represents the length of the given sequence A
* Ai represents the i-th element of the sequence A.
Output
> m
> C1 C2 .. Cm-1
>
* The first line outputs one integer m. m represents the length of the final sequence B. The second line outputs m-1 integer Ci separated by blanks. Ci represents the i-th delimiter when the sequence A is appropriately divided into m parts. See the figure for the definition of the delimiter. Note that 1 ≤ Ci <n is satisfied. The m-1 integer sequence C in the second row must be arranged in ascending order. Therefore, if i <j, then Ci <Cj holds.
* If m = 1, the second line will be blank.
* When the sequence B is generated from the sequence A according to the sequence C, when the sequence B is not an increasing sequence (that is, when i (1 ≤ i <m) such that Bi ≥ Bi + 1 exists), it becomes WrongAnswer.
Examples
Input
3
1
2
4
Output
3
1 2
Input
3
2
2
2
Output
2
1
Input
3
4
2
1
Output
1
(空行)
|
stdin
| null | 4,758 | 1 |
[
"3\n4\n2\n1\n",
"3\n1\n2\n4\n",
"3\n2\n2\n2\n"
] |
[
"1\n(空行)\n",
"3\n1 2\n",
"2\n1\n"
] |
[
"3\n6\n2\n1\n",
"3\n2\n2\n4\n",
"3\n2\n3\n4\n",
"3\n12\n2\n1\n",
"3\n12\n0\n1\n",
"3\n19\n0\n1\n",
"3\n19\n1\n1\n",
"3\n19\n1\n2\n",
"3\n9\n1\n2\n",
"3\n9\n0\n2\n"
] |
[
"1\n",
"2\n1\n",
"3\n1 2\n",
"1\n",
"1\n",
"1\n",
"1\n",
"1\n",
"1\n",
"1\n"
] |
CodeContests
|
Given is a positive integer N.
We will choose an integer K between 2 and N (inclusive), then we will repeat the operation below until N becomes less than K.
* Operation: if K divides N, replace N with N/K; otherwise, replace N with N-K.
In how many choices of K will N become 1 in the end?
Constraints
* 2 \leq N \leq 10^{12}
* N is an integer.
Input
Input is given from Standard Input in the following format:
N
Output
Print the number of choices of K in which N becomes 1 in the end.
Examples
Input
6
Output
3
Input
3141
Output
13
Input
314159265358
Output
9
|
stdin
| null | 1,764 | 1 |
[
"314159265358\n",
"6\n",
"3141\n"
] |
[
"9\n",
"3\n",
"13\n"
] |
[
"7705668993\n",
"2827\n",
"6363881708\n",
"2031\n",
"10229584853\n",
"308\n",
"13543667986\n",
"23472293460\n",
"45468207033\n",
"9\n"
] |
[
"64\n",
"12\n",
"17\n",
"16\n",
"6\n",
"4\n",
"33\n",
"11\n",
"48\n",
"5\n"
] |
CodeContests
|
You are given $n$ packages of $w_i$ kg from a belt conveyor in order ($i = 0, 1, ... n-1$). You should load all packages onto $k$ trucks which have the common maximum load $P$. Each truck can load consecutive packages (more than or equals to zero) from the belt conveyor unless the total weights of the packages in the sequence does not exceed the maximum load $P$.
Write a program which reads $n$, $k$ and $w_i$, and reports the minimum value of the maximum load $P$ to load all packages from the belt conveyor.
Constraints
* $1 \leq n \leq 100,000$
* $1 \leq k \leq 100,000$
* $1 \leq w_i \leq 10,000$
Input
In the first line, two integers $n$ and $k$ are given separated by a space character. In the following $n$ lines, $w_i$ are given respectively.
Output
Print the minimum value of $P$ in a line.
Examples
Input
5 3
8
1
7
3
9
Output
10
Input
4 2
1
2
2
6
Output
6
|
stdin
| null | 4,917 | 1 |
[
"5 3\n8\n1\n7\n3\n9\n",
"4 2\n1\n2\n2\n6\n"
] |
[
"10\n",
"6\n"
] |
[
"5 3\n4\n1\n7\n3\n9\n",
"4 2\n1\n1\n2\n6\n",
"5 3\n4\n1\n7\n3\n5\n",
"5 6\n4\n1\n7\n3\n5\n",
"4 2\n1\n1\n3\n1\n",
"4 2\n1\n1\n3\n0\n",
"4 2\n1\n4\n3\n0\n",
"5 3\n6\n2\n8\n5\n4\n",
"5 3\n6\n2\n8\n7\n4\n",
"5 3\n8\n2\n9\n7\n5\n"
] |
[
"10\n",
"6\n",
"8\n",
"7\n",
"4\n",
"3\n",
"5\n",
"9\n",
"11\n",
"12\n"
] |
CodeContests
|
Irving & Cohen Petroleum Corporation has decided to develop a new oil field in an area. A preliminary survey has been done and they created a detailed grid map of the area which indicates the reserve of oil.
They are now planning to construct mining plants on several grid blocks according this map, but they decided not to place any two plants on adjacent positions to avoid spreading of fire in case of blaze. Two blocks are considered to be adjacent when they have a common edge. You are one of the programmers working for the company and your task is to write a program which calculates the maximum amount of oil they can mine, given the map of the reserve.
Input
The first line of the input specifies N, the number of test cases. Then N test cases follow, each of which looks like the following:
W H
r1,1 r2,1 . . . rW,1
...
r1,H r2,H . . . rW,H
The first line of a test case contains two integers W and H (1 ≤ W, H ≤ 20). They specifies the dimension of the area. The next H lines, each of which contains W integers, represent the map of the area. Each integer rx,y (0 ≤ rx,y < 10000) indicates the oil reserve at the grid block (x, y).
Output
For each test case, output the case number (starting from 1) and the maximum possible amount of mining in a line. Refer to the sample output section about the format.
Example
Input
2
2 2
2 3
3 5
3 2
4 1 1
2 1 4
Output
Case 1: 7
Case 2: 8
|
stdin
| null | 269 | 1 |
[
"2\n2 2\n2 3\n3 5\n3 2\n4 1 1\n2 1 4\n"
] |
[
"Case 1: 7\nCase 2: 8\n"
] |
[
"2\n2 2\n2 3\n3 5\n3 2\n4 1 1\n2 1 0\n",
"2\n2 0\n2 3\n3 5\n3 2\n4 1 1\n2 1 0\n",
"2\n2 0\n2 3\n3 5\n3 3\n4 1 1\n2 1 0\n",
"2\n1 1\n2 3\n3 5\n3 3\n4 1 1\n2 2 0\n",
"2\n1 1\n2 2\n3 5\n3 3\n4 1 1\n2 2 0\n",
"2\n1 1\n2 2\n3 5\n3 3\n6 1 1\n2 2 0\n",
"2\n1 1\n2 3\n3 5\n5 3\n6 1 1\n4 2 0\n",
"2\n1 1\n2 3\n5 5\n3 3\n12 1 1\n0 2 0\n",
"2\n1 1\n2 3\n5 9\n3 3\n12 1 0\n0 2 0\n",
"2\n1 1\n2 3\n5 9\n5 3\n12 1 0\n0 2 0\n"
] |
[
"Case 1: 7\nCase 2: 6\n",
"Case 1: 0\nCase 2: 9\n",
"Case 1: 0\nCase 2: 10\n",
"Case 1: 2\nCase 2: 11\n",
"Case 1: 2\nCase 2: 10\n",
"Case 1: 2\nCase 2: 12\n",
"Case 1: 2\nCase 2: 14\n",
"Case 1: 2\nCase 2: 18\n",
"Case 1: 2\nCase 2: 17\n",
"Case 1: 2\nCase 2: 19\n"
] |
CodeContests
|
There are N cubes stacked vertically on a desk.
You are given a string S of length N. The color of the i-th cube from the bottom is red if the i-th character in S is `0`, and blue if that character is `1`.
You can perform the following operation any number of times: choose a red cube and a blue cube that are adjacent, and remove them. Here, the cubes that were stacked on the removed cubes will fall down onto the object below them.
At most how many cubes can be removed?
Constraints
* 1 \leq N \leq 10^5
* |S| = N
* Each character in S is `0` or `1`.
Input
Input is given from Standard Input in the following format:
S
Output
Print the maximum number of cubes that can be removed.
Examples
Input
0011
Output
4
Input
11011010001011
Output
12
Input
0
Output
0
|
stdin
| null | 138 | 1 |
[
"0\n",
"0011\n",
"11011010001011\n"
] |
[
"0\n",
"4\n",
"12\n"
] |
[
"1\n",
"0010\n",
"11011010001001\n",
"11001010001001\n",
"11001000001001\n",
"1010\n",
"01001000101000\n",
"11011011111101\n",
"0000\n",
"1000\n"
] |
[
"0\n",
"2\n",
"14\n",
"12\n",
"10\n",
"4\n",
"8\n",
"6\n",
"0\n",
"2\n"
] |
CodeContests
|
A rabbit who came to the fair found that the prize for a game at a store was a carrot cake. The rules for this game are as follows.
There is a grid-like field of vertical h squares x horizontal w squares, and each block has at most one block. Each block is a color represented by one of the uppercase letters ('A'-'Z'). When n or more blocks of the same color are lined up in a straight line vertically or horizontally, those blocks disappear.
Participants can select two adjacent cells next to each other and switch their states to each other. When blocks are exchanged, disappeared, or dropped and there are no blocks in the cell below the cell with the block, this block At this time, it disappears when n or more blocks of the same color are lined up again. However, the disappearance of the blocks does not occur while the falling blocks exist, and occurs at the same time when all the blocks have finished falling.
If you eliminate all the blocks on the field with one operation, this game will be successful and you will get a free gift cake. Rabbit wants to get the cake with one entry fee, can not do it If you don't want to participate. From the state of the field at the beginning of the game, answer if the rabbit should participate in this game.
Input
The first line of input is given h, w, n separated by spaces.
2 ≤ h, w, n ≤ 30
In the following h lines, the state of the field is given in order from the top. Uppercase letters represent blocks, and'.' Represents an empty space. The state of the given field is n or more consecutive blocks of the same color in the vertical or horizontal direction. No, no blocks are in a falling state. There is one or more blocks.
Output
Output "YES" if the rabbit should participate in this game, otherwise output "NO" on one line.
Examples
Input
4 6 3
......
...Y..
...Y..
RRYRYY
Output
YES
Input
4 6 3
......
...Y..
...Y..
RRYRY.
Output
NO
|
stdin
| null | 2,818 | 1 |
[
"4 6 3\n......\n...Y..\n...Y..\nRRYRYY\n",
"4 6 3\n......\n...Y..\n...Y..\nRRYRY.\n"
] |
[
"YES\n",
"NO\n"
] |
[
"4 6 3\n......\n..Y...\n...Y..\nRRYRYY\n",
"4 6 1\n......\n...Y..\n/..Z..\nYRRRYY\n",
"4 6 3\n......\n...Y..\n...Y..\nRRYRZ.\n",
"4 6 3\n......\n...Y..\n/..Y..\nRRYRYY\n",
"4 6 3\n......\n...Y..\n...Y..\n.RYRYR\n",
"4 6 3\n......\n...Y..\n...Z..\nRRYRZ.\n",
"4 6 3\n......\n...Y..\n/..Z..\nRRYRYY\n",
"4 6 3\n....-.\n...Y..\n...Y..\n.RYRYR\n",
"4 6 3\n......\n...Y..\n/..Z..\nYRRRYY\n",
"4 6 3\n....-.\n...Y.-\n...Y..\n.RYRYR\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n"
] |
CodeContests
|
jfen
There is a one-person game to play on the H × W board. This game is a game to move 0 or 1 balls in each cell. You were playing this game and found it difficult to move the ball accurately from cell to cell because the ball is so round. So you decided to make a robot that would move the ball as instructed. Here, the notation (y, x) is used to represent the cell. This represents the cell in the xth column of the yth row.
Instructions to the robot are given by the four integers a, b, c, d. This means moving the ball at (a, b) to (c, d). At this time, it is guaranteed that the ball exists in (a, b) and does not exist in (c, d).
The state of the board is expressed by the following notation called "jfen".
[Data in the first line] / [Data in the second line] /.../ [Data in the H line]
This notation is a slash-separated concatenation of data representing each line on the board. The data in each row is represented by a character string, and the state of the cells in the 1st to Wth columns is described in order from the left. This string is represented by a number and the letter'b', where the integer represented by the number represents the number of consecutive blank cells and'b' represents the cell in which the ball resides. Here, integers must not be consecutive in the data of each row. Also, the sum of the integers written in the data of each line and the sum of the number of'b'are always W.
As an example, consider the following board surface condition. A blank cell is represented by a'.', And a cell in which the ball exists is represented by a'b'. The j character from the left of the i-th row in this example represents the state of the cell in the j-th column of the i-th row on the board.
....
.b.b
....
The above board is expressed in jfen as follows.
4 / 1b1b / 4
Create a program that outputs the board surface after the robot moves the ball when the robot is given the current board surface state and a command to move one ball. At this time, output the board surface in jfen notation.
Input
The input consists of multiple datasets. Each dataset has the following format.
> S
> a b c d
Each dataset consists of two lines, and the first line is given the jfen-formatted string S, which represents the state of the board. Here, the size of the board satisfies 2 ≤ W and H ≤ 9. Instructions to the robot are given to the following lines. This represents an instruction to move the ball at (a, b) to (c, d). The end of the input is represented by #.
Output
The output is one line of character string that expresses the state of the board after executing the instruction for each data set in jfen notation. There must be no other characters on the output line.
Sample Input
b1 / 1b
1 1 1 2
b5 / bbbbbb
2 4 1 4
b2b2b / 7
1 4 2 4
Output for Sample Input
1b / 1b
b2b2 / bbb1bb
b5b / 3b3
The initial state of the first input is as follows.
b.
.b
Since the ball of (1,1) is moved to (1,2), the board surface after the command is as follows.
.b
.b
Example
Input
b1/1b
1 1 1 2
b5/bbbbbb
2 4 1 4
b2b2b/7
1 4 2 4
#
Output
1b/1b
b2b2/bbb1bb
b5b/3b3
|
stdin
| null | 4,991 | 1 |
[
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 4\nb2b2b/7\n1 4 2 4\n#\n"
] |
[
"1b/1b\nb2b2/bbb1bb\nb5b/3b3\n"
] |
[
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 4\nb2b2b/7\n1 4 2 6\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 5\nb2b2b/7\n1 4 2 4\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 4\nb2b2b/7\n1 4 1 4\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 0 5\nb2b2b/7\n1 4 2 4\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 4\nb2b2b/7\n1 4 2 2\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 4\nb2b2b/7\n1 4 1 2\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 8 0 5\nb2b2b/7\n1 4 2 4\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 8\nb2b2b/7\n1 4 1 2\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 0 5\nb2b2b/7\n1 4 2 7\n#\n",
"b1/1b\n1 1 1 2\nb5/bbbbbb\n2 4 1 2\nb2b2b/7\n1 4 2 2\n#\n"
] |
[
"1b/1b\nb2b2/bbb1bb\nb5b/5b1\n",
"1b/1b\nb3b1/bbb1bb\nb5b/3b3\n",
"1b/1b\nb2b2/bbb1bb\nb2b2b/7\n",
"1b/1b\nb5/bbb1bb\nb5b/3b3\n",
"1b/1b\nb2b2/bbb1bb\nb5b/1b5\n",
"1b/1b\nb2b2/bbb1bb\nbb4b/7\n",
"1b/1b\nb5/bbbbbb\nb5b/3b3\n",
"1b/1b\nb5/bbb1bb\nbb4b/7\n",
"1b/1b\nb5/bbb1bb\nb5b/6b\n",
"1b/1b\nbb4/bbb1bb\nb5b/1b5\n"
] |
CodeContests
|
M-kun is a competitor in AtCoder, whose highest rating is X.
In this site, a competitor is given a kyu (class) according to his/her highest rating. For ratings from 400 through 1999, the following kyus are given:
* From 400 through 599: 8-kyu
* From 600 through 799: 7-kyu
* From 800 through 999: 6-kyu
* From 1000 through 1199: 5-kyu
* From 1200 through 1399: 4-kyu
* From 1400 through 1599: 3-kyu
* From 1600 through 1799: 2-kyu
* From 1800 through 1999: 1-kyu
What kyu does M-kun have?
Constraints
* 400 \leq X \leq 1999
* X is an integer.
Input
Input is given from Standard Input in the following format:
X
Output
Print the kyu M-kun has, as an integer. For example, if he has 8-kyu, print `8`.
Examples
Input
725
Output
7
Input
1600
Output
2
|
stdin
| null | 4,538 | 1 |
[
"725\n",
"1600\n"
] |
[
"7\n",
"2\n"
] |
[
"1359\n",
"543\n",
"1855\n",
"609\n",
"982\n",
"1485\n",
"1125\n",
"1764\n",
"554\n",
"417\n"
] |
[
"4\n",
"8\n",
"1\n",
"7\n",
"6\n",
"3\n",
"5\n",
"2\n",
"8\n",
"8\n"
] |
CodeContests
|
Welcome to CODE FESTIVAL 2016! In order to celebrate this contest, find a string s that satisfies the following conditions:
* The length of s is between 1 and 5000, inclusive.
* s consists of uppercase letters.
* s contains exactly K occurrences of the string "FESTIVAL" as a subsequence. In other words, there are exactly K tuples of integers (i_0, i_1, ..., i_7) such that 0 ≤ i_0 < i_1 < ... < i_7 ≤ |s|-1 and s[i_0]='F', s[i_1]='E', ..., s[i_7]='L'.
It can be proved that under the given constraints, the solution always exists. In case there are multiple possible solutions, you can output any.
Constraints
* 1 ≤ K ≤ 10^{18}
Input
The input is given from Standard Input in the following format:
K
Output
Print a string that satisfies the conditions.
Examples
Input
7
Output
FESSSSSSSTIVAL
Input
256
Output
FFEESSTTIIVVAALL
|
stdin
| null | 2,290 | 1 |
[
"7\n",
"256\n"
] |
[
"FESSSSSSSTIVAL\n",
"FFEESSTTIIVVAALL\n"
] |
[
"3\n",
"454\n",
"6\n",
"754\n",
"0\n",
"819\n",
"928\n",
"1486\n",
"1008\n",
"2009\n"
] |
[
"FESTIVALLLFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVALLLLFESTIVAFESTIVAFESTIVALFESTIVALFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVALLLLLLFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVALLLLLLFESTIVALLFESTIVALLFESTIVAFESTIVALLFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVALLLFESTIVALLLFESTIVAFESTIVAFESTIVAFESTIVALFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVAFESTIVALLFESTIVAFESTIVALFESTIVAFESTIVALFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVALLFESTIVALLLLFESTIVAFESTIVAFESTIVALLFESTIVALFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVAFESTIVALLLFESTIVALLFESTIVALFESTIVAFESTIVALFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n",
"FESTIVALFESTIVALLFESTIVALFESTIVALLFESTIVAFESTIVAFESTIVALFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVAFESTIVA\n"
] |
CodeContests
|
There are 2N balls, N white and N black, arranged in a row. The integers from 1 through N are written on the white balls, one on each ball, and they are also written on the black balls, one on each ball. The integer written on the i-th ball from the left (1 ≤ i ≤ 2N) is a_i, and the color of this ball is represented by a letter c_i. c_i = `W` represents the ball is white; c_i = `B` represents the ball is black.
Takahashi the human wants to achieve the following objective:
* For every pair of integers (i,j) such that 1 ≤ i < j ≤ N, the white ball with i written on it is to the left of the white ball with j written on it.
* For every pair of integers (i,j) such that 1 ≤ i < j ≤ N, the black ball with i written on it is to the left of the black ball with j written on it.
In order to achieve this, he can perform the following operation:
* Swap two adjacent balls.
Find the minimum number of operations required to achieve the objective.
Constraints
* 1 ≤ N ≤ 2000
* 1 ≤ a_i ≤ N
* c_i = `W` or c_i = `B`.
* If i ≠ j, (a_i,c_i) ≠ (a_j,c_j).
Input
Input is given from Standard Input in the following format:
N
c_1 a_1
c_2 a_2
:
c_{2N} a_{2N}
Output
Print the minimum number of operations required to achieve the objective.
Examples
Input
3
B 1
W 2
B 3
W 1
W 3
B 2
Output
4
Input
4
B 4
W 4
B 3
W 3
B 2
W 2
B 1
W 1
Output
18
Input
9
W 3
B 1
B 4
W 1
B 5
W 9
W 2
B 6
W 5
B 3
W 8
B 9
W 7
B 2
B 8
W 4
W 6
B 7
Output
41
|
stdin
| null | 2,883 | 1 |
[
"9\nW 3\nB 1\nB 4\nW 1\nB 5\nW 9\nW 2\nB 6\nW 5\nB 3\nW 8\nB 9\nW 7\nB 2\nB 8\nW 4\nW 6\nB 7\n",
"3\nB 1\nW 2\nB 3\nW 1\nW 3\nB 2\n",
"4\nB 4\nW 4\nB 3\nW 3\nB 2\nW 2\nB 1\nW 1\n"
] |
[
"41\n",
"4\n",
"18\n"
] |
[
"3\nB 1\nW 1\nB 3\nW 2\nW 3\nB 2\n",
"4\nB 4\nW 4\nB 2\nW 3\nB 3\nW 2\nB 1\nW 1\n",
"4\nB 2\nW 4\nB 3\nW 3\nB 4\nW 2\nB 1\nW 1\n",
"4\nB 4\nW 4\nB 3\nW 2\nB 1\nW 3\nB 2\nW 1\n",
"3\nB 1\nW 1\nB 2\nW 2\nW 3\nB 3\n",
"3\nB 1\nW 1\nB 3\nW 3\nW 2\nB 2\n",
"3\nB 1\nW 2\nB 2\nW 1\nW 3\nB 3\n",
"4\nB 4\nW 4\nB 3\nW 3\nB 1\nW 2\nB 2\nW 1\n",
"3\nB 1\nW 1\nB 3\nW 2\nW 3\nB 2\n",
"4\nB 4\nW 4\nB 3\nW 2\nB 2\nW 3\nB 1\nW 1\n"
] |
[
"3\n",
"17\n",
"15\n",
"16\n",
"0\n",
"4\n",
"2\n",
"17\n",
"3\n",
"17\n"
] |
CodeContests
|
Limak is an old brown bear.
He often goes bowling with his friends.
For rolling a ball one gets a score - a non-negative integer number of points.
Score for the i-th roll is multiplied by i and scores are summed up.
For example, for rolls with scores 7, 10, 5 the total score is equal to 7×1 + 10×2 + 5×3 = 42.
Limak made N rolls and got a score Ai for the i-th of them.
Unfortunately, the bowling club's computer system isn't stable today.
Any rolls can be erased!
Then, the total score is calculated as if there were only non-erased rolls.
There are 2^N possible sequences of remaining (non-erased) rolls.
Limak is curious about various statistics of this situation.
He asks you for one thing.
Find the sum of total scores of all 2^N possible sequences of remaining rolls.
Print it modulo 10^9+7.
Input format
The first line contains a single integer N.
The second line contains N non-negative integers A1, A2, ..., AN.
Output format
In a single line print modulo 10^9+7 the sum of total scores of possible remaining sequences.
Constraints
1 ≤ N ≤ 200,000
0 ≤ Ai ≤ 10^9
SAMPLE INPUT
3
6 12 8
SAMPLE OUTPUT
160
Explanation
There are eight possible remaining subsequences.
{} - 0
{6} - 6
{12} - 12
{8} - 8
{6, 12} - 30
{6, 8} - 22
{12, 8} - 28
{6, 12, 8} - 54
0 + 6 + 12 + 8 + 30 + 22 + 28 + 54 = 160
|
stdin
| null | 3,420 | 1 |
[
"3\n6 12 8\n\nSAMPLE\n"
] |
[
"160\n"
] |
[
"15\n163004418 74928250 168024392 150391828 194860227 992288235 933539839 120817690 26026774 465544095 363334937 708292303 29566466 171450602 452807812\n",
"3\n6 12 8\n\nTAMPLE\n",
"15\n163004418 74928250 168024392 150391828 194860227 992288235 933539839 120817690 26026774 465544095 363334937 708292303 29566466 58453081 452807812\n",
"3\n6 8 8\n\nTAMPLE\n",
"15\n163004418 74928250 168024392 150391828 194860227 992288235 933539839 189011517 26026774 465544095 363334937 708292303 29566466 58453081 452807812\n",
"3\n6 8 13\n\nTAMPLE\n",
"15\n163004418 74928250 168024392 150391828 194860227 992288235 933539839 189011517 26026774 465544095 28287208 708292303 29566466 58453081 452807812\n",
"15\n163004418 74928250 168024392 177359443 194860227 992288235 933539839 189011517 26026774 465544095 28287208 708292303 29566466 58453081 452807812\n",
"15\n163004418 74928250 168024392 177359443 194860227 992288235 933539839 189011517 13004007 465544095 28287208 708292303 29566466 58453081 452807812\n",
"15\n163004418 74928250 168024392 177359443 194860227 992288235 933539839 189011517 13004007 338067987 28287208 708292303 29566466 58453081 452807812\n"
] |
[
"622751009\n",
"160\n",
"487467724\n",
"136\n",
"281909584\n",
"176\n",
"750188527\n",
"343691192\n",
"518626021\n",
"391662334\n"
] |
CodeContests
|
There's an array A consisting of N non-zero integers A1..N. A subarray of A is called alternating if any two adjacent elements in it have different signs (i.e. one of them should be negative and the other should be positive).
For each x from 1 to N, compute the length of the longest alternating subarray that starts at x - that is, a subarray Ax..y for the maximum possible y ≥ x. The length of such a subarray is y-x+1.
Input
The first line of the input contains an integer T - the number of test cases.
The first line of each test case contains N.
The following line contains N space-separated integers A1..N.
Output
For each test case, output one line with N space-separated integers - the lengths of the longest alternating subarray starting at x, for each x from 1 to N.
Constraints
1 ≤ T ≤ 10
1 ≤ N ≤ 10^5
-10^9 ≤ Ai ≤ 10^9
Example
Input:
3
4
1 2 3 4
4
1 -5 1 -5
6
-5 -1 -1 2 -2 -3
Output:
1 1 1 1
4 3 2 1
1 1 3 2 1 1
Explanation
Example case 1. No two elements have different signs, so any alternating subarray may only consist of a single number.
Example case 2. Every subarray is alternating.
Example case 3. The only alternating subarray of length 3 is A3..5.
|
stdin
| null | 3,179 | 1 |
[
"3\n4\n1 2 3 4\n4\n1 -5 1 -5\n6\n-5 -1 -1 2 -2 -3\n"
] |
[
"1 1 1 1\n4 3 2 1\n1 1 3 2 1 1\n"
] |
[
"3\n4\n1 2 3 7\n4\n1 -5 1 -5\n6\n-5 -1 -1 2 -2 -3\n",
"3\n4\n1 2 3 8\n4\n1 -5 1 -5\n6\n-5 -1 -1 2 -2 -3\n",
"3\n4\n1 2 1 8\n4\n1 -5 1 -5\n6\n-5 -1 -1 2 -2 -3\n",
"3\n4\n1 2 3 7\n4\n1 -5 1 -5\n6\n-5 -1 -1 3 -2 -3\n",
"3\n4\n1 2 3 13\n4\n1 -5 1 -5\n6\n-5 -1 -1 2 -2 -3\n",
"3\n4\n1 1 3 7\n4\n1 -5 1 -5\n6\n-5 -1 -1 3 -2 -3\n",
"3\n4\n2 2 3 13\n4\n1 -5 1 -5\n6\n-5 -1 -1 2 -2 -3\n",
"3\n4\n1 2 3 7\n4\n1 -5 1 -5\n6\n-4 -1 -1 3 -2 -3\n",
"3\n4\n2 2 3 13\n4\n1 -5 1 -5\n6\n-3 -1 -1 2 -2 -3\n",
"3\n4\n1 2 3 7\n4\n1 -10 1 -5\n6\n-4 -1 -1 3 -2 -3\n"
] |
[
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n",
"1 1 1 1 4 3 2 1 1 1 3 2 1 1\n"
] |
CodeContests
|
One
Problem Statement
A beautiful mountain range can be seen from the train window.
The window is a rectangle with the coordinates of the lower left corner (0, 0) and the coordinates of the upper right corner (W, H).
N peaks can be seen from the window, and the i-th peak has the shape of an upwardly convex parabola y = a_i (x-p_i) ^ 2 + q_i.
Find the length of the boundary between the mountain and the sky.
The following three figures correspond to Sample Input. The part shown by the thick line is the boundary between the mountain and the sky.
<image> <image> <image>
Constraints
* 1 ≤ W, H ≤ 100
* 1 ≤ N ≤ 50
* -100 ≤ a_i ≤ -1
* 0 ≤ p_i ≤ W
* 1 ≤ q_i ≤ H
* If i \ neq j, then (a_i, p_i, q_i) \ neq (a_j, p_j, q_j)
Input
Input follows the following format. All given numbers are integers.
W H N
a_1 p_1 q_1
...
a_N p_N q_N
Output
Output the length of the boundary between the mountain and the sky on one line.
The output value must have an absolute or relative error of less than 10 ^ {-6} with the true value.
Examples
Input
20 20 1
-1 10 10
Output
21.520346288593280
Input
20 20 2
-1 10 10
-2 10 5
Output
21.520346288593280
Input
15 100 2
-2 5 100
-2 10 100
Output
126.921542730127873
|
stdin
| null | 193 | 1 |
[
"20 20 2\n-1 10 10\n-2 10 5\n",
"15 100 2\n-2 5 100\n-2 10 100\n",
"20 20 1\n-1 10 10\n"
] |
[
"21.520346288593280\n",
"126.921542730127873\n",
"21.520346288593280\n"
] |
[
"20 20 2\n-1 10 10\n-2 10 9\n",
"20 20 2\n-1 18 10\n-2 10 9\n",
"20 20 2\n-1 18 10\n-2 10 3\n",
"20 28 1\n-2 15 10\n",
"20 28 1\n-2 15 16\n",
"13 20 2\n-1 10 10\n-2 10 5\n",
"20 20 2\n-1 10 7\n-2 10 9\n",
"20 20 2\n-1 18 12\n-2 10 9\n",
"20 20 2\n-1 18 8\n-2 10 3\n",
"11 28 1\n-2 15 10\n"
] |
[
"21.520346289\n",
"34.240259496\n",
"22.103789181\n",
"20.846429535\n",
"32.905034243\n",
"20.507261903\n",
"19.040295762\n",
"36.262920953\n",
"20.076088851\n",
"0.000000000\n"
] |
CodeContests
|
Write a program which counts and reports the number of each alphabetical letter. Ignore the case of characters.
Constraints
* The number of characters in the sentence < 1200
Input
A sentence in English is given in several lines.
Output
Prints the number of alphabetical letters in the following format:
a : The number of 'a'
b : The number of 'b'
c : The number of 'c'
.
.
z : The number of 'z'
Example
Input
This is a pen.
Output
a : 1
b : 0
c : 0
d : 0
e : 1
f : 0
g : 0
h : 1
i : 2
j : 0
k : 0
l : 0
m : 0
n : 1
o : 0
p : 1
q : 0
r : 0
s : 2
t : 1
u : 0
v : 0
w : 0
x : 0
y : 0
z : 0
|
stdin
| null | 4,918 | 1 |
[
"This is a pen.\n"
] |
[
"a : 1\nb : 0\nc : 0\nd : 0\ne : 1\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 0\np : 1\nq : 0\nr : 0\ns : 2\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n"
] |
[
"This is ` pen.\n",
"This si a pen.\n",
"hTit si a pen.\n",
"hTis ir a pen.\n",
"hTis ri a pdn.\n",
"hTis ri a odn.\n",
"hTis ri a odo.\n",
"hsiT rh a od.o\n",
"Tsih is a od-o\n",
"Tsih is ` od-o\n"
] |
[
"a : 0\nb : 0\nc : 0\nd : 0\ne : 1\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 0\np : 1\nq : 0\nr : 0\ns : 2\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 0\ne : 1\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 0\np : 1\nq : 0\nr : 0\ns : 2\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 0\ne : 1\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 0\np : 1\nq : 0\nr : 0\ns : 1\nt : 2\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 0\ne : 1\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 0\np : 1\nq : 0\nr : 1\ns : 1\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 1\ne : 0\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 0\np : 1\nq : 0\nr : 1\ns : 1\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 1\ne : 0\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 1\no : 1\np : 0\nq : 0\nr : 1\ns : 1\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 1\ne : 0\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 0\no : 2\np : 0\nq : 0\nr : 1\ns : 1\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 1\ne : 0\nf : 0\ng : 0\nh : 2\ni : 1\nj : 0\nk : 0\nl : 0\nm : 0\nn : 0\no : 2\np : 0\nq : 0\nr : 1\ns : 1\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 1\nb : 0\nc : 0\nd : 1\ne : 0\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 0\no : 2\np : 0\nq : 0\nr : 0\ns : 2\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n",
"a : 0\nb : 0\nc : 0\nd : 1\ne : 0\nf : 0\ng : 0\nh : 1\ni : 2\nj : 0\nk : 0\nl : 0\nm : 0\nn : 0\no : 2\np : 0\nq : 0\nr : 0\ns : 2\nt : 1\nu : 0\nv : 0\nw : 0\nx : 0\ny : 0\nz : 0\n"
] |
CodeContests
|
You are given an integer K. Print the string obtained by repeating the string `ACL` K times and concatenating them.
For example, if K = 3, print `ACLACLACL`.
Constraints
* 1 \leq K \leq 5
* All values in input are integers.
Input
Input is given from Standard Input in the following format:
K
Output
Print the string obtained by repeating the string `ACL` K times and concatenating them.
Example
Input
3
Output
ACLACLACL
|
stdin
| null | 965 | 1 |
[
"3\n"
] |
[
"ACLACLACL\n"
] |
[
"4\n",
"6\n",
"5\n",
"10\n",
"8\n",
"7\n",
"9\n",
"2\n",
"13\n",
"1\n"
] |
[
"ACLACLACLACL\n",
"ACLACLACLACLACLACL\n",
"ACLACLACLACLACL\n",
"ACLACLACLACLACLACLACLACLACLACL\n",
"ACLACLACLACLACLACLACLACL\n",
"ACLACLACLACLACLACLACL\n",
"ACLACLACLACLACLACLACLACLACL\n",
"ACLACL\n",
"ACLACLACLACLACLACLACLACLACLACLACLACLACL\n",
"ACL\n"
] |
CodeContests
|
Sig has built his own keyboard. Designed for ultimate simplicity, this keyboard only has 3 keys on it: the `0` key, the `1` key and the backspace key.
To begin with, he is using a plain text editor with this keyboard. This editor always displays one string (possibly empty). Just after the editor is launched, this string is empty. When each key on the keyboard is pressed, the following changes occur to the string:
* The `0` key: a letter `0` will be inserted to the right of the string.
* The `1` key: a letter `1` will be inserted to the right of the string.
* The backspace key: if the string is empty, nothing happens. Otherwise, the rightmost letter of the string is deleted.
Sig has launched the editor, and pressed these keys several times. You are given a string s, which is a record of his keystrokes in order. In this string, the letter `0` stands for the `0` key, the letter `1` stands for the `1` key and the letter `B` stands for the backspace key. What string is displayed in the editor now?
Constraints
* 1 ≦ |s| ≦ 10 (|s| denotes the length of s)
* s consists of the letters `0`, `1` and `B`.
* The correct answer is not an empty string.
Input
The input is given from Standard Input in the following format:
s
Output
Print the string displayed in the editor in the end.
Examples
Input
01B0
Output
00
Input
0BB1
Output
1
|
stdin
| null | 2,211 | 1 |
[
"01B0\n",
"0BB1\n"
] |
[
"00\n",
"1\n"
] |
[
"01B1\n",
"BB11\n",
"B01B\n",
"02B0\n",
"/BB1\n",
"1B10\n",
"B010\n",
"B110\n",
"B011\n",
"B101\n"
] |
[
"01\n",
"11\n",
"0\n",
"00\n",
"1\n",
"10\n",
"010\n",
"110\n",
"011\n",
"101\n"
] |
CodeContests
|
Shun and his professor are studying Lisp and S-expressions. Shun is in Tokyo in order to make a presen- tation of their research. His professor cannot go with him because of another work today.
He was making final checks for his slides an hour ago. Then, unfortunately, he found some serious mistakes! He called his professor immediately since he did not have enough data in his hand to fix the mistakes.
Their discussion is still going on now. The discussion looks proceeding with difficulty. Most of their data are written in S-expressions, so they have to exchange S-expressions via telephone.
Your task is to write a program that outputs S-expressions represented by a given English phrase.
Input
The first line of the input contains a single positive integer N, which represents the number of test cases. Then N test cases follow.
Each case consists of a line. The line contains an English phrase that represents an S-expression. The length of the phrase is up to 1000 characters.
The rules to translate an S-expression are as follows.
1. An S-expression which has one element is translated into “a list of <the element of the S-expression>”. (e.g. “(A)” will be “a list of A”)
2. An S-expression which has two elements is translated into “a list of <the first element of the S-expression> and <the second element of the S-expression>”. (e.g. “(A B)” will be “a list of A and B”)
3. An S-expression which has more than three elements is translated into “a list of <the first element of the S-expression>, <the second element of the S-expression>, . . . and <the last element of the S-expression>”. (e.g. “(A B C D)” will be “a list of A, B, C and D”)
4. The above rules are applied recursively. (e.g. “(A (P Q) B (X Y Z) C)” will be “a list of A, a list of P and Q, B, a list of X, Y and Z and C”)
Each atomic element of an S-expression is a string made of less than 10 capital letters. All words (“a”, “list”, “of” and “and”) and atomic elements of S-expressions are separated by a single space character, but no space character is inserted before comma (”,”). No phrases for empty S-expressions occur in the input. You can assume that all test cases can be translated into S-expressions, but the possible expressions may not be unique.
Output
For each test case, output the corresponding S-expression in a separate line. If the given phrase involves two or more different S-expressions, output “AMBIGUOUS” (without quotes).
A single space character should be inserted between the elements of the S-expression, while no space character should be inserted after open brackets (“(”) and before closing brackets (“)”).
Example
Input
4
a list of A, B, C and D
a list of A, a list of P and Q, B, a list of X, Y and Z and C
a list of A
a list of a list of A and B
Output
(A B C D)
(A (P Q) B (X Y Z) C)
(A)
AMBIGUOUS
|
stdin
| null | 1,982 | 1 |
[
"4\na list of A, B, C and D\na list of A, a list of P and Q, B, a list of X, Y and Z and C\na list of A\na list of a list of A and B\n"
] |
[
"(A B C D)\n(A (P Q) B (X Y Z) C)\n(A)\nAMBIGUOUS\n"
] |
[
"4\na list of A, B, C and D\na list of A, a list of O and Q, B, a list of X, Y and Z and C\na list of A\na list of a list of A and B\n",
"4\na list of A, B, C and D\na list of B, a list of P and Q, B, a list of X, Y and Z and C\na list of A\na list of a list of A and B\n",
"4\na list of A, B, C and D\na list of B, a list of P and Q, B, a list of X, Y and Z and B\na list of A\na list of a list of A and B\n",
"4\na list of A, C, C and D\na list of A, a list of P and Q, B, a list of X, Y and Z and C\na list of A\na list of a list of A and B\n",
"4\na list of A, C, C and D\na list of A, a list of P and Q, B, a list of X, Z and Z and C\na list of A\na list of a list of A and B\n",
"4\na list of A, C, C and D\na list of A, a list of P and Q, B, a list of X, Z and Z and D\na list of A\na list of a list of A and B\n",
"4\na list of A, C, C and D\na list of A, a list of O and Q, B, a list of X, Y and Z and C\na list of A\na list of a list of A and B\n",
"4\na list of A, C, C and D\na list of A, a list of P and Q, B, a list of X, Y and Y and C\na list of A\na list of a list of A and B\n",
"4\na list of A, B, C and D\na list of B, a list of P and Q, A, a list of X, Y and Z and C\na list of A\na list of a list of A and B\n",
"4\na list of A, B, C and D\na list of A, a list of P and Q, B, a list of X, Y and Z and D\na list of A\na list of a list of A and B\n"
] |
[
"(A B C D)\n(A (O Q) B (X Y Z) C)\n(A)\nAMBIGUOUS\n",
"(A B C D)\n(B (P Q) B (X Y Z) C)\n(A)\nAMBIGUOUS\n",
"(A B C D)\n(B (P Q) B (X Y Z) B)\n(A)\nAMBIGUOUS\n",
"(A C C D)\n(A (P Q) B (X Y Z) C)\n(A)\nAMBIGUOUS\n",
"(A C C D)\n(A (P Q) B (X Z Z) C)\n(A)\nAMBIGUOUS\n",
"(A C C D)\n(A (P Q) B (X Z Z) D)\n(A)\nAMBIGUOUS\n",
"(A C C D)\n(A (O Q) B (X Y Z) C)\n(A)\nAMBIGUOUS\n",
"(A C C D)\n(A (P Q) B (X Y Y) C)\n(A)\nAMBIGUOUS\n",
"(A B C D)\n(B (P Q) A (X Y Z) C)\n(A)\nAMBIGUOUS\n",
"(A B C D)\n(A (P Q) B (X Y Z) D)\n(A)\nAMBIGUOUS\n"
] |
CodeContests
|
Problem statement
Here are N mysteriously shaped vases. The i-th jar is a shape in which K_i right-sided cylinders are vertically connected in order from the bottom. The order in which they are connected cannot be changed. Mr. A has a volume of water of M. Pour this water into each jar in any amount you like. It does not matter if there is a jar that does not contain any water. Also, when all the vases are filled with water, no more water can be poured. Find the maximum sum of the heights of the water surface of each jar.
input
N \ M
K_1 \ S_ {11} \ H_ {11} \… \ S_ {1 K_1} \ H_ {1 K_1}
K_2 \ S_ {21} \ H_ {21} \… \ S_ {2 K_2} \ H_ {2 K_2}
...
K_N \ S_ {N1} \ H_ {N1} \… \ S_ {N K_N} \ H_ {N K_N}
N and M are entered in the first line, and the information of the i-th jar is entered in the 1 + i line. K_i is the number of right-sided cylinders, and S_ {ij} and H_ {ij} are the base area and height of the j-th right-sided cylinder that makes up the jar, respectively.
Constraint
* An integer
* 1 ≤ N ≤ 200
* 1 ≤ M ≤ 200
* 1 ≤ K_i ≤ 20
* 1 ≤ S_ {ij} ≤ 20
* 1 ≤ H_ {ij} ≤ 20
output
Output the answer in one line. It may include an absolute error of 0.00001 or less.
sample
Sample input 1
2 15
2 3 3 7 2
2 7 1 1 4
Sample output 1
6.33333333
Sample input 2
2 14
1 2 4
2 5 2 1 4
Sample output 2
6
The input and output of samples 1 and 2 are shown below.
<image>
Sample input 3
2 25
4 8 9 1 9 6 5 2 8
4 1 7 4 4 1 6 4 3
Sample output 3
13
Example
Input
2 15
2 3 3 7 2
2 7 1 1 4
Output
6.33333333
|
stdin
| null | 473 | 1 |
[
"2 15\n2 3 3 7 2\n2 7 1 1 4\n"
] |
[
"6.33333333\n"
] |
[
"2 15\n2 3 3 7 2\n1 7 1 1 4\n",
"2 15\n2 3 5 7 2\n0 7 1 1 4\n",
"2 15\n2 5 5 8 2\n1 7 1 1 4\n",
"2 4\n2 3 3 7 1\n0 7 1 1 6\n",
"2 25\n2 3 3 7 2\n2 7 1 1 4\n",
"2 0\n2 3 5 7 2\n1 7 1 1 4\n",
"2 4\n2 1 3 7 1\n0 7 1 1 6\n",
"2 15\n2 2 5 7 3\n0 11 0 1 4\n",
"2 15\n2 3 2 7 3\n0 11 0 1 2\n",
"2 25\n2 5 3 7 2\n2 7 1 1 4\n"
] |
[
"3.857143\n",
"5.000000\n",
"3.000000\n",
"1.333333\n",
"8.714286\n",
"0.000000\n",
"3.142857\n",
"5.714286\n",
"3.285714\n",
"7.800000\n"
] |
CodeContests
|
Snuke stands on a number line. He has L ears, and he will walk along the line continuously under the following conditions:
* He never visits a point with coordinate less than 0, or a point with coordinate greater than L.
* He starts walking at a point with integer coordinate, and also finishes walking at a point with integer coordinate.
* He only changes direction at a point with integer coordinate.
Each time when Snuke passes a point with coordinate i-0.5, where i is an integer, he put a stone in his i-th ear.
After Snuke finishes walking, Ringo will repeat the following operations in some order so that, for each i, Snuke's i-th ear contains A_i stones:
* Put a stone in one of Snuke's ears.
* Remove a stone from one of Snuke's ears.
Find the minimum number of operations required when Ringo can freely decide how Snuke walks.
Constraints
* 1 \leq L \leq 2\times 10^5
* 0 \leq A_i \leq 10^9(1\leq i\leq L)
* All values in input are integers.
Input
Input is given from Standard Input in the following format:
L
A_1
:
A_L
Output
Print the minimum number of operations required when Ringo can freely decide how Snuke walks.
Examples
Input
4
1
0
2
3
Output
1
Input
8
2
0
0
2
1
3
4
1
Output
3
Input
7
314159265
358979323
846264338
327950288
419716939
937510582
0
Output
1
|
stdin
| null | 2,602 | 1 |
[
"4\n1\n0\n2\n3\n",
"8\n2\n0\n0\n2\n1\n3\n4\n1\n",
"7\n314159265\n358979323\n846264338\n327950288\n419716939\n937510582\n0\n"
] |
[
"1\n",
"3\n",
"1\n"
] |
[
"4\n1\n0\n4\n3\n",
"8\n2\n0\n0\n2\n0\n3\n4\n1\n",
"4\n0\n0\n4\n3\n",
"8\n2\n0\n1\n2\n0\n1\n0\n1\n",
"8\n2\n0\n1\n2\n0\n1\n0\n0\n",
"8\n4\n0\n0\n2\n0\n1\n2\n1\n",
"7\n314159265\n429733551\n846264338\n327950288\n419716939\n937510582\n0\n",
"8\n2\n0\n0\n2\n0\n0\n4\n1\n",
"7\n314159265\n429733551\n846264338\n327950288\n419716939\n937510582\n-1\n",
"4\n0\n1\n4\n3\n"
] |
[
"1\n",
"4\n",
"0\n",
"3\n",
"2\n",
"5\n",
"1\n",
"4\n",
"0\n",
"1\n"
] |
CodeContests
|
Let's play Amidakuji.
In the following example, there are five vertical lines and four horizontal lines. The horizontal lines can intersect (jump across) the vertical lines.
<image>
In the starting points (top of the figure), numbers are assigned to vertical lines in ascending order from left to right. At the first step, 2 and 4 are swaped by the first horizontal line which connects second and fourth vertical lines (we call this operation (2, 4)). Likewise, we perform (3, 5), (1, 2) and (3, 4), then obtain "4 1 2 5 3" in the bottom.
Your task is to write a program which reads the number of vertical lines w and configurations of horizontal lines and prints the final state of the Amidakuji. In the starting pints, numbers 1, 2, 3, ..., w are assigne to the vertical lines from left to right.
Hint
Try it. -->
Input
w
n
a1,b1
a2,b2
.
.
an,bn
w (w ≤ 30) is the number of vertical lines. n (n ≤ 30) is the number of horizontal lines. A pair of two integers ai and bi delimited by a comma represents the i-th horizontal line.
Output
The number which should be under the 1st (leftmost) vertical line
The number which should be under the 2nd vertical line
:
The number which should be under the w-th vertical line
Example
Input
5
4
2,4
3,5
1,2
3,4
Output
4
1
2
5
3
|
stdin
| null | 2,252 | 1 |
[
"5\n4\n2,4\n3,5\n1,2\n3,4\n"
] |
[
"4\n1\n2\n5\n3\n"
] |
[
"5\n4\n2,4\n3,5\n2,1\n3,4\n",
"5\n4\n2,4\n4,5\n2,1\n3,4\n",
"5\n1\n2,4\n4,5\n2,1\n3,4\n",
"5\n0\n2,4\n4,5\n1,2\n4-3\n",
"5\n1\n1,4\n5,4\n21,\n,34\n",
"5\n4\n2,4\n3,5\n1,2\n2,4\n",
"5\n2\n2,4\n4,5\n2,1\n3,4\n",
"5\n1\n5,1\n,54\n22-\n,44\n",
"5\n2\n2,4\n3,5\n2,1\n3,4\n",
"5\n2\n1,4\n5,4\n21-\n,44\n"
] |
[
"4\n1\n2\n5\n3\n",
"4\n1\n5\n3\n2\n",
"1\n4\n3\n2\n5\n",
"1\n2\n3\n4\n5\n",
"4\n2\n3\n1\n5\n",
"4\n2\n5\n1\n3\n",
"1\n4\n3\n5\n2\n",
"5\n2\n3\n4\n1\n",
"1\n4\n5\n2\n3\n",
"4\n2\n3\n5\n1\n"
] |
CodeContests
|
Example
Input
1
Output
)(
|
stdin
| null | 1,586 | 1 |
[
"1\n"
] |
[
")(\n"
] |
[
"2\n",
"4\n",
"3\n",
"5\n",
"6\n",
"9\n",
"7\n",
"8\n",
"12\n",
"22\n"
] |
[
")()(\n",
")())((\n",
"))((\n",
"))()((\n",
")))(((\n",
")))()(((\n",
")()))(((\n",
"))())(((\n",
"))()))((((\n",
")())))))((((((\n"
] |
CodeContests
|
There is a tree with N vertices, numbered 1 through N. The i-th of the N-1 edges connects vertices a_i and b_i.
Currently, there are A_i stones placed on vertex i. Determine whether it is possible to remove all the stones from the vertices by repeatedly performing the following operation:
* Select a pair of different leaves. Then, remove exactly one stone from every vertex on the path between those two vertices. Here, a leaf is a vertex of the tree whose degree is 1, and the selected leaves themselves are also considered as vertices on the path connecting them.
Note that the operation cannot be performed if there is a vertex with no stone on the path.
Constraints
* 2 ≦ N ≦ 10^5
* 1 ≦ a_i,b_i ≦ N
* 0 ≦ A_i ≦ 10^9
* The given graph is a tree.
Input
The input is given from Standard Input in the following format:
N
A_1 A_2 … A_N
a_1 b_1
:
a_{N-1} b_{N-1}
Output
If it is possible to remove all the stones from the vertices, print `YES`. Otherwise, print `NO`.
Examples
Input
5
1 2 1 1 2
2 4
5 2
3 2
1 3
Output
YES
Input
3
1 2 1
1 2
2 3
Output
NO
Input
6
3 2 2 2 2 2
1 2
2 3
1 4
1 5
4 6
Output
YES
|
stdin
| null | 3,398 | 1 |
[
"6\n3 2 2 2 2 2\n1 2\n2 3\n1 4\n1 5\n4 6\n",
"5\n1 2 1 1 2\n2 4\n5 2\n3 2\n1 3\n",
"3\n1 2 1\n1 2\n2 3\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
[
"3\n2 2 1\n1 2\n2 3\n",
"6\n3 2 2 2 2 2\n1 2\n2 3\n1 6\n1 5\n4 6\n",
"6\n5 2 2 2 2 2\n1 2\n2 3\n1 6\n1 5\n4 6\n",
"6\n5 2 4 2 2 2\n1 2\n2 3\n1 6\n1 5\n4 6\n",
"6\n5 2 4 2 2 2\n1 2\n2 3\n1 6\n1 5\n6 6\n",
"6\n5 2 4 2 2 2\n1 0\n2 3\n1 6\n1 5\n6 6\n",
"6\n3 2 2 2 2 2\n1 2\n2 3\n1 4\n1 5\n1 6\n",
"3\n1 1 1\n1 2\n2 3\n",
"6\n0 2 2 2 2 2\n1 2\n2 3\n1 6\n1 5\n4 6\n",
"6\n5 3 4 2 2 2\n1 2\n2 3\n1 6\n1 5\n4 6\n"
] |
[
"NO\n",
"YES\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n",
"NO\n",
"YES\n",
"NO\n",
"NO\n"
] |
CodeContests
|
Problem
The appearance of the sky is different from usual. A variety of colorful hot-air balloons covered the sky. Today is a hot-air balloon tournament. It seems that all the participants will compete for the scored ball dropped from the hot-air balloon. I decided to predict the winner because it was a big deal.
* N people participate in recreation.
* Each of the N participants will be given their own position. No multiple participants will be given the same position.
* M balls fall one by one from a hot-air balloon in the sky.
* All participants start running at the same timing and run straight toward the ball at the same speed.
* The person who reaches the position where the ball falls first can get the ball. If multiple people arrive at the same time, the people who can get it will be decided with a uniform probability.
* When a participant gets the ball, all the participants return to their original positions.
* No other ball will fall between the time a participant starts running and the time all participants return to their original positions.
* Each ball is given a score and a position to fall, and when you get the ball, you get a score.
* Because the ball receives air resistance during the fall, there will be a gap at the point where it actually falls. It deviates from the planned drop position by ± dx in the X-axis direction and ± dy in the Y-axis direction with a uniform probability.
Find the expected value of the score to be obtained and output the expected value of the participant with the highest expected value.
Constraints
The input satisfies the following conditions.
* 1 ≤ N ≤ 100
* 1 ≤ M ≤ 10
* 0 ≤ xi, yi, bxj, byj ≤ 10000
* 1 ≤ dxj, dyj ≤ 10000
* 1 ≤ scorej ≤ 100
* The number of test cases does not exceed 10.
* All values contained in the input are integers.
Input
The input consists of multiple datasets.
Each dataset is represented below.
N M
x1 y1
..
..
xN yN
bx1 by1 dx1 dy1 score1
..
..
bxM byM dxM dyM scoreM
The first line gives the number of participants N and the number of balls M.
Participant information is given from the second line to the N + 1 line. xi and yi are the X and Y coordinates of the participant's position, respectively.
Ball information is given from the N + 2nd line to the N + M + 1st line. The X and Y coordinates of the point where each ball actually falls are somewhere in the range from bxj --dxj to bxj + dxj and from byj --dyj to byj + dyj. scorej is the score of the ball.
The end of the input consists of two zeros.
Output
Print the answer on one line for each dataset.
The output may contain an error of 0.0001 or less.
Example
Input
3 4
10 75
50 5
90 75
50 50 10 10 2
40 90 1 1 3
10 20 10 15 1
50 70 50 50 4
4 2
25 25
25 75
75 75
75 25
50 50 10 10 1
50 50 15 15 2
1 1
5 5
1 1 1 1 1
0 0
Output
5.442857
0.750000
1.000000
|
stdin
| null | 4,474 | 1 |
[
"3 4\n10 75\n50 5\n90 75\n50 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n"
] |
[
"5.442857\n0.750000\n1.000000\n"
] |
[
"3 4\n10 75\n50 5\n79 75\n50 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 75\n50 5\n79 75\n50 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n66 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 75\n50 5\n90 75\n50 50 10 10 2\n40 90 1 1 3\n5 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 75\n50 5\n79 75\n50 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 46\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 75\n50 5\n79 75\n39 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n66 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 75\n50 5\n90 75\n50 50 10 10 2\n40 90 1 1 3\n5 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 30\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 122\n50 5\n79 75\n50 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 46\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 75\n50 5\n79 75\n39 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n66 70 50 50 4\n4 2\n25 25\n25 75\n75 75\n75 36\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 37\n50 5\n90 75\n50 50 10 10 2\n40 90 1 1 3\n5 20 10 15 1\n50 70 50 50 4\n4 2\n25 25\n25 75\n75 30\n75 25\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n",
"3 4\n10 122\n50 5\n79 75\n50 50 10 10 2\n40 90 1 1 3\n10 20 10 15 1\n50 70 50 9 4\n4 2\n25 25\n25 75\n75 75\n75 46\n50 50 10 10 1\n50 50 15 15 2\n1 1\n5 5\n1 1 1 1 1\n0 0\n"
] |
[
"5.009614\n0.750000\n1.000000\n",
"4.417157\n0.750000\n1.000000\n",
"5.538095\n0.750000\n1.000000\n",
"5.009614\n1.698550\n1.000000\n",
"5.374300\n0.750000\n1.000000\n",
"5.538095\n1.387500\n1.000000\n",
"6.367198\n1.698550\n1.000000\n",
"5.374300\n1.294294\n1.000000\n",
"5.599905\n1.387500\n1.000000\n",
"7.311511\n1.698550\n1.000000\n"
] |
CodeContests
|
N programmers are going to participate in the preliminary stage of DDCC 20XX. Due to the size of the venue, however, at most 9 contestants can participate in the finals.
The preliminary stage consists of several rounds, which will take place as follows:
* All the N contestants will participate in the first round.
* When X contestants participate in some round, the number of contestants advancing to the next round will be decided as follows:
* The organizer will choose two consecutive digits in the decimal notation of X, and replace them with the sum of these digits. The number resulted will be the number of contestants advancing to the next round.
For example, when X = 2378, the number of contestants advancing to the next round will be 578 (if 2 and 3 are chosen), 2108 (if 3 and 7 are chosen), or 2315 (if 7 and 8 are chosen).
When X = 100, the number of contestants advancing to the next round will be 10, no matter which two digits are chosen.
* The preliminary stage ends when 9 or fewer contestants remain.
Ringo, the chief organizer, wants to hold as many rounds as possible. Find the maximum possible number of rounds in the preliminary stage.
Since the number of contestants, N, can be enormous, it is given to you as two integer sequences d_1, \ldots, d_M and c_1, \ldots, c_M, which means the following: the decimal notation of N consists of c_1 + c_2 + \ldots + c_M digits, whose first c_1 digits are all d_1, the following c_2 digits are all d_2, \ldots, and the last c_M digits are all d_M.
Constraints
* 1 \leq M \leq 200000
* 0 \leq d_i \leq 9
* d_1 \neq 0
* d_i \neq d_{i+1}
* c_i \geq 1
* 2 \leq c_1 + \ldots + c_M \leq 10^{15}
Input
Input is given from Standard Input in the following format:
M
d_1 c_1
d_2 c_2
:
d_M c_M
Output
Print the maximum possible number of rounds in the preliminary stage.
Examples
Input
2
2 2
9 1
Output
3
Input
3
1 1
0 8
7 1
Output
9
|
stdin
| null | 2,087 | 1 |
[
"3\n1 1\n0 8\n7 1\n",
"2\n2 2\n9 1\n"
] |
[
"9\n",
"3\n"
] |
[
"3\n1 0\n0 8\n7 1\n",
"3\n1 0\n0 8\n7 2\n",
"3\n1 0\n0 10\n7 2\n",
"3\n1 0\n0 17\n7 2\n",
"3\n1 1\n0 17\n7 2\n",
"3\n1 1\n0 4\n7 2\n",
"3\n1 0\n0 4\n7 2\n",
"3\n1 0\n0 4\n7 1\n",
"3\n1 0\n0 3\n7 1\n",
"3\n1 1\n0 8\n7 2\n"
] |
[
"8\n",
"10\n",
"12\n",
"19\n",
"20\n",
"7\n",
"6\n",
"4\n",
"3\n",
"11\n"
] |
CodeContests
|
Mr. Dango's family has an extremely huge number of members. Once it had about 100 members, and now it has as many as population of a city. It is jokingly guessed that the member might fill this planet in the near future.
Mr. Dango's family, the huge family, is getting their new house. Scale of the house is as large as that of town.
They all had warm and gracious personality and were close each other. However, in this year the two members of them became to hate each other. Since the two members had enormous influence in the family, they were split into two groups.
They hope that the two groups don't meet each other in the new house. Though they are in the same building, they can avoid to meet each other by adjusting passageways.
Now, you have a figure of room layout. Your task is written below.
You have to decide the two groups each room should belong to. Besides you must make it impossible that they move from any rooms belonging to one group to any rooms belonging to the other group. All of the rooms need to belong to exactly one group. And any group has at least one room.
To do the task, you can cancel building passageway. Because the house is under construction, to cancel causes some cost. You'll be given the number of rooms and information of passageway. You have to do the task by the lowest cost.
Please answer the lowest cost.
By characteristics of Mr. Dango's family, they move very slowly. So all passageways are escalators. Because of it, the passageways are one-way.
Constraints
* 2 ≤ n ≤ 100
* -10,000 ≤ Ci ≤ 10,000
* Y1 ... Ym can't be duplicated integer by each other.
Input
The input consists of multiple datasets. Each dataset is given in the following format.
n m
X1 Y1 C1
...
Xm Ym Cm
All numbers in each datasets are integers. The integers in each line are separated by a space.
The first line of each datasets contains two integers. n is the number of rooms in the house, m is the number of passageways in the house. Each room is indexed from 0 to n-1.
Each of following m lines gives the details of the passageways in the house. Each line contains three integers. The first integer Xi is an index of the room, the starting point of the passageway. The second integer Yi is an index of the room, the end point of the passageway. The third integer Ci is the cost to cancel construction of the passageway. The passageways, they are escalators, are one-way. The last dataset is followed by a line containing two zeros (separated by a space).
Output
For each dataset, print the lowest cost in a line. You may assume that the all of integers of both the answers and the input can be represented by 32 bits signed integers.
Example
Input
3 2
0 1 2
1 2 1
2 1
0 1 100
2 1
0 1 0
2 1
0 1 -1
0 0
Output
1
100
0
-1
|
stdin
| null | 5,061 | 1 |
[
"3 2\n0 1 2\n1 2 1\n2 1\n0 1 100\n2 1\n0 1 0\n2 1\n0 1 -1\n0 0\n"
] |
[
"1\n100\n0\n-1\n"
] |
[
"3 2\n0 1 2\n1 2 1\n2 1\n0 1 100\n2 1\n0 0 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 1 2\n1 2 1\n2 1\n1 1 100\n2 1\n0 0 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 2 2\n0 2 1\n2 1\n0 1 100\n2 1\n0 1 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 1 2\n1 2 1\n2 1\n0 1 100\n2 0\n0 0 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 1 2\n1 2 1\n2 1\n0 1 101\n2 0\n0 0 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 1 2\n1 2 1\n2 1\n0 1 101\n2 1\n0 0 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 1 2\n1 2 1\n2 1\n0 1 100\n2 1\n0 1 0\n2 1\n0 1 -2\n0 0\n",
"3 2\n0 2 2\n0 2 2\n2 1\n0 1 000\n2 1\n0 1 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 1 2\n1 2 1\n2 1\n1 1 101\n2 0\n0 0 0\n2 1\n0 1 -1\n0 0\n",
"3 2\n0 2 2\n0 2 1\n2 1\n0 1 100\n2 1\n0 1 -1\n2 1\n0 1 -1\n0 0\n"
] |
[
"1\n100\n0\n-1\n",
"1\n0\n0\n-1\n",
"0\n100\n0\n-1\n",
"1\n100\n0\n",
"1\n101\n0\n",
"1\n101\n0\n-1\n",
"1\n100\n0\n-2\n",
"0\n0\n0\n-1\n",
"1\n0\n0\n",
"0\n100\n-1\n-1\n"
] |
CodeContests
|
Rachel, being an awesome android programmer, just finished an App that will let us draw a triangle by selecting three points on the touch-plane.Now She asks her friend Bruce to draw a Right-Angled Triangle (we'll call it RAT) by selecting 3 integral points on the plane.
A RAT is a triangle with Non-Zero area and a right-angle.
But Bruce, being in a hurry as always, makes a mistake on drawing the points. Now Rachel's app can fix Bruce's mistake if only one coordinate of any one point can be adjusted within a distance of 1 units. i.e., if the drawn triangle can be made a RAT by adjusting any one coordinate within 1 unit of distance.
Your task is simple, given 6 coordinates (each Integer pair representing a point), you have to tell can Rachel's app correct Bruce's mistake automatically?
Input:
First line containing T, the number of test cases.
Then T lines follow with 6 space separated coordinates.
Output:
print "YES" in a newline if it's possible.
otherwise print "NO" in a newline.
Constraints:
1 ≤ T ≤ 100
-1000 ≤ xi,yi ≤ 1000
SAMPLE INPUT
3
-1 0 2 0 0 1
2 3 4 5 6 6
0 0 2 0 10 10
SAMPLE OUTPUT
YES
NO
NO
Explanation
Case 1: For (-1, 0), (2, 0) and (0, 1), shifting (-1, 0) to (0, 0) makes it a RAT.
Case 2 and Case 3: No any possible shift results into a RAT.
Note that any point can be moved either in x- or in y- direction at a time by 1 unit.
|
stdin
| null | 3,259 | 1 |
[
"3\n-1 0 2 0 0 1\n2 3 4 5 6 6\n0 0 2 0 10 10\n\nSAMPLE\n"
] |
[
"YES\nNO\nNO\n"
] |
[
"15\n27 44 85 23 100 99\n-97 -19 17 62 30 -76\n28 -15 86 32 98 -41\n-66 24 8 -29 17 62\n-83 40 -80 52 -71 43\n-88 67 -62 37 -49 75\n58 45 6 22 13 79\n75 86 -82 89 -37 -35\n34 74 -2 -95 63 -33\n-7 63 78 74 -39 -30\n-49 -99 7 92 61 -28\n-90 90 87 -92 -40 -26\n-100 -100 100 -100 0 73\n39 22 94 25 69 -23\n100 100 -100 100 1 -73\n",
"3\n-1 0 2 0 0 1\n2 3 4 5 6 7\n0 0 2 0 10 10\n\nSAMPLE\n",
"3\n-1 0 2 0 0 1\n2 3 4 5 6 2\n0 0 2 0 10 10\n\nSAMPLE\n",
"3\n-1 0 2 2 0 1\n2 3 4 0 6 2\n0 0 2 0 10 10\n\nSAMPLE\n",
"3\n-1 0 2 2 0 1\n0 3 2 0 6 2\n0 0 0 -1 10 10\n\nSAMQLE\n",
"3\n-1 0 2 2 0 2\n0 3 2 1 0 2\n0 0 0 -1 10 10\n\nSAMQLE\n",
"3\n-1 0 1 4 0 2\n0 4 2 1 1 2\n0 -1 0 -2 10 20\n\nELQMSA\n",
"3\n1 -1 3 5 1 2\n1 0 -2 0 0 0\n1 0 -6 -1 2 -1\n\nTBLDQN\n",
"15\n40 9 22 0 110 20\n-14 -66 0 72 38 -172\n14 -8 3 38 14 -7\n-29 42 13 -123 35 23\n-167 186 -43 0 -25 0\n-4 128 -148 26 -33 121\n103 71 0 118 -1 113\n119 6 -82 176 -3 -45\n8 341 -9 -33 42 -13\n0 63 78 010 -1 -2\n-3 -11 2 145 77 -3\n-351 6 21 -8 -72 -54\n-108 0 101 -252 -1 509\n54 13 94 25 52 -25\n100 101 -54 001 0 -29\n",
"15\n40 9 22 0 110 20\n-14 -48 0 72 38 -219\n19 -8 3 38 14 -7\n-29 42 24 -123 35 23\n-167 260 -43 0 -25 0\n-4 128 -339 26 -33 121\n103 71 0 111 0 113\n1 6 -82 176 -3 -60\n8 341 -9 -33 42 -13\n0 63 78 011 -1 -2\n-3 -11 4 145 77 -3\n-351 6 21 -8 -72 -54\n-108 0 000 -252 -1 193\n54 13 94 43 52 -29\n100 100 -12 000 0 -10\n"
] |
[
"NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\n",
"YES\nNO\nNO\n",
"YES\nYES\nNO\n",
"NO\nYES\nNO\n",
"NO\nYES\nYES\n",
"YES\nYES\nYES\n",
"NO\nNO\nNO\n",
"NO\nNO\nYES\n",
"NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\n",
"NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\n"
] |
CodeContests
|
Multiple polygonal lines are given on the xy-plane. Given a list of polygonal lines and a template, you must find out polygonal lines which have the same shape as the template.
A polygonal line consists of several line segments parallel to x-axis or y-axis. It is defined by a list of xy-coordinates of vertices from the start-point to the end-point in order, and always turns 90 degrees at each vertex. A single polygonal line does not pass the same point twice. Two polygonal lines have the same shape when they fully overlap each other only with rotation and translation within xy-plane (i.e. without magnification or a flip). The vertices given in reverse order from the start-point to the end-point is the same as that given in order.
Figure 1 shows examples of polygonal lines. In this figure, polygonal lines A and B have the same shape.
Write a program that answers polygonal lines which have the same shape as the template.
<image>
---
Figure 1: Polygonal lines
Input
The input consists of multiple datasets. The end of the input is indicated by a line which contains a zero.
A dataset is given as follows.
> n
> Polygonal line0
> Polygonal line1
> Polygonal line2
> ...
> Polygonal linen
n is the number of polygonal lines for the object of search on xy-plane. n is an integer, and 1 <= n <= 50. Polygonal line0 indicates the template.
A polygonal line is given as follows.
> m
> x1 y1
> x2 y2
> ...
> xm ym
>
m is the number of the vertices of a polygonal line (3 <= m <= 10). xi and yi, separated by a space, are the x- and y-coordinates of a vertex, respectively (-10000 < xi < 10000, -10000 <yi < 10000).
Output
For each dataset in the input, your program should report numbers assigned to the polygonal lines that have the same shape as the template, in ascending order. Each number must be written in a separate line without any other characters such as leading or trailing spaces.
Five continuous "+"s must be placed in a line at the end of each dataset.
Example
Input
5
5
0 0
2 0
2 1
4 1
4 0
5
0 0
0 2
-1 2
-1 4
0 4
5
0 0
0 1
-2 1
-2 2
0 2
5
0 0
0 -1
2 -1
2 0
4 0
5
0 0
2 0
2 -1
4 -1
4 0
5
0 0
2 0
2 1
4 1
4 0
4
4
-60 -75
-60 -78
-42 -78
-42 -6
4
10 3
10 7
-4 7
-4 40
4
-74 66
-74 63
-92 63
-92 135
4
-12 22
-12 25
-30 25
-30 -47
4
12 -22
12 -25
30 -25
30 47
3
5
-8 5
-8 2
0 2
0 4
8 4
5
-3 -1
0 -1
0 7
-2 7
-2 16
5
-1 6
-1 3
7 3
7 5
16 5
5
0 1
0 -2
8 -2
8 0
17 0
0
Output
1
3
5
+++++
3
4
+++++
+++++
|
stdin
| null | 4,791 | 1 |
[
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n5\n0 0\n0 2\n-1 2\n-1 4\n0 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-2 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n"
] |
[
"1\n3\n5\n+++++\n3\n4\n+++++\n+++++\n"
] |
[
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-2 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 -1\n2 1\n4 1\n4 0\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-1 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n5\n0 0\n0 2\n-1 2\n-1 4\n0 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n1 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-2 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 -1\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-1 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 -1\n2 1\n4 1\n4 0\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n4 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n46 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-1 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n5\n0 0\n0 2\n-1 2\n-1 4\n0 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n1 0\n2 1\n4 1\n4 0\n4\n4\n-24 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-2 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 -1\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -40\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 1\n-2 7\n-1 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 -1\n2 1\n4 1\n4 1\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n-1 1\n-2 1\n-4 2\n0 2\n5\n0 0\n0 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -34\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-1 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 -1\n2 1\n4 1\n4 0\n5\n1 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n0 -1\n2 1\n4 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-42 -6\n4\n10 3\n10 7\n-4 7\n-2 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 41\n-12 25\n-30 25\n-30 -47\n4\n12 -22\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n15 4\n5\n-3 -1\n0 -1\n0 7\n-2 7\n-1 16\n5\n-1 6\n0 3\n7 3\n7 5\n16 5\n5\n0 1\n0 -2\n8 -2\n8 0\n17 0\n0\n",
"5\n5\n0 0\n2 0\n2 1\n4 1\n4 -1\n5\n0 0\n0 2\n-1 2\n-1 4\n1 4\n5\n0 0\n0 1\n-2 1\n-2 2\n0 2\n5\n0 0\n-1 -1\n2 -1\n2 0\n4 0\n5\n0 0\n2 0\n2 -1\n4 -1\n4 0\n5\n0 0\n2 0\n2 1\n4 1\n4 0\n4\n4\n-60 -75\n-60 -78\n-42 -78\n-51 -6\n4\n10 3\n10 7\n-8 7\n-4 40\n4\n-74 66\n-74 63\n-92 63\n-92 135\n4\n-12 22\n-12 25\n-30 25\n-30 -47\n4\n12 -40\n12 -25\n30 -25\n30 47\n3\n5\n-8 5\n-8 2\n0 2\n0 4\n8 4\n5\n-3 -1\n0 -1\n0 1\n-2 8\n-1 16\n5\n-1 6\n-1 3\n7 3\n7 5\n16 5\n5\n0 1\n0 0\n8 -2\n8 0\n17 0\n0\n"
] |
[
"3\n5\n+++++\n3\n4\n+++++\n+++++\n",
"+++++\n3\n4\n+++++\n+++++\n",
"1\n3\n+++++\n3\n4\n+++++\n+++++\n",
"1\n+++++\n3\n4\n+++++\n+++++\n",
"+++++\n3\n+++++\n+++++\n",
"1\n3\n+++++\n+++++\n+++++\n",
"1\n+++++\n3\n+++++\n+++++\n",
"+++++\n+++++\n+++++\n",
"+++++\n4\n+++++\n+++++\n",
"1\n+++++\n+++++\n+++++\n"
] |
CodeContests
|
Given a String(only lower case letters) , check if any substring has occured Twice :
Example : iwsagoodboody
Here, substring "ood" occurs twice.
Output "YES" if there is any such substring else output "NO" .(without qoutes)
Input:
First line of input consists of an integer T (1 ≤ T ≤ 100) , indicating the number of test cases.
For each test case, there will be a string s (1 ≤ |s| ≤ 2000)
Output:
Print "YES" if there is any such substring else Print "NO" .(without quotes)
SAMPLE INPUT
3
abcdefghi
dogsbarkatdogs
howtheydo
SAMPLE OUTPUT
NO
YES
YES
|
stdin
| null | 3,947 | 1 |
[
"3\nabcdefghi\ndogsbarkatdogs\nhowtheydo\n\nSAMPLE\n"
] |
[
"NO\nYES\nYES\n"
] |
[
"100\nhq\nh\nmeayl\nlfdxfi\ncvscxggb\nkfnqdux\nfnf\nzvsrt\njprep\ngxrpn\nvy\ntmwcysy\ncqpev\nk\nffmznim\nkasvwsr\nnzkycxf\ntlsg\np\nfaopode\nxzbcoejuvp\naboygp\neylfp\nnpljvrvi\nya\nyehwqnq\nqpmxuj\nloovao\nu\nwh\nsncbxcoks\nzkvatxdk\nlyjyhfix\nswnkkufnux\nzrzbmn\ngqooketly\nnkoaugzqrc\ndi\nteiojwa\nyzp\nscmpsajlfv\nubfaaov\nzylntrkdcp\nsrtesjwhd\nzcobzcn\nwl\ni\ntvdw\nxhrcbldv\nylwgbus\nmb\nrxtlhcs\npxo\ngm\nnke\nfdx\nt\ngbgxpey\nn\netcukepzsh\nlju\nggekj\nqzje\npevqgxie\njsrd\njazujl\nchhb\nqm\nimw\nobiwybxd\nu\nfsksrsrt\nkmqdcyz\nee\nhmsrq\nozijipf\noneeddpsz\nnavymmta\nbdzqsoem\nvnpppsu\ncbazu\nmhecthlegr\nunkd\nbppweqtgj\np\nrmowz\nqyoxyt\nbbhawdyd\nprjbxph\nohp\nwqy\nhrq\nhnbn\nuvqnqqlr\njpxiog\nliexdz\nzosrk\nusvojb\nzmwzpo\nkjilefraa\n",
"100\nhqghumeaylnlfdxfircvscxggbwkfnqduxwfnfozvs\ntkjprepggxrpnrvystmwcysyycqpevikeffmznimkkasvwsrenzkycxfxtlsgypsfadpooefxzbcoejuvpvaboygpoeylfpbnpljvrvipyamyehwqnqrqpmxujjloovaowuxwhmsncbxcoksfzkvatxdknlyjyhfixjswnkkufnuxxzrzbmnmgqooketlyhnkoaugzqrcddiuteiojwayyzpvscmpsajlfvgubfaaovlzylntrkdcpwsrtesjwhdizcobzcnfwlqijtvdwvxhrcbldvgylwgbusbmborxtlhcsmpxohgmgnkeufdxotogbgxpeyanfetcu\nepzshkljugggekjdqzjenpevqgxiepjsrdzjazujllchhbfqmkimwzobiwybxduunfsksrsrtekmqdcyzjeeuhmsrqcozijipfioneeddpszrnavymmtatbdzqsoemuvnpppsuacbazuxmhecthlegrpunkdmbppweqtgjopa\nmowzdqyoxytjbbhawdydcprjbxphoohpkwqyuhrqzhnbnfuvqnqqlrzjpxiogvliexdzuzosrkrusvojbrzmwzpowkjilefraamdigpnpuuhgxpqnjwjmwaxxmnsnhhlqqrzudltfzotcjtnzxuglsdsmzcnockvfajfrmxothowkbjzwucwljfrimpmyhchzriwkbarxbgfcbceyhjugixwtbvtrehbbcpxifbxvfbcgkcfqckcotzgkubmjrmbsztsshfroefwsjrxjhguzyupzwweiqurpixiqflduuveoowqcudhnefnjhaimuczfskuiduburiswtbr\ncuykabfcvkdzeztoidukuhjzefczz\nbfkq\npqzikfobucdhthxdjgkjelrlpaxamceroswitdptpcclifkeljytihrcqaybnefxnxvgzedyyhngycdrudmphmeckotrwospofghfozqvlqfxwwkmfxdyygmdcaszsgovsodkjghcwmbmxrmhuyfyqgajqkcklznayxqkqoyzwmyubzazcpkhktkyd\nivcuypurfmbisgekyrgzvxdhpoamvafyrarxsvkhtqdihersigbhzjzujxmmyspnaraewkegjccvhhrjvbjtsqdjootgpknfpfycgfieowqrwwwpzsqmetogepspxnvjiupalyynmkmnuvklhsecdwracgfmzkgipdfodkjmjqwiqpuoqhimvfvuzwyvijgfullkjduhsjafbtlkmfqrmyjfjnhhssqctydteamdcjbprhtnegyiwxgcjwlgrsmeaearwtvjsjbaoiojlwhypnvruihoswkifygtydhacwyhsgewzmtgonzltjhgauhnihreqgjfwkjsmtpjhaefqzaauldrchjccdyrfvvrivuyeegfivdrcygurqdredakubnfguproqylobcwqxkzmausjgmhcmhgdnmphnqkam\nurktrffaclvgrzkkldacllteojomonxrqyjzginrnnzwacxxaedrwudxzrfusewjtboxvynfhkstcena\nmnddxfdmvzcautdcckxaaydzsxttobbgqngvvpjgojoglmkxgbfcpypckqchbddzwrxbzmqrlxvobtwhxginfgfrcclmznmjugwwbsqfcihubsjollmsqsghmcphelsotflbgsfnpcuzsrupchynvzhcpqugriwniqxdfjpwpxfblkpnpeelfjmtkuqpzomwnlmbupmktlptndmpdsydsgvfpenemwborifsuqhceskmkhssmvnonwafxwhgbibabvqopqfoviussqfqwehtxdzujtlntxmrjxxwtlggkytbiolydnilqadojskkvfxahhjmbocljarintdwcldvdxropbyjzwyyojuothwmlvrglfzdzdbtubxuoffvncr\nwsaznmoijoivvgobqpnckwvnhkebmtdhvygkjisuxhatmuudqbhmknhfxaxqxkjlzzqtsjfaeedfuujkolxjoqkdvfepvlhvhrwtfdukxffjpsswyxlijjhevryxozbafpfmowgrgonuatdqlahyggyljddjhmltedzlodsrkeutgtnkntarjkpxinovgzdthunwooxvjjmpsvknhkwjopmmlebksucvzqlyqnwcmbvbhrmlowpjbwyvwtgtoqnmicxapzarknnxtuufarzrosdqwsmtcjghecqudosrtjxyaaykqrxycrxuwjxnpqjnbkcpdmokalxapemvbqlzsvxzkutappwgzpdpyzkzcvbntcvfxsxpjaoxtfhvxxy\ngokrcxaetauqgndmphwzyiayabjrqgeppxyjsttyzuvldvybsuxkbmfzvrtnovidznpghozvafmsnsnqivmvubcwtfsrqtmknepbhowejazhkwcmmtpixxxlzqysxtwwtaidyaxyqleprxibexxyfvsddygthcuyyfwpjsfybglgzmbintattnhodtonpyzwotkgnguphpkxeatowzabsdnvqhkfcmofisfrfqgvpmvorpjfzslzmpjjnehrykxjzubuacclfkcyzobghtuoxrajvprecwgxxpswcgmmvedewdmfnqwcuqdsciliqecihluilgmfcswtwkkxlcbhqkvcswjebkrjlpgfgratzbsguvzifnhyxwjsjavwauxpannamxjdvzuhnaczyhepwzolhuslrkvwpnvgzmiizwudwdfzlktbqdxgyyiudsjvezkmesbjlkyertahnexhuqmjicbmusqd\nlasolwjxptxxeumzfwyucpabqseffunqpkfnnbecbbcjpdyjlibitllplxelrdkexdtquvptteyhtlqlbbbvoqozkynayyrbaqmyjhzxndsiyfsexwbioewqvqrtcdlpqmvjifvgymkgotzjmnzqtmrpndevnmthjitss\naqnjrdoyjwpyatmleyqsvkpamsvbmvxrllivfedkjigavyxjveqvrbacuigaipyhbbxipbzncwhrblirizxoqptqqweaafjeqiozpyfauuqmvhxkmnxmsyamptlzanotlslwuhtfqjrrwbwhmqhzkhdkcrfvbeiyipvfvpzhyujabtqwwtbkdogkemhibyxrnxsxrzletbqexkrqoiernaplqyjpqoubvjsebalwnksvloidzfpirwycztwzzvewxotakudkpedupkczlhwuskdnevdcplbklpjmpfdcyqtrcvvvtrffvpekkqmcupryjauteuvczvicthrxsxclprgdlwxfaigayrueicufdiamhtkbxotdirxxgvzqmeyrovfichqnivfjzauqfdftgmopsrgpugxtuhlcvspihazrssfszwxbqm\nrwmxcdbhumrgjqmvnkyrtnsjvwzxssqxnjomuyjnjuwrsyxwqyyxcszpoklwjdrltbsciedpiwlaqigesjsqhsjlrglmwanrxrfnwakztgjhxaunfqjvxiohnjq\nzjttwywkmhaaciixusjivgiissvbhwmqfccbftqsjnzetxnksxttdlhdnmqxwxjdazwaxrkytvocuxnsciklaamkcsmtaqhaviupcqysmkwunrlkglkfituhgzwxnoteotwqntimtopothtxzbqjpuigaghysmomqxazrppogmghyoyslhwchblyibtmlgxarlypdgxxmwywnfzhbzfsmeijdlbfzkteqrqoirzgmhizrslqhpxxzdcjvorgiwlvrqpawzecgszsiejpesbkcusluxgwksrpczywkuxlmdghyrmocdsvefmqyhajoqmwrsyouorhkfwgklpestbcfzripcswnulmqgvryizbsxzsbpwdythqovsjrjhuhkzyayyhafusxxacvjmxtrchrqsbbagmhulzoeywwgjfeoyshtusjbhzpwekxwkgjvtzkjqpoyuybxompdjljoizithvsejhfegwvodmyhsj\npkwlbmjahtputiebpbbmuegyrhlthxwgjprwvhshzyavqyecztozoabnanhrrbddndodxeuiozioiuozxqtihwauroqrdqwcvlxzipodiispqnzomcwvaptgrgdfnyytkwwqqtmiuuyvgaihfs\nccxhuuyyhtgdglfciebdutoeunfhdaxphbsywztpwjngjncpxrjvbvccefkbemgsdymzmmkwdehfkruqbyvecmpesromdxllubryyeshqlzmrewqnkqitxgiigquskwtcznlterxbltzydyzvahnkixjwzztdjpqsuowkvfccockvrjbfrjpcgdjdrwdnposrjgd\nqrvqtvppazhltjqvcclpeztsjpynzfrotqpoxmwhhwewnvcbvdkuzififrtwqqeojueqbnskwzeewzkaojursqgsczvhhujzumigofhwbkkfluwzkctkagxksmfauwinsjlsojtrxhwmhlvbypecjeiwwstneuiqubpgugwgnmikdwickdilsnpdqsvmterdfblhwbafbgarcsfijylbiimofgxeirpb\nywqzapkkcafcomvntmdhzxlefppyebeoeqznbhycwmfyaqqiannyhqouizveavgzjwoblsgwnkvjlnivqcwvzxtcthynmuxqkwwmtfisgglgcoxpipytdbamrykbokmwgsddpqkrzyjchztmiepagwhroqkhwudbcihpqwaqzxugkvakvlavkswfzsdbvqidhtbcdeytmpphkuhsxorpufwhjrutksslhlrxlydxvkosaggmpbgzvbafazjohqsswtorckqaxsrehnrlyjiwtmhglkozfkmmxtyvoxhfkxop\nybjzoxhzubdntoamzottcjtuegmpqkcdbbgckjqtebichznpprqiswbdhoyncsaetlgbfviocfwxwdrnlffbfhvyxzukjwocyhzqjzdhtbrrrllktchfnctpirnawonydwwvuabuqcimcnlhqodemakmunmaxiomkeywcofqbkdmzoizgqipzayixrydwsovhztkgzskwptkqcexrnnxskywndqizlzklnissamqazhlndnviltkoiafmeicgguzxhrdjzzheruswavnvslonoasrudrnldkldkfztagienatjzwxclkkulncaqptoneqlnbtoddbmivazxzmcojdhiswkaxiagtutafrsvpphuraaaixztwdyruumqadjepvvcvoidwmtpbnmquiopiwpuwczdapdzghavviyirojnolsowrmvvjiqswricmzsxavdqamnfhwfgeohskkefutxxibhpulnlwxqwwzdgdjgeqw\npbhlpudoemnntpouahgxjhzjbeplttriabwucrjmbvbozvmxobatkhqsqchlh\nbofuikwafkcowuuntfhpkdeyhokquwqvwtthhhugjzmfeuinipbncizockaadalljreqtkhudblprzlsrwxoccslutwqzsqtijvcwnpflrlukdiaohqjhraglgriykldkdfrdrxjstcwrsxgywfnhcbkpmesupmtrvipfbktbwzfahoe\nnhxbrhhfobgywcvhktdoxqtekiwwurzblmldlfibdvemunnlxubykvvrgktrerptisizxhrevnxquezxkugroohrhudidgvhtjhyezky\npfxwgprpseaccxkwvixvfhqfawkfdjpyeevdggatfiekixeyrfcpxscjkcfgqmyhjmjtimdspizhwzizcyuceglmmbgygfvtqvzqatxlgibyzzkiajxmbhmkqlwhqnghlvlzgppxooeoqxppbpmblxnkeofmniumjcafcuyvdcueterqpjjwaknkxtlzqfljnwkxgkfylnukbiysplkhjucfuwohzvphjbjyovdlnbfrkvbemwytfjynqmgzagbkwekkouxdcynkhtosfytlucentoilfuldvrxlonvkxzecxepkmzzgxluahmjyecsldjesdcpjikvpaudvkxgllisaambovjkdqrkdorjfnyghhhptzifawftzqgemnhpqyictmoyfpcvkcaodakjacqauzyowdzsfqhkplfbyzmnimdlxmjydaxyjnecxsj\nbhiqnvocdenqmwilxxzoqfotpikpqudmomikppzhdhfqsgbxiisyzwnhxyfvydfmpdwomciudcnyndgcnfjitp\nmymxiisnebpywsgqsxdjplwzfmjoopyyifvkmwwpgpljeawpvapihoxuuffbrwhpevcoqrgrqwzhibnorkhzmlbzfhxunrklibvpszznopfgaxzgfltlsxbtumilocltgcozgtziufuzimxeekwnysbicrfxdiogcseozpscrhjotyczcwmbaaolsvubpylonmwajgxzgyzaovenfvocikqjtxgvenksppwwplhxtgybvmajeyfaxegseijikcmduclaaioissisiyppnzdubptsaveszsippqmotjhkudnvqzbkatnefulgexktrmhddapswptfvovujiuwbmibructtmrvznjrchjwzwmozecrznjkfrvkrmrdwroaocqpktlmwxwtnuamqelrwbgbijilnhiiulltovbeflwlpbhyffhbavhfuahl\nndjdfpekxglixlaxxtolhglvwxkyvulcyjeflloqzhltmgtujdcuugnrotlotcpbnyfhejegcmfptqmveghmfbmvklsqfubvxctepvmljohzxxoolnvlayguokqdauptyvjafzzkqtaxjlrbrukkkigjmxqrbazlpdevpezpbwshvpckldqgivlqpirqvwqquyxpixqireuqamffsvvntguxesidrnwwtqkdozfpkduulifzdpohcgubkurehrqbbxajefbfhkzbpkapbszyspdaaoxraojotjufsturtjhudpetsgrzuigusnwlyrvfnkkmsdbuhvhfqtdvtnlewfquuht\ninkebbvzhtqbkdbmvhbsnjbtvjtqnbchiwfuqlzsmxvfjtvquitivyhzpxcdjwikfatcanchxssjluhlyoebcgnsqfzxxwgliuejobcfpvnyrrpkegeqpvlhxeeocmerjmziudtsqqozvejnrtibvnjepfqdsmvstmmwwwqkn\nrmqmjccpaowazfeurgpbfryedqjrltmymhysoicwuohferebeacazuvjoxyipmsgufjiwlcfywxteyyqdhxwjhiudghyxyoxbsceftdr\nelxfvcfbbjjyfsvkvsapdshakgdvhcfmceztgjcmhxlhasqkauqlnfhggtagrnffmnpinwlexrqxisbfnhjzqvoxkukylzcrupmibacpjzsnaclmnuqnbdifzlujqvnfjxxvkczfkzzjqnaqpohygjsjtakzrsosyqhquhkjcjyugtedogfurkxiyqufotiajmwhyilthmoevlwlrxpwpzhsvbfzvtvhwycfznmaomafsyvyrqpizteuoxgthfxsmxjrwpsursgwthhilgdhzfzaxadtklhyhqzfdimsrueecxkqkrudlmzgdtnhmivnnkclgarygydqdhltrsthidzyqazfnovktqcotchcolineiytymrjscyoeivdyhphljzhezohmiurcpblvwaajiqugtaoqmemjlhgo\nprurtymkktdbnoxwttgeeqimlhcztctyphmeqdsuyvkkjoplmzdcakpjvozimhxxqhduiqedlngwgoooupnedksdgpmhhdaqbsqrfpdrsykhbutsnuwjppgdeebjgsdyfoecqqnlemkimipecehlbtmbwnkdxymeclsshvkmywjxeshoihmlgvxiljvwllfpnjzywcpamevwtygfphifubttnwnphdbytwodclrjprseqwrdwsvyncgfrazzaodggxwwbtjqujrmcdpomjryledhufhwkhzktnkytgjpmmgvxjcnjgzuhwqqsldzcsfojswrqcnbqyxaagibpvtxdonpeashnrohuvogldxhsprngsoqdjfqtexyrwizzoeowaqezdlmwafcozvqci\nwgkekfgrcyvzsahpszobrixwxkpiclqljtkvnbimpdkyebcwlfkffrlzzmkvmhnlcivwhwztzrbxjcrtuvtxfkidxhoafyesyvizvozsqorqmqlesixrnerzoowrvwpmibhhyffuvkoukdwjcvxqglschjagquehpnhkycpmjtgludhrbefjjfytkxlbnvmdwsyxhgsczhyjgdfgnwfpdtlkhpekhjncylcqmssyghwdvaeqjkzmhiydlxdjohnscghbtuswzumsqoykiidfwfxyaaaymoivfhjlrwyaxawgeurbrnberazsxtkaquehjfcewctbfjtpqdljhehjobmarguqwsokldzscsfacxfzxfjqoverscjzbkmzdndosiyhtyavoxhtapyektuatprwskxzcznfdiuehuwymtxdrnklsmduskvutkfiubzyblwmparmjdspxywxerftzlkorie\nsupcpxcjwkuveerenlaitvycicyzalwuiuzteyctmuifefygaiaioiiedbywrgrtdxvdkocsaehfcilqjoevajnjttknrsprtkrlkjapymuzrphzlcepaytfaveopszrnkvnehrjstzflvyahorktkmgycouiertlpbjcsxqlgyglmvlyqxixipvwoqlnkaeqmarvxumkrnjcokvfktqjdcugbidvbxrnsaqwxtbftqsnpavytodpjdpvyqxksuvzwztjrwovttlnkznqdqiauapwkczxrxopeneuxflgbdwjmhjguzpeuddfeimozyfrqmfozissccrifwqbhxyehktusdgzxlaeykexqgqoevjtframuqgbdnrsmbxrvbtfglowffctujtzq\nzggtlbhropkwkbbwvnakwvvdycxczozqiworvpwkoqmqhcalyzvqnkcxekjqzvueswqknzpyvysdkhsoicmhczohefnaslxwxllxlewtzuwbsuvseneiqwhnezojkxhoryesugdhtjckqjdfgnrdoizpyfmdlqlwqiodcwfygkivbujfinzyhcejcjojonhgustqjfnecolocmfhpzxtgfpmuscrldurennlqkwhhyipqzevbyktbvtpwvttgecajylqvuizfsoayxziljzegblcatmvefqrzxwktndpbbzdrwlphlgdywdofnzxqlxvkhdjyalhvvpaangodnlxhlsxshhtifxickobixbbduzvngqiaggcxfgrjmarwupaybnqgudbewkgwgtocblxjeccgqhbczibhqufqqxvllvmtzhfmbezplhqakbmmvafqyxjyexdsswbjiouymhlzcltjud\nbfuoiwubgeidpmvkhozhkducomlgltlveinncaiknsugjqccasdxdazcrtvllkfvtezazzcsctlegenlltvkzdqowgoljpdsyqncsdjsdcxxyrghrwpqinxmridxpdpqunvkwxrykxtlxyppfmajfhqyudwtigbjtmqmdltcqzgcaiwswfyry\ncwwiaruhiibujopgrqnpiugkdqtesojacqhnwdagnvxesfrfiefaabradqeelkpkecvpsdwelpdjmmbpdupzvtvjxydkdncugghonucwegvfjzbdwkbevkgdwubtjvtoqothggtdrdolgjmfubzzpnhjaqwotzqblhmrfzfgykzmucwwpdyjvctvfamcgltmjtmrcjivhsytnwmqqjvmohfyesqxdvrjgfvgymhlwdxlozmcqmvhtcexameykvixdaqvssdwwoedklqenafbcfnhwrhdkjcsxohdvrbnlblseendubkxaortejlrcmcvovrsqrcopnnpkunkkcpoenvpkvygunpaboujvirelehlgectnazvqpsouubcpyfikgqtufvqqevcpcjpmj\npuacsiasptskqyhitauzfablpqlkukahmlivzaprotlqdiuoeeykiqzahfavzzrfrzzemi\nzvobxuojorawurhjoppnnctehrulpgkozuywmobcdlbofbjejazsrulvqtammemhqpyiowmnlqaefzsiotpxjwocjeumcjdqszrrrugimnjbjalqlrcezjfxchwddxonzmnjvlrjxrxwkduooercteeqdvdlrwamnky\njsxpfdlzehbgkvypxfsmqhib\ngjtgrkpferayxdznpgksdfpdjobicqfqmfstqhpfmcpmfdcdccmodlqjqgwjofnuqnpmhdvkze\nnligkjfswcxwcujwhepdbsgtffkbykeuhnfzngkpmvqthejjrbzhrcggoewvrxbwyszblqgpwjpltjfrqcocqxyluttlwhtzasnqeoyjbxkiqmajagfhzzfb\nvfuyurlvurnwramcadunwugtueshxmgzvsrmcifbvrasucuvivowlzivliiczpusswafkenwemocimlmslebfiiargfmuabizmyqpthdmzeiegqcjtsjhqkmvwzedalkjdvmzgrxokchgoalguqcnqyrokqmjszjwsdgcofglcqgdndbypqqidclzxsqbjwiploxderklgbxgognwyunrnumfolbalezroknkjnwrwebgelzbgiqdscwtsbxxzkghskgexlevgxnydqvtyjsllqkehtliauyiccqdmfiejrqnrnazcrfhpbjmrfbyqmhdabalhtigpqmwfonteprchddweqdohspjdgvlzmjbmweoilejrpksbxeestgpsmnmalpuswibubaqvotcaytbtuzdtwsysjrvrwgixzhxwhiuhvqtkjpqzyyhhtxmjfmqlfwzjfqvbenlerlkyawolvbtyzgewxc\nhswmwghbbancuejvmwgsffvowdlryinxfiwfhtldytygqkxrwdvrkcoytxkcweagydmhrpyquimwrbvezzvvjpgihcyfqzvadtdfyemfqvynbdlrqhvapgysggxdorkvmvqexpjfgvpifyidttggsdyjbvolbmcgbrrvkuptanlzosctfnyszklrnzrkuxyjpwwminhplxgxwulgxhlmsbzrquajuaxpdpsmwiwxxdvipouxtlkqwwowrqeatqbmmilpoxb\npwweghtfiqjqkbnjhxdkunebqgrizkekgerqqlyyfesoykmvayqbnkstmdefrmtwkylnonchigmtfbourzhmfffsrcbdzdfbeostfvskrebtljhzkrghtsgbbdhlsicutfmmjoutfvexdczschytbcrkliwcxkgoqvufyogvfrnymopfwpnfuzeihxyxansprggwdyafawqgqbtdgffcegtpcybqvrqusqsydymvpeibgxffnopfymrmqhucgomdiuxemxbzyslvlitwubnspbmewwhgpmprkcyfdxkmtuhevoixrwlmxwgcnoyzmmyovrtepqtibdvthmpoaqyddqrxnvkiyadvloyemcycfcpyuwkzebcjaedsbvqqijqlgjycjpkpxflceoniyvqvurdiaqmsrtfgwtpepunugeajdgzsjewsqrmjzssbxjvotjvjqcfqptbzgketqkittrhyubkewfe\nrcihhxjeigutwigdbbdxrbwmbrmbvgaowlvdjyddyctcockmgzvarpfobgmhpaojoiqpqtxtucrorysmgtxcfzlbjbipfimunezpqaqjasixvwoqyjvxkhcqpqiab\nbqqdofehhjtzyqktdmkapspbmykoylpnzoipzwdmkrbhdnt\nkvpdelorqcjkqzzpinoqluibjgnqqlfewioamgmrcemoaxvufyqypchhgfmizrcklyhbpjjzrrugofluioivovxmrawzswpfncnfytmcfvwnrmfzgpzpoltvnbmvwthjsvhbxsewqyckwexzpmiexgrjxjmdwbqyuipxarrbphnzwkbclgbvocyuzutzypirocyyucclqzcxtawhxkha\npukjrmgsxockdraauacxkpmrflspdlqkew\nqjftfwahgqohkqnkttiqfyrhdsgeueivkrnez\nmcirzfqxozfcuhcnscqkcjb\nhvrspzotkdbidwwygowwqhnzfjqhfgimwjgrjvqspooslaqkxzehzegkwutiypzvvztdurgodxvaahguigpsglhabnqbwtqmbdsmbfzthyumquowldnovucoimmqszmsrzqpmaddcvhinjjdfywrwsdagmvyqhtqwfyiaistvhbzvroovjftegskjrjynglsshitxzgfwawlyzgkxyspekdarmeqdkxjflkjwnwwfzinwtxscjbpawnhbskilhsdudslmcrfipqqbpbfgcqyxejhgahxwjmsk\naplcjjltqtrozamuinystpklzlivfhvsjtkzmnkabbaleiztjpzhztqhvnsjbjulu\njtyynqgpysvalzdfedgaufchgkgxapvwbnuhymeahscsnsiimbmtjstpvrjufsikdvwyrizublbbgwadbfzrwmohscfwygavzjaoxrdilpomoisjjswfdyynvlqrmhjcszfrzpsfcctayvficqbebazkleewjynezrxdmfqywohwhrgvtzcdvsfdvhpvsnlcwnndaefgenzglnxhomksignqhqgxatpxwldsxufannebavspetvuczjmutkxzybniehuesblhlpxnpoymjeebhdjhtjqfjkhawwtkguwtzefpxpbdrxfutvbuufjvgzpdfscrzswpqdbdzvnjdakgvqxhgkasgyrkpczgbhhevookfpdeqkohktevfnorjbezawpyzaudwuxqldjwjriqaqsjrqjgoa\niusxharyevoznqgqbteqmppciidgzfvgqvzeemwwazstqocwvntdnaqybcfrmnzrslrdexupsxuhacpttdyfaqwcgpwvnkrvkcofdgbbgpdoxjuuyyckitfdrclzmshghtlfspjhcgfasdvwjgplbqzjbbllfhnhecbjsntzzioxauwzkjzhzdfwdsvwyxghqilwncnkijcapbyquxvejecizvviztcbdoqjhveigvekkfkzncnkyvoguwpiiktajdjntsgiecrpwinbumvktizkxnrsdkqbvapludlbegdrhptkwpigfrcdmgzjeibterrwdlceczotviwlpfibyanraahoawomxzorzgvktiazlzynkmwbcrujpdzqsgqlaomtkvbhgfseiexvjvwwkasymwiammkempnjqcaelfyyvpymrgujzatfsnhtniwlwsdfwyijfzshtepejvtznhvpfhaticqjesfyhnid\nhvmuggazmnupbpkmszdbnofajljbroertesefxnippewoxvkzdnrluzlwfhlmwumclzystoxjrsoqfwluehqfrncfkpysqlhlanroccwzlikumoyyokhaokilpeemnqygsfjnyuctkfzbltinmzbkjylqwjiamfkofjjjjrjuuurrychyivifyaxlhwabbswjdysejwswzslxvyilclpgqlakdknfaoyzqrqivmedburfwkbkrdxwpwefaucltzwsxzimwdlhfecvifljzusprolqknjxfmzmhbzfpqicsbrlprbirdvslyhrsehxzuenmsdpakeearmhlffbpnshtjsbiavexuurspattalnfbqzronmfdwgpbepeuhgbjbvnaxrh\nvuwptsbzakokkpatutbdjevvjjoqrbmaqvjqkqwhapahwextjgxwtcklkdaoxfqkaycroesdtdlzthujqupnrrkaklcxgdcgtfoxkpjmrcixnsdoljzxhppxllzwwsmztolxglqtlmcjvrqlohvzxwaipjwivmnvqjbzkqfjjhwecxfcoeskfkadchwqsqtxmuncwiregvulrwlzwhifhdnqubwbwtcyxwujmjqhbjmjyfvtbmvwhqzjqrfbfdxd\ngmfkwmlplkprltgxgibtafvdirjmsszgabdvxilmgqaqlxfimfdzxxaywmvykpwxlzionemyrd\nvowpgwmooqrlntgrrtzhzlolmcgvruncmawflyqrtbbohdymiggavytlbrrbblygyehe\nihvfewlicdpqromvutbxujqyyokcjgbecatmjdvmajkpvunlgcbnwwvmlqtzzrbuoiwqqypfiiyzurocacwepxejxxfvjeglkctgavrygkjnhzqnxnttihvniogbjmvivggjzqxvdkgqyygmjuxmvgrrpsmnruiclcipomcsijvjvdfevwrhjmrcsurucsdskgxbotwuxhbxvsvandsewrnfwnszwgdugnuqfbkooqpowb\nufjlhobdwxadysonqdgbnpzlerqooveibtuakbmuzaqviouhhdenowzyxezbqzqpgnhobduwbzbdftzrainjruucocigrajyfaazgaigrnbcqjcwyveflclgteosbnbfvutghcjekknlsctwpopabjpliwzkbndgpzbbxomkcjdzlquodwmuwtidgdphkvexbsztrintjappsxgtykuqatmjcrvbsamzlvztawfovjkfeoxkykdaobdcdszgcovkqsnhgcgbaiosrkherchtqdnlywpyviqrfrgemkogqvqehdrcvrkmapqvdburjahmttyqqqaygtwrxunnugtkyfgvsmskscinmqjlgccfnfkgphxbab\nglouyqprlrnqwtoteigeokdfwfqcbylqkbyxvofglfmjxbmthzbooxobhxrbnb\nwhgehlcdimxufhcgeqfvdmjyjnoaqtcyrbzzcyrjbusmddvcmjoekrlzvngdhsftczzzlhojlcektmecjjtanfdjjbazsvopqheouddjethwmgwmvgpxutvccepmnoqsgylgjndlbhajwgvohtwrvfymybqnxzgsfrrjdexwkksbdnmetglmnkluvnxdblzdkysmyzvlvnxkiycztmivaacevfuabuxwymxiwtawlckmpathuaorsgapjklmfbizmvbxyuvgmgcbutuczjugofgwkleouxcatyewursbvobdgiqqimilvpwty\nnbsdbzxdmbpvbdqxqkrfqndqzsbxrcbwfbrwdqerimxfbwpanfhdwhpqafipcfhvthcrqrxrpfkctijgdkpqskwwoiripgxyorhticwgsotniggivzaljkqlxosqzmynmhemhwppvnwnwwhuzcqx\nkhgfdjgbpoohrmtaxrykrzqxfctchjpxcqwnwcfznzrgdkkoleejqdfpgfwvacgtxyqqiqqydfdcvofmafzdntosdjkidroloivodqisbzimryrkecdqzlyemsssqmivpbywesonnvultkjjzthqilbntcvczvjkuetxcknhxrfzqsxpppsewxwnueqovzyhqfjxqmzvkwmogpfocenywxgeacxrw\npiiqkxrpvrcfsnusuwecjjlcxpmqflauccefeehuqtjqwzphiwosewptcdqtmfxobkhxgkzhtiqtxgiosgeeqdbczpddbattyuvidxjodxvippweskzawjzfjhhfscdromehncpbpmivezzhklqxaplwumkpmycknbuzggfkoqrezgctqiqofqfqtssfwuqbysrtfwpoyqediumvefmnsgxczrduunaqxkfxinhsouikqwhzbukaupzujroolaulkabporpsdtypavkhvwnvemhmczbadvopemtlpshwwuyqhqvaxxeqwuouoxvyppkqacgbplsnpxjgsqkdppxzzyorylrspvyoenvpxnuhkczyfdummmzyrmytkyxfodmssqgfwmuqdswilnjnirudogvsalzlrvoqldtdyjthyuiskvcytzywlwbzpgvunxnvpjantjjawjbxpuhbqwuxd\nkfsuvrtgjtpphcswiilcjtmafrrourowzsysgcrwtswnnbntrfmbnwgscjxxfpmtboyuprarcjp\ncdplftiqrzmnuvesxxksegksefxmuopwrkve\nzeycqwxllnnbfnonushmvdmplykyisjhhvszhjpfswwbolzummwrhylyjlbuwxywxyqsjbc\nqnsbujwverqnvizakozdkscfykpvylkufcejdbnijjycjnppsavnseaeyrqqnbucwxglpxxruuqetpxoebjnrzodfafpcsxaxluopbzetsucqzzffskdokroszvjztrqgtlzapbvospelnnqxargfxvuqjoyrveuqnnameexbaebcisvmmhzttldfuroujregceyragqqbrsdanmnhigbxyglmfvgl\nolymflmknanrzpzuvejiewsbekbuzewnoszajzxxnevpuikxfvftcypgzyifwjenzsbdoybvqaurpweusehrpm\nzbxbrqoaaxwklouwfmszmgerszchaoeebcvyatgajtntrujkuixzvwrtzlnqpzaghsbjwzcfgasmuohhohsdyuyzpylvprnfeqmtltfaegziehowkjscuevznwrcnuhkmqlfybghl\nwmeihvphbaozasehczxmiemcaqpoilyodkmntfzpnyefbpupsfanjahrjpshxupmtefoymgpguoukjvdpuihijdttcouhptxjqsxoorduujidxymedewdmmadbrrmyzufwbecgfvlxetwaxidibgvhrguzmdfmpvtpbdohvlzmiovriwkbhbybvebyerlkqqbasqgxnvfhbxyetaerlhhfhetdlvcdzfkpfkhwgrkibxgwlohblnqcvovtgiyytklphnphbwyostmwhsjrqprxntmlqylkmnjgcrbioyhdobnxpwdbpbhlnnpegb\noiivalofwwtgajhrgpfdgqburvyykujnugjafdutwplpefbrkrzeeutlfbcvc\nwwdztvhzzaxwuyaqbrszrcyawwsxhgejmmunolbvbicioeheoxmiwvpilvovgslwopg\nvtvvpdudlfmumsdngistgjojubpmgymwjlcobgwxwtchyobsjnchogoarhvxtatcjfpngsenbvdayhdbdecjjitpilypiuuewrgobyxjklulffpdcipypmcrjkgireznuqrqcibnbkegxhallbbeempawcxuqglfkxwyxualayyiucjvgvvkysxgbnmngyjvvwtabktybjrkxmcwafullluoycnhofisjnnnxwnuukkhgvwllyjpvhmnzdheyspkjsfidtkoxzecwnvdiupsfzkixevkjgvrbqvjqzyh\nguhjjguxhzyplwiirestldulakyqquqgqccslrcgsqhvdehnjljkwomipksjeqxfwhilzboyforvespphluejhkgotyzudunghuuelfxmgezqdngrtnpkggiwpzyoklmaekfxpqqxmyntpiotqcvgysuyouseysaqnrywnttrydluzyfhukihcyhdzjjdyvtoxlateobsbrymvtnguiwrjmhuyshkrcxjabnlkdikayvrkaljfkwowycneovtchrkvgeewqieboshtvfekxqhsqcueohwpudvukjavfepisiifkknaknhuifjuuzsfcfmasbbsmthyhloxnwueeosiuupszlxkyfrllomgvpsnevmidmrpbhepwgdmezxcdptwokiioxhopmtrbqbpdiqhohvetjedbjpahgztezsbcvlgnefhpwiwuinnfvplgxtuqwpmyqxcaciic\nprelazhpxaxuhtnlxbylunbgjaggzyrfxdtubzqcqvhsikbrvvulnnlpyqkxuverkqalnyvzzfvzyfyuazwrioqvqwlytewacbadomhgnkqglaviujfvzmjrcuivduhqtezgbazrfwfheitdnruzvllhynrmogezevkmcwpngfjsacijichtxrprxznxiosbrbwdjdoknxftxzlmmvvntdzqfpviyrxgncvodqmxfvhzvizopv\nwxetiukpszrswajghzogrnntiggchnjhasntxprodmsenwopfrevcfwmzzwnczfkeyqjtwnrpsfnwepphzlzexpzakcrfjzayvipibpazivnrqorxekvoxieyvlgaziabpmvynehjfkdgclnyyvmtahgolomirqjjzjhzikppsyurtdinrlqvtlcmwmsfg\npgminkiwhnqodmlbnzpcgvunqmrydtlzdviacdsnminqpbcpebxugblhdfsjwurjtangfufuoebheeteuddizxytmzdykljyqgdednhiavqbqdfqwepncxcyzhponwerxlrpsomafcjykbkpwuxrpraiovcwtmvgtgcmgrkhrpfdhuqggflonbtgokdmhpziynvcikdvvuotxjrahjyjvrmzooqdagjcsexmpjtlvfmuxjjxcknixfeipbnysedyhhhrycqxeyxkoyxagwnilygiyjhisedolmiebwapqvscuiktgvyzhmbphpcolpkkuczvejlgembmiaqeitgdhqy\nyjonfhswfpnvtfzbvcalbcvasbikjtnnaciwpvfphqocgijfxdoatzyjzjeyfoyeudxzdpm\nfhkknqez\ntiorttfskwifwpwaafxmmqjhfmimakbssuondsadnftndfstbwdfwtbbaulffdbncumajcvpxvpocbvsuyegomjw\nocavmfyhhvnngozvjldkjchtzxqmqohynqaftunhjfklbkxnjjtnpdplwhgtujrcffovyffkmzcdobkmhxuqvubpyjmniexrwvtrevhhwnxswkbduuflaolttugfhrjtdopvzdzceeksiiwsqzimllwgttaphnrvntgnrjqmvlwobuvghcwsrgcuikqkeewfwgldppvytnevabzlqsevruablogglphjmprvrqoomzilxzzrkpomqarjsoevutqgliryaawguvogcdogjfvrlvhqhrmbftgvxsxeuoijsqxnfvsnjpxhhpruwyeopyvcjlnehhqgyxqxlwoikczgbzzcznkfwnwggybzmcfbsrckyobyevssdvmqllmeizqfqhxjxmibldfpccjymxofnxzpvqgyuahubzrcscbwieuiorfkfoyfdcimgzjzmlonupvfovcurtsffozglohnerehweccpto\npsfhffobcvtqriwuwkrktpiwpmshrxsfwrbuvdunvdxvytfokqqkgpkmssvqkumpodgnzgpshthmluwmgbpkrbzctxludvycrpzmapivxewbcipanscegliuuqvbujriyvfdkxdwkpvwnuhtrwvesqrtwlsiffkapackjhcifxcruvszyycugwjfzpapveziwlijvysyilpjiyiyqcqmxcycykwjrohfurkooekibwayegbombbmmznejpnulelofvjaqmioehdywiazcbehqyphwijshdrwrwcdtgzmhmspilmbqtozusgf\nidxtseolrxgdowmryrtqhfonlkzhflaxwolxcvmjj\ncsvlbrfqhddnymuyueowdpeqlaiejnntnmogteqpemeiqfxkgjtoepfovtbmxolapgqwrsnpihlkgoyuxiuwulrhqydptecbsfqdjjpxkihlojkoovimihzjmtxozuxlybgxyupqublbcsncofmnimzcaoimeaxrqecckytskuakgfgxldtisbctkgnth\nzyhrcxouexiuqeuyrcudqhyyzrompymdzubgvqiaegsysjkzlmbrlpyznloslrqhmmjvrwjslmoaqvnotvmvaxdylcbkwhplufnpuezogajukqhharjowrpxlwpoqtobq\npaofdmtxhvbbvxnngdhkksqntbokvducnmenpqkxdlkdpxwwlduvytmamfewfyhnzqmmqubuccxnqxsfsfecfjgcekvflcczwaxsthprcxkxynjdpekjvbojdjldezawsdzvbuibjwqhogacfprvcczihllgrskbadnnxnpqbglcsgdkqjthgeyygoosyzyhtqgvdyeiajqjjfxgxzxxvafzpeiewazlnhjkkccwtfnvbcxfdfzokonebcwlrqhxoqjpabyogpkmtdlvxrvljsupqiuefburedxuzrnsyvqwvwndwjodyxpbrwtvpmxcvdgsnneannqrnqyqisvclpohqodestjfukejgjefscozvnuiexpiisatfnpixojbtsiyaxyyjueyhsglfipipycgwfasxwkqnahsjcohxnvsvfxslpftyqvpdgnvcrmtwrmftodjaqbrfiaavyfmibcodwbt\natjndyuzigdljpjkogmzewlzvvzizetanviuymptictwdupivshvkahcixujsheyavyrsplmksqgblopltfgjizziisdaiqnydmdnplfhbefmrbblqwcwtllkorcopyiltfklzjotyozimgysnbmgkrhxgluyryej\njjovcnhlvmkrbkprjyosspxzapyrmerqrosmtjhbnmnyrfabyfnfncywxzhjnmfmaevmefbabflizedkdzmsdoygkjjdxvtouhhxgtmsilkzfzwdbqrnehhbpqkqexowyrvhlsuqspzggzvjseyikikzoqhzyuzzvdshkgrzvjamjplhzxbuxxwluelaukoatgonwvwlmvpdmjwnnuzspqrpiyqwrttsnmdzndhwgprgozkqwybnajfgrcvtmbygsagxeyedgrxtmpbjbtduesrrfontvollcgnwmoyedhovgnobrgtldcrdeuhcsumykhyyhhbyjbqw\nwenkrxabrfzzrnpuxztavyppukvgdfbwmngmkgazekpvvwgaczvjpdnaxbpzurprcjvsptbkjmcnvasajvpwwtzuysrxawdpwmdzwpalzsypydtxweoxgnlxroqmthqgdexurdawqolnoisgxgfjizqjixivxkflpknhpwqvaukzhjolovdosqekhkttaxntzzitqrdxrjyhdwixbihlfymukhoiqkwqdtfjzlpvyzrfqklpksqrrfpviandfshtsazjrrhehsresfczwazwokcdcibnybnwydhisljsxtvxnzkcpqktytmmcprccltssikmutrtrcgdyltqdssxxasfprorxfuamljmgxsdhlyyjfquiimkvgjtnejkyopocvgufilapzknymvxychpanhlmlkwhutlyyexlfdsffuerusdbnefnztrqpsoexsuexhgryfdpxcwavlxtodownixgwraxqbrlcxhvdttktmgnoujscpv\nwlwagexbhbzkdfnzslyvraqyzkiyiawcmdrlubzmklldfitzuyhgftrmomxuszatfxkpafhzdvxvooevucbwlnztkvzcgkmijoohmzicndfudzgrvofnxjboojiegewbacgbpaloptookenlazjttykwipemfslyoqyrltmvphlzvrwfacnajswrqqjyibdltqvsoivx\nybxbrwwgqaclxcxgttqzsrxttatfwbfnmhccfhstxntohvfqvgcevgyefjknqfywmrjuqegwqjaputsjnbzmxyosjteqxwevvtshbqdvvwfidjsmwtbvyazuwrfuakcywewyxjkmdurdyiglaxqxinvzgrrriuqjolwmbwoxqntzqmocqtkmibhpwzabilywkeytdmbdrjpmrvqlbxztvlukamyldzgddiujstqlvuvkzyidsapbxygnxbvmqmgb\neoickybowqxrwwbshemcisgxrjwdrenvqotvqlddpdommatyloejqyxpewdfhqrztxvwvibmnwcimspxaxtzgyqwgydpjkxsbtoefhcajwphfpzhdcmsymgkdwfazvueroafhepdgxreyvmrhlpfeuucumuzxfalmjjhoibqhzgvbjanycwbhwyudskhztzzgqulftvqyujbhazwbbqhdgofwyrxvewjybbrkkskbixngyuiisyqchwpqshlbwhxhgosbzzflvcetxcqthiqbzntbkbobnflhmekcjvdpfittsfvdeyptzqsouxqzuopabmjhmttkkrhsqfvewfqsadrkflmzocegfybaevpyfyzinxbohxxbewvrrcqgfwxqnaedhtcfuxrcwrdjpedjxrvaurypegtijqbwxlobpeyjldakqihaofg\nwoyxlmnarjdnxauysysisdekesobkgoalrlqsrrfdcfuwjfwfllirmetrvjffgkstvjkfjzifydlimlbcikxuqhsdhzkuurcqqukqeudywkqejhrbtmdhnoyqsxevpmzwainltqupqtomolcbwlhobszmwhmclekitsiragugqbqcogfiyfswwxyaggnfegvqygtqkzgevdtsdmzmttjbzwrcwlgomnbpggjhjibputjc\nerrabysbxjsalojjynozklznsibbiswpzhttudsvynieztyhlbdhlpwvlhusuzdyytomlsldyheqctuyreialugdacgklbrwwmeklxvdiqirhpdoazkdzqfwvaxvekxzhtrrjyvwvriirmdjiifchlbufwodmtiqipdfukecyqnegmgbiuyzgotvihfdynmdrrxbbmyrfdzlvootrevtpjvonlxxfavgxbpaenmmutsnutdanazrrkxvdybdjnylebererqrmkawxrrepwmzhdcaqcniizkjlmpqgzuxnqxzflphnzktgnauabjutgvrzrbhfpkoslpnpiameodatjtuifjuilcfgaboqicm\nkiyfuutgg\nmcfjxqevwcirnnzdzmzqejvyaivysiothwipfjegeeckpsrcpciwkvthbwgexhunrmpnckpkjtgjugwhwngwvrbwaqsotnwyprytgosdfawssvgoionddtebsikihelhwgqsnwodezxbvgbwhjkfuwqqrbzwxfmiianwupmelfewyaapmdiy\njpxfszrlyphhqaheeuoduvjsssjtdxeqfiikecjtydotairyqwzqvchfxvvi\n",
"100\nhqghumeaylnlfdxfircvscxggbwkfnqduxwfnfozvs\ntkjprepggxrpnrvystmwcysyycqpevikeffmznimkkasvwsrenzkycxfxtlsgypsfadpooefxzbcoejuvpvaboygpoeylfpbnpljvrvipyamyehwqnqrqpmxujjloovaowuxwhmsncbxcoksfzkvatxdknlyjyhfixjswnkkufnuxxzrzbmnmgqooketlyhnkoaugzqrcddiuteiojwayyzpvscmpsajlfvgubfaaovlzylntrkdcpwsrtesjwhdizcobzcnfwlqijtvdwvxhrcbldvgylwgbusbmborxtlhcsmpxohgmgnkeufdxotogbgxpeyanfetcu\nepzshkljugggekjdqzjenpevqgxiepjsrdzjazujllchhbfqmkimwzobiwybxduunfsksrsrtekmqdcyzjeeuhmsrqcozijipfioneeddpszrnavymmtatbdzqsoemuvnpppsuacbazuxmhecthlegrpunkdmbppweqtgjopa\nmowzdqyoxytjbbhawdydcprjbxphoohpkwqyuhrqzhnbnfuvqnqqlrzjpxiogvliexdzuzosrkrusvojbrzmwzpowkjilefraamdigpnpuuhgxpqnjwjmwaxxmnsnhhlqqrzudltfzotcjtnzxuglsdsmzcnockvfajfrmxothowkbjzwucwljfrimpmyhchzriwkbarxbgfcbceyhjugixwtbvtrehbbcpxifbxvfbcgkcfqckcotzgkubmjrmbsztsshfroefwsjrxjhguzyupzwweiqurpixiqflduuveoowqcudhnefnjhaimuczfskuiduburiswtbrecuykabfcvkdzeztoidukuhjzefczzzbfkqdpqzikfobucdhthxdjgkjelrlpaxamceroswitdptpcclifkeljytihrcqaybnefxnxvgzedyyhngycdrudmphmeckotrwospofghfozqvlqfxwwkmfxdyygmdcaszsgovsodkjghcwmbmxrmhuyfyqgajqkcklznayxqkqoyzwmyubzazcpkhktkydzivcuypurfmbisgekyrgzvxdhpoamvafyrarxsvkhtqdihersigbhzjzujxmmyspnaraewkegjccvhhrjvbjtsqdjootgpknfpfycgfieowqrwwwpzsqmetogepspxnvjiupalyynmkmnuvklhsecdwracgfmzkgipdfodkjmjqwiqpuoqhimvfvuzwyvijgfullkjduhsjafbtlkmfqrmyjfjnhhssqctydteamdcjbprhtnegyiwxgcjwlgrsmeaearwtvjsjbaoiojlwhyp\nvruihoswkifygtydhacwyhsgewzmtgonzltjhgauhnihreqgjfwkjsmtpjhaefqzaauldrchjccdyrfvvrivuyeegfivdrcygurqdredakubnfguproqylobcwqxkzmausjgmhcmhgdnmphnqkamhurktrffaclvgrzkkldacllteojomonxrqyjzginrnnzwacxxaedrwudxzrfusewjtboxvynfhkstcenaumnddxfdmvzcautdcckxaaydzsxttobbgqngvvpjgojoglmkxgbfcpypckqchbddzwrxbzmqrlxvobtwhxginfgfrcclmznmjugwwbsqfcihubsjollmsqsghmcphelsotflbgsfnpcuzsrupchynvzhcpqugriwniqxdfjpwpxfblkpnpeelfjmtkuqpzomwnlmbupmktlptndmpdsydsgvfpenemwborifsuqhceskmkhssmvnonwafxwhgbibabvqopqfoviussqfqwehtxdzujtlntxmrjxxwtlggkytbiolydnilqadojskkvfxahhjmbocljarintdwcldvdxropbyjzwyyojuothwmlvrglfzdzdbtubxuoffvncrswsaznmoijoivvgobqpnckwvnhkebmtdhvygkjisuxhatmuudqbhmknhfxaxqxkjlzzqtsjfaeedfuujkolxjoqkdvfepvlhvhrwtfdukxffjpsswyxlijjhevryxozbafpfmowgrgonuatdqlahyggyljddjhmltedzlodsrkeutgtnkntarjkpxinovgzdthunwooxvjjmpsvknhkwjopmmlebksucvzqlyqnwcmbvbhrmlowpjbwyvwtgtoqnmicxapzarknnxtuufarzrosdqwsmtcjghecqudosrtjxyaaykqrxycrxuwjxnpqjnbkcpdmokalxapemvbqlzsvxzkutappwgzpdpyzkzcvbntcvfxsxpjaoxtfhvxxytgokrcxaetauqgndmphwzyiayabjrqgeppxyjsttyzuvldvybsuxkbmfzvrtnovidznpghozvafmsnsnqivmvubcwtfsrqtmknepbhowejazhkwcmmtpixxxlzqysxtwwtaidyaxyqleprxibexxyfvsddygthcuyyfwpjsfybglgzmbintattnhodtonpyzwotkgnguphpkxeatowzabsdnvqhkfcmofisfrfqgvpmvorpjfzslzmpjjnehrykxjzubuacclfkcyzobghtuoxrajvprecwgxxpswcgmmvedewdmfnqwcuqdsciliqecihluilgmfcswtwkkxlcbhqkvcswjebkrjlpgfgratzbsguvzifnhyxwjsjavwauxpannamxjdvzuhnaczyhepwzolhuslrkvwpnvgzmiizwudwdfzlktbqd\ngyyiudsjvezkmesbjlkyertahnexhuqmjicbmusqdklaso\nwjxptxxeumzfwyucpabqseffunqpkfnnbecbbcjpdyjlibitllplxelrdkexdtquvptteyhtlqlbbbvoqozkynayyrbaqmyjhzxndsiyfsexwbioewqvqrtcdlpqmvjifvgymkgotzjmnzqtmrpndevnmthjitsspaqnjrdoyjwpyatmleyqsvkpamsvbmvxrllivfedkjigavyxjveqvrbacuigaipyhbbxipbzncwhrblirizxoqptqqweaafjeqiozpyfauuqmvhxkmnxmsyamptlzanotlslwuhtfqjrrwbwhmqhzkhdkcrfvbeiyipvfvpzhyujabtqwwtbkdogkemhibyxrnxsxrzletbqexkrqoiernaplqyjpqoubvjsebalwnksvloidzfpirwycztwzzvewxotakudkpedupkczlhwuskdnevdcplbklpjmpfdcyqtrcvvvtrffvpekkqmcupryjauteuvczvicthrxsxclprgdlwxfaigayrueicufdiamhtkbxotdirxxgvzqmeyrovfichqnivfjzauqfdftgmopsrgpugxtuhlcvspihazrssfszwxbqmurwmxcdbhumrgjqmvnkyrtnsjvwzxssqxnjomuyjnjuwrsyxwqyyxcszpoklwjdrltbsciedpiwlaqigesjsqhsjlrglmwanrxrfnwakztgjhxaunfqjvxiohnjqrjshymdovwgefhjesvhtiziojljdpmoxbyuyopqjkztvjgkwxkewpzhbjsuthsyoefjgwwyeozluhmgabbsqrhcrtxmjvcaxxsufahyyayzkhuhjrjsvoqhtydwpbszxsbziyrvgqmlunwscpirzfcbtseplkgwfkhrouoysrwmqojahyqmfevsdcomryhgdmlxukwyzcprskwgxulsuckbsepjeiszsgcezwapqrvlwigrovjcdzxxphqlsrzihmgzrioqrqetkzfbldjiemsfzbhzfnwywmxxgdpylraxglmtbiylbhcwhlsyoyhgmgopprzaxqmomsyhgagiupjqbzxthtopotmitnqwtoetonxwzghutifklgklrnuwkmsyqcpuivahqatmsckmaalkicsnxucovtykrxawzadjxwxqmndhldttxsknxteznjsqtfbccfqmwhbvssiigvijsuxiicaahmkwywttjzppkwlbmjahtputiebpbbmuegyrhlthxwgjprwvhshzyavqyecztozoabnanhrrbddndodxeuiozioiuozxqtihwauroqrdqwcvlxzipodiispqnzomcwvaptgrgdfnyytkwwqqtmiuuyvgaihfshccxhuuyyhtgdglfciebdutoeunfhdaxphbsywztpwjngjncpxrjvbvccefkbemgsdymzmmkwdehfkruqbyvecmpesromdxllubryyeshqlzmrewqnkqitxgiigquskwtcznlterxbltzydyzvahnkixjwzztdjpqsuowkvfccockvrjbfrjpcgdjdrwdnpos\njgdrqrvqtvppazhltjqvcclpeztsjpynzfrotqpoxmwhhwewnvcbvdkuzififrtwqqeojueqbnskwzeewzkaojursqgsczvhhujzumigofhwbkkfluwzkctkagxksmfauwinsjlsojtrxhwmhlvbypecjeiwwstneuiqubpgugwgnmikdwickdilsnpdqsvmterdfblhwbafbgarcsfijylbiimofgxeirpbtywqzapkkcafcomvntmdhzxlefppyebeoeqznbhycwmfyaqqiannyhqouizveavgzjwoblsgwnkvjlnivqcwvzxtcthynmuxqkwwmtfisgglgcoxpipytdbamrykbokmwgsddpqkrzyjchztmiepagwhroqkhwudbcihpqwaqzxugkvakvlavkswfzsdbvqidhtbcdeytmpphkuhsxorpufwhjrutksslhlrxlydxvkosaggmpbgzvbafazjohqsswtorckqaxsrehnrlyjiwtmhglkozfkmmxtyvoxhfkxopvybjzoxhzubdntoamzottcjtuegmpqkcdbbgckjqtebichznpprqiswbdhoyncsaetlgbfviocfwxwdrnlffbfhvyxzukjwocyhzqjzdhtbrrrllktchfnctpirnawonydwwvuabuqcimcnlhqodemakmunmaxiomkeywcofqbkdmzoizgqipzayixrydwsovhztkgzskwptkqcexrnnxskywndqizlzklnissamqazhlndnviltkoiafmeicgguzxhrdjzzheruswavnvslonoasrudrnldkldkfztagienatjzwxclkkulncaqptoneqlnbtoddbmivazxzmcojdhiswkaxiagtutafrsvpphuraaaixztwdyruumqadjepvvcvoidwmtpbnmquiopiwpuwczdapdzghavviyirojnolsowrmvvjiqswricmzsxavdqamnfhwfgeohskkefutxxibhpulnlwxqwwzdgdjgeqwapbhlpudoemnntpouahgxjhzjbeplttriabwucrjmbvbozvmxobatkhqsqchlhtbofuikwafkcowuuntfhpkdeyhokquwqvwtthhhugjzmfeuinipbncizockaadalljreqtkhudblprzlsrwxoccslutwqzsqtijvcwnpflrlukdiaohqjhraglgriykldkdfrdrxjstcwrsxgywfnhcbkpmesupmtrvipfbktbwzfahoevnhxbrhhfobgywcvhktdoxqtekiwwurzblmldlfibdvemunnlxubykvvrgktrerptisizxhrevnxquezxkugroohrhudidgvhtjhyezkyhpfxwgprpseaccxkwvixvfhqfawkfdjpyeevdggatfiekixeyrfcpxscjkcfgqmyhjmjtimdspizhwzizcyuceglmmbgygfvtqvzqatxlgibyzzkiajxmbhmkqlwhqnghlvlzgppxooeoqxppbpmblxnkeofmniumjcafcuyvdcueterqpjjwaknkxtlzqfljnwkxgkfylnukbiysplkhjucfuwohzvphjbjyovdlnbfrkvbemwytfjynqmgzagbkwekkouxdcynkhtosfytlucentoilfuldvrxlonvkxzecxepkmzzgxluahmjyecsldjesdcpjikvpaudvkxgllisaambovjkdqrkdorjfnyghhhptzifawftzqgemnhpqyictmoyfpcvkcaodakjacqauzyowdzsfqhkplfbyzmnimdlxmjydaxyjnecxsjjbhiqnvocdenqmwilxxzoqfotpikpqudmomikppzhdhfq\ngbxiisyzwnhxyfvydfmpdwomciudcnyndgcnfjitppmymxiisnebpywsgqsxdjplwzfmjoopyyifvkmwwpgpljeawpvapihoxuuffbrwhpevcoqrgrqwzhibnorkhzmlbzfhxunrklibvpszznopfgaxzgfltlsxbtumilocltgcozgtziufuzimxeekwnysbicrfxdiogcseozpscrhjotyczcwmbaaolsvubpylonmwajgxzgyzaovenfvocikqjtxgvenksppwwplhxtgybvmajeyfaxegseijikcmduclaaioissisiyppnzdubptsaveszsippqmotjhkudnvqzbkatnefulgexktrmhddapswptfvovujiuwbmibructtmrvznjrchjwzwmozecrznjkfrvkrmrdwroaocqpktlmwxwtnuamqelrwbgbijilnhiiulltovbeflwlpbhyffhbavhfuahlindjdfpekxglixlaxxtolhglvwxkyvulcyjeflloqzhltmgtujdcuugnrotlotcpbnyfhejegcmfptqmveghmfbmvklsqfubvxctepvmljohzxxoolnvlayguokqdauptyvjafzzkqtaxjlrbrukkkigjmxqrbazlpdevpezpbwshvpckldqgivlqpirqvwqquyxpixqireuqamffsvvntguxesidrnwwtqkdozfpkduulifzdpohcgubkurehrqbbxajefbfhkzbpkapbszyspdaaoxraojotjufsturtjhudpetsgrzuigusnwlyrvfnkkmsdbuhvhfqtdvtnlewfquuhtainkebbvzhtqbkdbmvhbsnjbtvjtqnbchiwfuqlzsmxvfjtvquitivyhzpxcdjwikfatcanchxssjluhlyoebcgnsqfzxxwgliuejobcfpvnyrrpkegeqpvlhxeeocmerjmziudtsqqozvejnrtibvnjepfqdsmvstmmwwwqknnrmqmjccpaowazfeurgpbfryedqjrltmymhysoicwuohferebeacazuvjoxyipmsgufjiwlcfywxteyyqdhxwjhiudghyxyoxbsceftdrqelxfvcfbbjjyfsvkvsapdshakgdvhcfmceztgjcmhxlhasqkauqlnfhggtagrnffmnpinwlexrqxisbfnhjzqvoxkukylzcrupmibacpjzsnaclmnuqnbdifzlujqvnfjxxvkczfkzzjqnaqpohygjsjtakzrsosyqhquhkjcjyugtedogfurkxiy\nufotiajmwhyilthmoevlwlrxpwpzhsvbfzvtvhwycfznmaomafsyvyrqpizteuoxgthfxsmxjrwpsursgwthhilgdhzfzaxadtklhyhqzfdimsrueecxkqkrudlmzgdtnhmivnnkclgarygydqdhltrsthidzyqazfnovktqcotchcolineiytymrjscyoeivdyhphljzhezo\nmiurcpblvwaajiqugtaoqmemjlhgoxprurtymkktdbnoxwttgeeqimlhcztctyphmeqdsuyvkkjoplmzdcakpjvozimhxxqhduiqedlngwgoooupnedksdgpmhhdaqbsqrfpdrsykhbutsnuwjppgdeebjgsdyfoecqqnlemkimipecehlbtmbwnkdxymeclsshvkmywjxeshoihmlgvxiljvwllfpnjzywcpamevwtygfphifubttnwnphdbytwodclrjprseqwrdwsvyncgfrazzaodggxwwbtjqujrmcdpomjryledhufhwkhzktnkytgjpmmgvxjcnjgzuhwqqsldzcsfojswrqcnbqyxaagibpvtxdonpeashnrohuvogldxhsprngsoqdjfqtexyrwizzoeowaqezdlmwafcozvqciewgkekfgrcyvzsahpszobrixwxkpiclqljtkvnbimpdkyebcwlfkffrlzzmkvmhnlcivwhwztzrbxjcrtuvtxfkidxhoafyesyvizvozsqorqmqlesixrnerzoowrvwpmibhhyffuvkoukdwjcvxqglschjagquehpnhkycpmjtgludhrbefjjfytkxlbnvmdwsyxhgsczhyjgdfgnwfpdtlkhpekhjncylcqmssyghwdvaeqjkzmhiydlxdjohnscghbtuswzumsqoykiidfwfxyaaaymoivfhjlrwyaxawgeurbrnberazsxtkaquehjfcewctbfjtpqdljhehjobmarguqwsokldzscsfacxfzxfjqoverscjzbkmzdndosiyhtyavoxhtapyektuatprwskxzcznfdiuehuwymtxdrnklsmduskvutkfiubzyblwmparmjdspxywxerftzlkoriebsupcpxcjwkuveerenlaitvycicyzalwuiuzteyctmuifefygaiaioiiedbywrgrtdxvdkocsaehfcilqjoevajnjttknrsprtkrlkjapymuzrphzlcepaytfaveopszrnkv\nehrjstzflvyahorktkmgycouiertlpbjcsxqlgyglmvlyqxixipvwoqlnkaeqmarvxumkrnjcokvfktqjdcugbidvbxrnsaqwxtbftqsnpavytodpjdpvyqxksuvzwztjrwovttlnkznqdqiauapwkczxrxopeneuxflgbdwjmhjguzpeuddfeimozyfrqmfozissccrifwqbhxyehktusdgzxlaeykexqgqoevjtframuqgbdnrsmbxrvbtfglowffctujtzqwzggtlbhropkwkbbwvnakwvvdycxczozqiworvpwkoqmqhcalyzvqnkcxekjqzvueswqknzpyvysdkhsoicmhczohefnaslxwxllxlewtzuwbsuvseneiqwhnezojkxhoryesugdhtjckqjdfgnrdoizpyfmdlqlwqiodcwfygkivbujfinzyhcejcjojonhgustqjfnecolocmfhpzxtgfpmuscrldurennlqkwhhyipqzevbyktbvtpwvttgecajylqvuizfsoayxziljzegblcatmvefqrzxwktndpbbzdrwlphlgdywdofnzxqlxvkhdjyalhvvpaangodnlxhlsxshhtifxickobixbbduzvngqiaggcxfgrjmarwupaybnqgudbewkgwgtocblxjeccgqhbczibhqufqqxvllvmtzhfmbezplhqakbmmvafqyxjyexdsswbjiouymhlzcltjudobfuoiwubgeidpmvkhozhkducomlgltlveinncaiknsugjqccasdxdazcrtvllkfvtezazzcsctlegenlltvkzdqowgoljpdsyqncsdjsdcxxyrghrwpqinxmridxpdpqunvkwxrykxtlxyppfmajfhqyudwtigbjtmqmdltcqzgcaiwswfyryhcwwiaruhiibujopgrqnpiugkdqtesojacqhnwdagnvxesfrfiefaabradqeelkpkecvpsdwelpdjmmbpdupzvtvjxydkdncugghonucwegvfjzbdwkbevkgdwubtjvtoqothggtdrdolgjmfubzzpnhjaqwotzqblhmrfzfgykzmucwwpdyjvctvfamcgltmjtmrcjivhsytnwmqqjvmohfyesqxdvrjgfvgymhlwdxlozmcqmvhtcexameykvixdaqvssdwwoedklqenafbcfnhwrhdkjcsxohdvrbnlblseendubkxaortejlrcmcvovrsqrcopnnpkunkkcpoenvpkvygunpaboujvirelehlgectnazvqpsouubcpyfikgqtufvqqevcpcjpmjhpuacsiasptskqyhitauzfablpqlkukahmlivzaprotlqdiuoeeykiqzahfavzzrfrzzemiyzvobxuojorawurhjoppnnctehrulpgkozuywmobcdlbofbjejazsrulvqtammemhqpyiowmnlqaefzsiotpxjwocjeumcjdqszrrrugimnjbjalqlrcezjfxchwddxonzmnjvlrjxrxwkduooercteeqdvdlrwamnkyxjsxpfdlzehbgkvypxfsmqhibngjtgrkpferayxdznpgksdfpdjobicqfqmfstqhpfmcpmfdcdccmodlqjqgwjofnuqnpmhdvkzebnligkjfswcxwcujwhepdbsgtffkbykeuhnfzngkpmvqthejjrbzhrcggoewvrxbwyszblqgpwjpltjfrqcocqxyluttlwhtzasnqeoyjbxkiqmajagfhzzfbdvfuy\nrlvurnwramcadunwugtueshxmgzvsrmcifbvrasucuvivowlzivliiczpusswafkenwemocimlmslebfiiargfmuabizmyqpthdmzeiegqcjtsjhqkmvwzedalkjdvmzgrxokchgoalguqcnqyrokqmjszjwsdgcofglcqgdndbypqqidclzxsqbjwiploxderklgbxgognwyunrnumfolbalezroknkjnwrwebgelzbgiqdscwtsbxxzkghskgexlevgxnydqvtyjsllqkehtliauyiccqdmfiejrqnrnazcrfhpbjmrfbyqmhdabalhtigpqmwfonteprchddweqdohspjdgvlzmjbmweoilejrpksbxeestgpsmnmalpuswibubaqvotcaytbtuzdtwsysjrvrwgixzhxwhiuhvqtkjpqzyyhhtxmjfmqlfwzjfqvbenlerlkyawolvbtyzgewxcchswmwghbbancuejvmwgsffvowdlryinxfiwfhtldytygqkxrwdvrkcoytxkcweagydmhrpyquimwrbvezzvvjpgihcyfqzvadtdfyemfqvynbdlrqhvapgysggxdorkvmvqexpjfgvpifyidttggsdyjbvolbmcgbrrvkuptanlzosctfnyszklrnzrkuxyjpwwminhplxgxwulgxhlmsbzrquajuaxpdpsmwiwxxdvipouxtlkqwwowrqeatqbmmilpoxbipwweghtfiqjqkbnjhxdkunebqgrizkekgerqqlyyfesoykmvayqbnkstmdefrmtwkylnonchigmtfbourzhmfffsrcbdzdfbeostfvskrebtljhzkrghtsgbbdhlsicutfmmjoutfvexdczschytbcrkliwcxkgoqvufyogvfrnymopfwpnfuzeihxyxansprggwdyafawqgqbtdgffcegtpcybqvrqusqsydymvpeibgxffnopfymrmqhucgomdiuxemxbzyslvlitwubnspbmewwhgpmprkcyfdxkmtuhevoixrwlmxwgcnoyzmmyovrtepqtibdvthmpoaqyddqrxnvkiyadvloyemcycfcpyuwkzebcjaedsbvqqijqlgjycjpkpxflceoniyvqvurdiaqmsrtfgwtpepunugeajdgzsjewsqrmjzssbxjvotjvjqcfqptbzgketqkittrhyubkewfekrcihhxjeigutwigdbbdxrbwmbrmbvgaowlvdjyddyctcockmgzvarpfobgmhpaojoiqpqtxtucrorysmgtxcfzlbjbipfimunezpqaqjasixvwoqyjvxkhcqpqiabubqqdofehhjtzyqktdmkapspbmykoylpnzoipzwdmkrbhdntdkvpdelorqcjkqzzpinoqluibjgnqqlfewioamgmrcemoaxvufyqypchhgfmizrcklyhbpjjzrrugofluioivovxmrawzswpfncnfytmcf\nwnrmfzgpzpoltvnbmvwthjsvhbxsewqyckwexzpmiexgrjxjmdwbqyuipxarrbphnzwkbclgbvocyuzutzypirocyyucclqzcxtawhxkhalpukjrmgsxockdraauacxkpmrflspdlqkewyqjftfwahgqohkqnkttiqfyrhdsgeueivkrnezumcirzfqxozfcuhcnscqkcjbchvrspzotkdbidwwygowwqhnzfjqhfgimwjgrjvqspooslaqkxzehzegkwutiypzvvztdurgodxvaahguigpsglhabnqbwtqmbdsmbfzthyumquowldnovucoimmqszmsrzqpmaddcvhinjjdfywrwsdagmvyqhtqwfyiaistvhbzvroovjftegskjrjynglsshitxzgfwawlyzgkxyspekdarmeqdkxjflkjwnwwfzinwtxscjbpawnhbskilhsdudslmcrfipqqbpbfgcqyxejhgahxwjmskgaplcjjltqtrozamuinystpklzlivfhvsjtkzmnkabbaleiztjpzhztqhvnsjbjulusjtyynqgpysvalzdfedgaufchgkgxapvwbnuhymeahscsnsiimbmtjstpvrjufsikdvwyrizublbbgwadbfzrwmohscfwygavzjaoxrdilpomoisjjswfdyynvlqrmhjcszfrzpsfcctayvficqbebazkleewjynezrxdmfqywohwhrgvtzcdvsfdvhpvsnlcwnndaefgenzglnxhomksignqhq\nxatpxwldsxufannebavspetvuczjmutkxzybniehuesblhlpxnpoymjeebhdjhtjqfjkhawwtkguwtzefpxpbdrxfutvbuufjvgzpdfscrzswpqdbdzvnjdakgvqxhgkasgyrkpczgbhhevookfpdeqkohktevfnorjbezawpyzaudwuxqldjwjriqaqsjrqjgoaxiusxharyevoznqgqbteqmppciidgzfvgqvzeemwwazstqocwvntdnaqybcfrmnzrslrdexupsxuhacpttdyfaqwcgpwvnkrvkcofdgbbgpdoxjuuyyckitfdrclzmshghtlfspjhcgfasdvwjgplbqzjbbllfhnhecbjsntzzioxauwzkjzhzdfwdsvwyxghqilwncnkijcapbyquxvejecizvviztcbdoqjhveigvekkfkzncnkyvoguwpiiktajdjntsgiecrpwinbumvktizkxnrsdkqbvapludlbegdrhptkwpigfrcdmgzjeibterrwdlceczotviwlpfibyanraahoawomxzorzgvktiazlzynkmwbcrujpdzqsgqlaomtkvbhgfseiexvjvwwkasymwiammkempnjqcaelfyyvpymrgujzatfsnhtniwlwsdfwyijfzshtepejvtznhvpfhaticqjesfyhnidzhvmuggazmnupbpkmszdbnofajljbroertesefxnippewoxvkzdnrluzlwfhlmwumclzystoxjrsoqfwluehqfrncfkpysqlhlanroccwzlikumoyyokhaokilpeemnqygsfjnyuctkfzbltinmzbkjylqwjiamfkofjjjjrjuuurrychyivifyaxlhwabbswjdysejwswzslxvyilclpgqlakdknfaoyzqrqivmedburfwkbkrdxwpwefaucltzwsxzimwdlhfecvifljzusprolqknjxfmzmhbzfpqicsbrlprbirdvslyhrsehxzuenmsdpakeearmhlffbpnshtjsbiavexuurspattaln\nbqzronmfdwgpbepeuhgbjbvnaxrhrvuwptsbzakokkpatutbdjevvjjoqrbmaqvjqkqwhapahwextjgxwtcklkdaoxfqkaycroesdtdlzthujqupnrrkaklcxgdcgtfoxkpjmrcixnsdoljzxhppxllzwwsmztolxglqtlmcjvrqlohvzxwaipjwivmnvqjbzkqfjjhwecxfcoeskfkadchwqsqtxmuncwiregvulrwlzwhifhdnqubwbwtcyxwujmjqhbjmjyfvtbmvwhqzjqrfbfdxdxgmfkwmlplkprltgxgibtafvdirjmsszgabdvxilmgqaqlxfimfdzxxaywmvykpwxlzionemyrdbvowpgwmooqrlntgrrtzhzlolmcgvruncmawflyqrtbbohdymiggavytlbrrbblygyehefihvfewlicdpqromvutbxujqyyokcjgbecatmjdvmajkpvunlgcbnwwvmlqtzzrbuoiwqqypfiiyzurocacwepxejxxfvjeglkctgavrygkjnhzqnxnttihvniogbjmvivggjzqxvdkgqyygmjuxmvgrrpsmnruiclcipomcsijvjvdfevwrhjmrcsurucsdskgxbotwuxhbxvsvandsewrnfwnszwgdugnuqfbkooqpowbpufjlhobdwxadysonqdgbnpzlerqooveibtuakbmuzaqviouhhdenowzyxezbqzqpgnhobduwbzbdftzrainjruucocigrajyfaazgaigrnbcqjcwyveflclgteosbnbfvutghcjekknlsctwpopabjpliwzkbndgpzbbxomkcjdzlquodwmuwtidgdphkvexbsztrintjappsxgtykuqatmjcrvbsamzlvztawfovjkfeoxkykdaobdcdszgcovkqsnhgcgbaiosrkherchtqdnlywpyviqrfrgemkogqvqehdrcvrkmapqvdburjahmttyqqqaygtwrxunnugtkyfgvsmskscinmqjlgccfnfkgphxbabrglouyqprlrnqwtoteigeokdfwfqcbylqkbyxvofglfmjxbmthzbooxobhxrbnbewhgehlcdimxufhcgeqfvdmjyjnoaqtcyrbzzcyrjbusmddvcmjoekrlzvngdhsftczzzlhojlcektmecjjtanfdjjbazsvopqheouddjethwmgwmvgpxutvccepmnoqsgylgjndlbhajw\nvohtwrvfymybqnxzgsfrrjdexwkksbdnmetglmnkluvnxdblzdkysmyzvlvnxkiycztmivaacevfuabuxwymxiwtawlckmpathuaorsgapjklmfbizmvbxyuvgmgcbutuczjugofgwkleouxcatyewursbvobdgiqqimilvpwtytnbsdbzxdmbpvbdqxqkrfqndqzsbxrcbwfbrwdqerimxfbwpanfhdwhpqafipcfhvthcrqrxrpfkctijgdkpqskwwoiripgxyorhticwgsotniggivzaljkqlxosqzmynmhemhwppvnwnwwhuzcqxmkhgfdjgbpoohrmtaxrykrzqxfctchjpxcqwnwcfznzrgdkkoleejqdfpgfwvacgtxyqqiqqydfdcvofmafzdntosdjkidroloivodqisbzimryrkecdqzlyemsssqmivpbywesonnvultkjjzthqilbntcvczvjkuetxcknhxrfzqsxpppsewxwnueqovzyhqfjxqmzvkwmogpfocenywxgeacxrwepiiqkxrpvrcfsnusuwecjjlcxpmqflauccefeehuqtjqwzphiwosewptcdqtmfxobkhxgkzhtiqtxgiosgeeqdbczpddbattyuvidxjodxvippweskzawjzfjhhfscdromehncpbpmivezzhklqxaplwumkpmycknbuzggfkoqrezgctqiqofqfqtssfwuqbysrtfwpoyqediumvefmnsgxczrduunaqxkfxinhsouikqwhzbukaupzujroolaulkabporpsdtypavkhvwnvemhmczbadvopemtlpshwwuyqhqvaxxeqwuouoxvyppkqacgbplsnpxjgsqkdppxzzyorylrspvyoenvpxnuhkczyfdummmzyrmytkyxfodmssqgfwmuqdswilnjnirudogvsalzlrvoqldtdyjthyuiskvcytzywlwbzpgvunxnvpjantjjawjbxpuhbqwuxdkkfsuvrtgjtpphcswiilcjtmafrrourowzs\nsgcrwtswnnbntrfmbnwgscjxxfpmtboyuprarcjpdcdplftiqrzmnuvesxxksegksefxmuopwrkveszeycqwxllnnbfnonushmvdmplykyisjhhvszhjpfswwbolzummwrhylyjlbuwxywxyqsjbcxqnsbujwverqnvizakozdkscfykpvylkufcejdbnijjycjnppsavnseaeyrqqnbucwxglpxxruuqetpxoebjnrzodfafpcsxaxluopbzetsucqzzffskdokroszvjztrqgtlzapbvospelnnqxargfxvuqjoyrveuqnnameexbaebcisvmmhzttldfuroujregceyragqqbrsdanmnhigbxyglmfvglxolymflmknanrzpzuvejiewsbekbuzewnoszajzxxnevpuikxfvftcypgzyifwjenzsbdoybvqaurpweusehrpmszbxbrqoaaxwklouwfmszmgerszchaoeebcvyatgajtntrujkuixzvwrtzlnqpzaghsbjwzcfgasmuohhohsdyuyzpylvprnfeqmtltfaegziehowkjscuevznwrcnuhkmqlfybghlxwmeihvphbaozasehczxmiemcaqpoilyodkmntfzpnyefbpupsfanjahrjpshxupmtefoymgpguoukjvdpuihijdttcouhptxjqsxoorduujidxymedewdmmadbrrmyzufwbecgfvlxetwaxidibgvhrguzmdfmpvtpbdohvlzmiovriwkbhbybvebyerlkqqbasqgxnvfhbxyetaerlhhfhetdlvcdzfkpfkhwgrkibxgwlohblnqcvovtgiyytklphnphbwyostmwhsjrqprxntmlqylkmnjgcrbioyhdobnxpwdbpbhlnnpegbeoiivalofwwtgajhrgpfdgqburvyykujnugjafdutwplpefbrkrzeeutlfbcvcowwdztvhzzaxwuyaqbrszrcyawwsxhgejmmunolbvbicioeheoxmiwvpilvovgslwopgbvtvvpdudlfmumsdngistgjojubpmgymwjlcobgwxwtchyobsjnchogoarh\nxtatcjfpng\nenbvdayhdbdecjjitpilypiuuewrgobyxjklulffpdcipypmcrjkgireznuqrqcibnbkegxhallbbeempawcxuqglfkxwyxualayyiucjvgvvkysxgbnmngyjvvwtabktybjrkxmcwafullluoycnhofisjnnnxwnuukkhgvwllyjpvhmnzdheyspkjsfidtkoxzecwnvdiupsfzkixevkjgvrbqvjqzyhyguhjjguxhzyplwiirestldulakyqquqgqccslrcgsqhvdehnjljkwomipksjeqxfwhilzboyforvespphluejhkgotyzudunghuuelfxmgezqdngrtnpkggiwpzyoklmaekfxpqqxmyntpiotqcvgysuyouseysaqnrywnttrydluzyfhukihcyhdzjjdyvtoxlateobsbrymvtnguiwrjmhuyshkrcxjabnlkdikayvrkaljfkwowycneovtchrkvgeewqieboshtvfekxqhsqcueohwpudvukjavfepisiifkknaknhuifjuuzsfcfmasbbsmthyhloxnwueeosiuupszlxkyfrllomgvpsnevmidmrpbhepwgdmezxcdptwokiioxhopmtrbqbpdiqhohvetjedbjpahgztezsbcvlgnefhpwiwuinnfvplgxtuqwpmyqxcaciicdprelazhpxaxuhtnlxbylunbgjaggzyrfxdtubzqcqvhsikbrvvulnnlpyqkxuverkqalnyvzzfvzyfyuazwrioqvqwlytewacbadomhgnkqglaviujfvzmjrcuivduhqtezgbazrfwfheitdnruzvllhynrmogezevkmcwpngfjsacijichtxrprxznxiosbrbwdjdoknxftxzlmmvvntdzqfpviyrxgncvodqmxfvhzvizopvrwxetiukpszrswajghzogrnntiggchnjhasntxprodmsenwopfrevcfwmzzwnczfkeyqjtwnrpsfnwepphzlzexpzakcrfjzayvipibpazivnrqorxekvoxieyvlgaziabpmvynehjfkdgclnyyvmtahgolomirqjjzjhzikppsyurtdinrlqvtlcmwmsfgopgminkiwhnqodmlbnzpcgvunqmrydtlzdviacdsnminqpbcpebxugblhdfsjwurjtangfufuoebheeteuddizxytmzdykljyqgdednhiavqbqdfqwepncxcyzhponwerxlrpsomafcjykbkpwuxrpraiovcwtmvgtgcmgrkhrpfdhuqggflonbtgokdmhpziynvcikdvvuotxjrahjyjvrmzooqdagjcsexmpjtlvfmuxjjxcknixfeipbnysedyhhhrycqxeyxkoyxagwnilygiyjhisedolmiebwapqvscuiktgvyzhmbphpcolpkkuczvejlgembmiaqeitgdhqywyjonfhswfpnvtfzbvcalbcvasbikjtnnaciwpvfphqocgijfxdoatzyjzjeyfoyeudxzdpmtfhkknqezftiorttfskwifwpwaafxmmqjhfmimakbssuondsadnftndfstbwdfwtbbaulffdbncumajcvpxvpoc\nvsuyegomjwyocavmfyhhvnngozvjldkjchtzxqmqohynqaftunhjfklbkxnjjtnpdplwhgtujrcffovyffkmzcdobkmhxuqvubpyjmniexrwvtrevhhwnxswkbduuflaolttugfhrjtdopvzdzceeksiiwsqzimllwgttaphnrvntgnrjqmvlwobuvghcwsrgcuikqkeewfwgldppvytnevabzlqsevruablogglphjmprvrqoomzilxzzrkpomqarjsoevutqgliryaawguvogcdogjfvrlvhqhrmbftgvxsxeuoijsqxnfvsnjpxhhpruwyeopyvcjlnehhqgyxqxlwoikczgbzzcznkfwnwggybzmcfbsrckyobyevssdvmqllmeizqfqhxjxmibldfpccjymxofnxzpvqgyuahubzrcscbwieuiorfkfoyfdcimgzjzmlonupvfovcurtsffozglohnerehweccptovpsfhffobcvtqriwuwkrktpiwpmshrxsfwrbuvdunvdxvytfokqqkgpkmssvqkumpodgnzgpshthmluwmgbpkrbzctxludvycrpzmapivxewbcipanscegliuuqvbujriyvfdkxdwkpvwnuhtrwvesqrtwlsiffkapackjhcifxcruvszyycugwjfzpapveziwlijvysyilpjiyiyqcqmxcycykwjrohfurkooekibwayegbombbmmznejpnulelofvjaqmioehdywiazcbehqyphwijshdrwrwcdtgzmhmspilmbqtozusgfwidxtseolrxgdowmryrtqhfonlkzhflaxwolxcvmjjccsvlbrfqhddnymuyueowdpeqlaiejnntnmogteqpemeiqfxkgjtoepfovtbmxolapgqwrsnpihlkgoyuxiuwulrhqydptecbsfqdjjpxkihlojkoovimihzjmtxozuxlybgxyupqublbcsncofmnimzcaoimeaxrqecckytskuakgfgxldtisbctkgnthczyhrcxouexiuqeuyrcudqhyyzrompymdzubgvqiaegsysjkzlmbrlpyznloslrqhmmjvrwjslmoaqvnotvmvaxdylcbkwhplufnpuezogajukqhharjowrpxlwpoqt\nbqxpaofdmtxhvbbvxnngdhkksqntbokvducnmenpqkxdlkdpxwwlduvytmamfewfyhnzqmmqubuccxnqxsfsfecfjgcekvflcczwaxsthprcxkxynjdpekjvbojdjldezawsdzvbuibjwqhogacfprvcczihllgrskbadnnxnpqbglcsgdkqjthgeyygoosyzyhtqgvdyeiajqjjfxgxzxxvafzpeiewazlnhjkkccwtfnvbcxfdfzokonebcwlrqhxoqjpabyogpkmtdlvxrvljsupqiuefburedxuzrnsyvqwvwndwjodyxpbrwtvpmxcvdgsnneannqrnqyqisvclpohqodestjfukejgjefscozvnuiexpiisatfnpixojbtsiyaxyyjueyhsglfipipycgwfasxwkqnahsjcohxnvsvfxslpftyqvpdgnvcrmtwrmftodjaqbrfiaavyfmibcodwbtuatjndyuzigdljpjkogmzewlzvvzizetanviuymptictwdupivshvkahcixujsheyavyrsplmksqgblopltfgjizziisdaiqnydmdnplfhbefmrbblqwcwtllkorcopyiltfklzjotyozimgysnbmgkrhxgluyryejdjjovcnhlvmkrbkprjyosspxzapyrmerqrosmtjhbnmnyrfabyfnfncywxzhjnmfmaevmefbabflizedkdzmsdoygkjjdxvtouhhxgtmsilkzfzwdbqrnehhbpqkqexowyrvhlsuqspzggzvjseyikikzoqhzyuzzvdshkgrzvjamjplhzxbuxxwluelaukoatgonwvwlmvpdmjwnnuzspqrpiyqwrttsnmdzndhwgprgozkqwybnajfgrcvtmbygsagxeyedgrxtmpbjbtduesrrfontvollcgnwmoyedhovgnobrgtldcrdeuhcsumykhyyhhbyjbqwvwenkrxabrfzzrnpuxztavyppukvgdfbwmngmkgazekpvvwgaczvjpdnaxbpzurprcjvsptbkjmcnvasajvpwwtzuysrxawdpwmdzwpalzsypydtxweoxgnlxroqmthqgdexurdawqolnoisgxgfjizqjixivxkflpknhpwqvaukzhjolovdosqekhkttaxntzzitqrdxrjyhdwixbihlfymukhoiqkwqdtfjzlpvyzrfqklpksqrrfpviandfshtsazjrrhehsresfczwazwokcdcibnybnwydhisljsxtvxnzkcpqktytmmcprccltssikmutrtrcgdyltqdssxxasfprorxfuamljmgxsdhlyyjfquiimkvgjtnejkyopocvgufilapzknymvxychpanhlmlkwhutlyyexlfdsffuerusdbnefnztrqpso\nxsuexhgryfdpxcwavlxtodownixgwraxqbrlcxhvdttktmgnoujscpvrwlwagexbhbzkdfnzslyvraqyzkiyiawcmdrlubzmklldfitzuyhgftrmomxuszatfxkpafhzdvxvooevucbwlnztkvzcgkmijoohmzicndfudzgrvofnxjboojiegewbacgbpaloptookenlazjttykwipemfslyoqyrltmvphlzvrwfacnajswrqqjyibdltqvsoivxlybxbrwwgqaclxcxgttqzsrxttatfwbfnmhccfhstxntohvfqvgcevgyefjknqfywmrjuqegwqjaputsjnbzmxyosjteqxwevvtshbqdvvwfidjsmwtbvyazuwrfuakcywewyxjkmdurdyiglaxqxinvzgrrriuqjolwmbwoxqntzqmocqtkmibhpwzabilywkeytdmbdrjpmrvqlbxztvlukamyldzgddiujstqlvuvkzyidsapbxygnxbvmqmgbreoickybowqxrwwbshemcisgxrjwdrenvqotvqlddpdommatyloejqyxpewdfhqrztxvwvibmnwcimspxaxtzgyqwgydpjkxsbtoefhcajwphfpzhdcmsymgkdwfazvueroafhepdgxreyvmrhlpfeuucumuzxfalmjjhoibqhzgvbjanycwbhwyudskhztzzgqulftvqyujbhazwbbqhdgofwyrxvewjybbrkkskbixngyuiisyqchwpqshlbwh\nhgosbzzflvcetxcqthiqbzntbkbobnflhmekcjvdpfittsfvdeyptzqsouxqzuopabmjhmttkkrhsqfvewfqsadrkflmzocegfybaevpyfyzinxbohxxbewvrrcqgfwxqnaedhtcfuxrcwrdjpedjxrvaurypegtijqbwxlobpeyjldakqihaofggwoyxlmnarjdnxauysysisdekesobkgoalrlqsrrfdcfuwjfwfllirmetrvjffgkstvjkfjzifydlimlbcikxuqhsdhzkuurcqqukqeudywkqejhrbtmdhnoyqsxevpmzwainltqupqtomolcbwlhobszmwhmclekitsiragugqbqcogfiyfswwxyaggnfegvqygtqkzgevdtsdmzmttjbzwrcwlgomnbpggjhjibputjcperrabysbxjsalojjynozklznsibbiswpzhttudsvynieztyhlbdhlpwvlhusuzdyytomlsldyheqctuyreialugdacgklbrwwmeklxvdiqirhpdoazkdzqfwv\nxvekxzhtrrjyvwvriirmdjiifchlbufwodmtiqipdfukecyqnegmgbiuyzgotvihfdynmdrrxbbmyrfdzlvootrevtpjvonlxxfavgxbpaenmmutsnutdanazrrkxvdybdjnylebererqrmkawxrrepwmzhdcaqcniizkjlmpqgzuxnqxzflphnzktgnauabjutgvrzrbhfpkoslpnpiameodatjtuifjuilcfgaboqicmukiyfuutggjmcfjxqevwcirnnzdzmzqejvyaivysiothwipfjegeeckpsrcpciwkvthbwgexhunrmpnckpkjtgjugwhwngwvrbwaqsotnwyprytgosdfawssvgoionddtebsikihelhwgqsnwodezxbvgbwhjkfuwqqrbzwxfmiianwupmelfewyaapmdiypjpxfszrlyphhqaheeuoduvjsssjtdxeqfiikecjtydotairyqwzqvchfxvviaqzxlytskpboitzvnlslpltmehkfjhdgnudxmkwiudapflpvvqlncwkzyubxrqogrniynugrhqyukfsrmqjswxhfujlbjzggrerijxlvtnrjcujunjoicpuxambzwocebokmakpisbnuyfwshnlkhbeshtghufmlijn\njbotpqiknnmiididasgyzuquqxofntotuquovpppzllbqypdoykjhomrvlyapvnhbybdyruxhjasgxmkjxknbqxyhdufrkmypkblamanarhlqdzbssrzmtfxnnjyehbjpnmmmwrwxwtofqyidwcunttmxggrhpqorjbqeeoarronnezvuudmnltmsgdbfmjhzmauxnfndxduomfioarxnrvrubfupmrjiaqnpycjuoejobuosjqbrynjmbaslkwdauwxygkgxgjmnfmoqhojclkftnkiknaiwpwkndtyktazgnjoglzjqaesauvrzxtrruegfvqnqddcmivcvobpqykascbvpxrdisxsabjdhioucegqboymszdnjgfivqkbkbeqmarcflhkimovfabmnelemvhugscuyrtkecksdjddlduadccuoiapjfienrsxfkrbkyycshyxuxtehdujgbwyhtrsaeqitoqxlxunujessjdyxqmkmqphkvwoklkdxayjspdhcophaxrxtncpmiorropjgkskilflqnvuwahyoyzaydignjejjpipzraslrjzswbdrsqndltwbrrlildhgarroxyajliulensxvqljuniivaogvwfhisywagmzyyauritdrxnhcywiwpfcpfxsdhtatmeuokgtqwuovmrfjcwbtvqjngyiknehramlocwzyeyvfnxouyhrewgqvdalkcmpxrhhgngpwfghmpzvqfldtuwusmpgbkohhbnkbcrarpssphbnvbccfzmoytcecdgzzpgdydtdxngdercnsvraxdiiefowkfyhzoptxswdyzivgplnuagweoplvuzfjyzezhvrjcdbrujxcmqudxswbolugtxzggrrbpgqrwwnvcccczvdalzgytwevldbeslozmqwfijgyjtppgbxcinfxsfyqwtzjcfqjbvcbjtsdjopfokrrljbrxihnsloixxjlwlaqdos\nmrjdnsqeafgzflikpdshigcwgcnrujwoulwglwtepzupvflfdqgdjctnvcbruqrnxogcwizlqceibcthplhtmzztevhzxtogogkqsubpzmmxlxlflytbapxculktvrnmxsrrlftnijluqisipldqorggnwvlqshgyzkxynecncpeqrxedmdteupwuiforpagvnimfdffmxhuclznxositwupllmfmyxrmoyotptuafoeiwrqplkznzubnyhgspgehabdhlvtpwxuxycgzdejaxfbkeieizqfuryllssciclnjstarxzlcnmmbuuecocprxmyhwxpawuwguerbyywfwbupatkywrbsuvkrkmcpktksiynccmpvtbidamdrwwlgeejzsgtxtcxgtkiijviifrvsveeqkvwprmjsudodjusoexdickjchfhunplrodubzkmjlunzmjgbnwbjfxdoagpaqqnvhbmovzaezfryjmfekcueehhovmijbdzcqohambcgsczaeuuvomvydifwhakvgnjubsnpgzjrbdmizufrnoftjrqykalrwszfcrznfjqfgzmclnnjnzcsxppcghklrfuptfnpecdoxklsfpfuqjwcpewugkyrdjjosecnlomlbiiamvhlxgubxtwomqqotdboeffdqagkwvqaagbgyxfupeixesnwriceaqkbhhkmfuivnlwizrczygannqnaeqeuakabvcenmbwrjxaluimmgrkmjfsmqizfwhojzsxebcj\nkhljfehprgzwrxtpdndwvnqrbhenvlgqwgfunohtiuezphzbgoibvdevrezuahpolvrczwdewoevnzkmhrioyegwhizckyxhvdohkdgxjdcqcgnwqcjyzmrcqmvmktorsauzagyvppuaqnxtvbpmndnwlsnkpmmoopfclaswlfknzwskjmkuhmifiqufhektxpnxiknehdnaokzpbwctrbxxdihfykyytvkwhjfhvwypdzmxfvnnvxvaauskszuxduiecgnzzqptqoqsvysydrmzihlsnggygdtsevwboqjxqtoxkhumxomrvzpjketdatznpfiebpdtqfakegvnrpaehlnxmuysdkgqwwmwwvdjkbnrtqavhdajrhiwzwxzabanzlrqhlqkysmroykkbhgoqzssfnjmpyzdgwlgodfuortkvunhvnkfivvxxablmnblwdoougmccocbkimscazghzvwhwbitzrdjohodybqyovqajlitbitvqtpncmkvzskkkbkfwxxqrgqcfhknxfoqjlwarapbfzeljdarzrlatlxzjvsghkjmlrxosgvjpipysxvakaiejuhcgxwtodjlgqcjrvihkpnwauzcwftkmfesduhcfjsrtcqijhohitlpplfxhqszfosofzshcsguvakgsluiixbxfyicupycxfyxfazgsodendaqauhlwsusvcozrvvxuelkcdlmbmtoejxzwcjxuijpsfbaxzakoptpahcuuxwfqfxslpxbfjkjimhhqdbgaxhosjgxztetgycgbcjmudpmfxsvdaqbgvdbdixirmsyibokgwjddmmgktbprrxpdotrslhutjrxternpkxfwcbrxzadseciomtjoyqzbydqfdlzipvrmpuebnhpfqsnclnpwvutwjpbhheyspvpbfxqjcmjkuuxeosdntiscyzkenfyvcstuiftqhxcksooesorejgdeotkptsqvpiawfeflvuknojkdryuuhtoemlmlagdktucgpeekqbtqvxbysvkdgglfydygncrcshbplpfmmmqwhegcghpgfjdmoqsjqzmwplkjlvsbazauamufgyusowzxsgyjiaypfutnhethjhhrqdzrukgyii\nsxsjjgbesyeuzsqnnlwppwsvugxzzoarinbitcluxbtqottzudjddybcqbctkqyktunvvfvkppimycmxfapzvbrisyqkirxeuvsshyzljuzkqghjnidlukdcfixwtilngewdnrusilbkdwcjasidyvlftxolotkjssflucoxnkiatkpvujkwmpclfytleiwtbogawqnqogltjzavihivdpvsrrmogopwaytssafkueqdjszrulnsnjhrnkfqbergglvkgrmtziqcmrqnburdkwlmxxexyjcpwgowqinrijvhgbqvuolsprjpfhuiynhhaqbtutioztgqarpjyfjeisozeankpwknnlokyscfffponpusyilbciqkyaszyomhzzvsfkeprenfwundoyvhgjlposozhjkxcntlowokasyfwyzepcmnlyvwbjfdffaetigrwyycraudcksxpcsosggdnlvhcyozvrncxdgnulpfdxfhnsmiwrefwpwhnalssemzqgmymnfebbokrilbceryeosettkjwngdovlvsjuutboakgjwgdmgbseimqzvgsrruibyjwurclxqnayxhxxmwwdzhyvamhdrpitgmsasdesiuiekdnpdzrbiagyansasfatsugcbvdfcaorlyzxubzdnckafuzkuhzcmanmergmdneujjcrbymbxdlzmakihdsgkjdcismrtosglhnnqotpeoftesjiiqvguagqngkmnnudpwiyviltmmkgjbhcpeesppvqpsijjlaepaibuzvfkuqifaflaquhcbzkjvxottdffkgcovfpirweyxwbdxezultsmekwqikqskekzohyxdkexjyrjirjamffaxnbmjwzuzplfzdivtowpfpolevpyrlfvcwfbdtmvsxfyqylozjgfegijzahqvrhlpwkyafhaarkniezppwkqvawbawnkxdugwmqwhfriwqqmalfikryjjiehpzdsfdvyilxymegdvinbjgothxgnliregbnzabhnvcnpjkxhowzpsvlcdxxztuxtwllskjidmvlgdkzpumonetnwzjuuqqiqmeoqwxtiiadgbdwdjjdtgpgmfjnsowarexgdowfkgmosclohqamfcpnidsppambsgiltsbgkrwnfhjrhyitqzkksbtusygdkroljejdfyimdkkdycviwdxjlizynoayvxfuabgglyzxomoptndzdabctqdlkmadvxeaprqvsdoeiucvuctitpmrqfzbindgpfkrocsonunranqtzcadvtesdvrdprozprbxnolgkljltqxtgvdzggcxmlazzugkuoeviuinzfwuhumbsgsugihvffvohbbdndxdb\npcscpxwkjzfwklhyakbygfwcpgbcbykyopqqheenhzjauwlurllyesaudpudbppenjclecpsprlreehngpaskthgqwulbavnzekitfqnplygwymynwgruanejfdmgpxvzcsrpagdjgumpmuekmrcxlsqyxsvtxxpummymxvprixqqptutctwglxxzqqbktdtbxjlsjdgdeavrrhrnvkibjzdgsunklcocllhncjfhdrttstefrpvhrozpjmgpcczzxehufxxlgszfbzzwzovlaqkmnrcoetlwhkybylftapquqvdgrjbdkqvnajsudmbzrpnqrethxhjmbqdubcthtwzkkocxjxyfzcauyikoillteumqhanorobnellcggjbhurutyppwhprxutxrkonkdopiilqmowbtoboxwzzjpoybyfspczdvllrsvbbsjutjomufwskadwasoffzmmssjaeqmcjemmnxmflpzadfegazdmhwglgorqueihedjjcihtecpjokkbbafviqrvtmbsrgexaeagwihtienbipfmgcjsrarcvwcjwwichliqzkgmwnblmxuitplirtqxockuwginpmxmwzzcwvvximumqvniibrnqmtocrauojkaitmoquymrlxxeswzlqcbjswiafdloothlkjupiiblzpyufwazruwnjljcdsbhckrmhdhckflfilybupwstyndakuoojzrisacprjgojpwadlbioqjsjlqpotcwihuqtjpszxbhfmyfbuuscgbtrabptzadbzjhtbjtlazoalubtqkyifmyelemgtumxilxxqbapcmrmghrkmbopomlmdckniokgcbszkkxyfoojatsvttwgomorlnlyjotqqpyjmbyiqtvvfsicaayyaztnorzuybqomvuigvvjxvqdnzudmclkzsyipattkwbemoqevqsspwgsbkuwnpgnsfvrnhjwxymlvdrylaypdcjiirwcsctxazrtfqmbadnaoszwsqvdmyxpqcshgydqgdsskptwrlgwzchmozimnzudbcktmkgmsfteurqaltvrukfvrbewzqgrmxytrsyitulwmjlrbaqfeknrmllyvlvddabmygrowyuyhnyjofmwhzcxcmvoyqhbnsxmsjpoussyuarttgpfayvnsasdskeeaunbwakuuvdfeljpelljytknowklsqexawcofgxitzhnfylbioevcrgcffokfxbwpmexlrqlaqbaulhsvbwzvvxeklapmbozvyfytbaypvnztxyqlupcylvtuetegkprhkbbamikxbfefnsgtibuetupwfffgooewyuhvwuvtjvqkyfmymzdfqwxcmrbhjziybnpltipyynjdtbglvwyuzlqztdspvmfkuwfzvlntufxdwczfdefstnevieghxqgashpmughdvrtrhpncdiwwukrpasgbyerqnqdumrvbmdrorqtcgqldcsajdozhvscklzuqqjqqqpiezsthuwjehspeoqxqgzfuzmgtjuyqsgkkvqpihojyyycngbupgjynqbpqeyamyirsicmbuudpjycgbpgitqenpwisdnqmezivbmksulfeomnnkqhhwuwmbdkqkvgeibtzcutvzjtfmkblcypfovngwpfpwudxuigimaqrybeqldngnvwipjzoqapaqirsqotuolbgsunqwambyhhbqjwjwljopagjitbasygzogkqavypcqpktjfunhzbnibhuahctlsimhjpznhlnlpjbogylmbosteaypvailykufwacstkagxghdllrkfsaunnbehjpuympeyjcsodehclvofjayyiplzskpexgoslebhcstjptaknmpynwatnlotqqwsxmnuiyxdhqjjnbpnnjjvltlqwcjpihlfial\nufyztqscjxkoegvwqcvhokynplwkfjraqmnhrvqwwoplqqbjdkxgzjgdqzfnxpdaisssyqythomsiqsvnmnqsgnzziikqgwdjbdxfdqovwuxpkaepfrpgarlfsymbwvgsnolenvovjbzgchslznlqgobaybnfdemqrmcvnwdysbjchjmwuiddyaadxbtpjfhmmfgthkjhbezbcmbsbuewkxzqtolhcifreyhiaaeiemriccjitmcozpbalwahktfauxmnvslwzzfhmzciilfuqwkmcxibppkqxpyxgralkzqyuhsjltwjcchqsnprwfrufcevukhklnykoldypkzzzamtuhecmjwurwwqivfbvardljynccsvuejnzzxeqcjxazhdsrtenoijymgfnlnkspfbldoyyiigelttuklbowyqrtfqdtjbhoidganqibheyzimfkbrgehppkdlmwpzeouyxptetfggpvdbmbgmrgfwzbairtbzdclbdjnvmjfaprezobucoozqlppqfexkouetnlhyezazxqblittfqdjhqddemzfugrsjkbnzkgrnrkiqkrtcqjtanpylkogornnrsffgoiuhykkpactyyfdisisactabnjvsnuykoinlvfahfhwcquagpmzvtezuijoqmiixvyassdmwoayfyezjftqnohgonclkiybcigqzubszjfhlckcmvdjujreqhwjgzhywtoslbx\nozopccjbzoayltqlpsaplqqhsvomduojdbphnqomzsjoyxtxuskacomhhovcriuwzphjmwkwskafebzjylxfhffvmbphmpkblpsbagdkepgwsukhncjrlpwacrtdyixceuwuskcuwdhcwqahgnrzkpjwnenwzmyljnitbibshbimhilruongnxbhwzscktovuxmgssqkkttytyhoqwbyapepqfkewelypxdhyppjmskybhddvghzodrmmptxquqiehghmimtxbastmvcaqzaysbuhhuxvphwidpwuzzeiegmizxtaycfxbmlujnmdckyggzihgorixesdzvafdgiiarkqspkavlpnrojghncytlclpbqovistbouslsuudavcflmetzgnozpjihvwoablutddadswnnmjqyqkuupwkaeqirvmateafttviacbpmjqkdnhchbmnmzlnlhjmlziikhzwzdwaxgubqxgobhgkfcasjsqzeuqhozammiwqychzlilnqllqjwgmayabkaxqhzxbbttgofaccbhfwqbzkzmzirkegfoprqdmlkrrlbynxokbqqtlcxjoughqapqcnklpsmpznlsdrpufxriowdsalfjclxrhblujxhdlklrlglqwpafnatyzxcvywhboaasycvomagqzcuvvrvjypbqsmzwovxxaafebogzangkarrbqxmfbyqaevnbrimzuabfvprlellfarjcenaovxsjfubbinrmzeyoqdndfzagiwnxgptqeuqsggdppiczrcaijlmgplpototknhdolmokmbfspoptsxmkahsbrjmkzbxwtprsndiqzsrgaqgdptkzoovonjnznahzgiscuwpnhhealsvfdjetysmkgfdqjzdxpaqtfntixyazvnmkuxjxxonspdtqevzsbuhudvqyihrisbhfnaehrksxqvjnndxywdxafedkbdgefsovbklyisboedvyszxmjjesdgqciicenkxeajwuycaehkjlcxjzbauupjfthppnstuixndwlysceqqpaycusglniolwqvfybjyxzuchpdizgetscvhzxxqirhnybglczvurslqpdpxobbqsbqhhzmcxtfhqqktnsfglvomnmvpzabvrfiepwhieofvvfllolkgclsstzdorsgmsbfukieyegbkqsnlgafnggrgocgkxxjgzmxsjiavixgitbsgakqfckoiixqeogz\ngqysmpzxuxhbzqcjrcngssbbkftjjmwxzogekehoikvdmxcmcadywpgezlixixnvxbzrxcwdhgptwiqfmldkqocbeczkezylolqembpiflzsakcwxqxdnkpgqhlibtpkyghvjnkrvxgdjysmydqdtxqzxuieoqscxojatnbyutknxvuhkyguphnhadhffbbhwlhlrwdoherhsdunaspwlblyzfuvrveevljstoqelzxmjuqvjafggcgwaldepybnzahqbwcceaapahvsypohfwsiutcukynpugzkutternuxyxlscaclbazbaifrpyuknbtskdteirbmmcfdsznwjzvpuixwqtssjhuwmtrtujfchfiarmpeklhewcookdjabiithemrxvjymjqphgradfidxbfbvjfsywcheccssivkeozadqrygpsyaxqjjeqrvisueeutmbreyjntiqzumeilrvkxfmaplzfrkvadlylbibqtnbtfhxuijunzickwuszojhaaoinbhwvjrohzhsqwijgdkhzpztczgsewlcjddnalvxjffyuiywtervnmdipjrliqpwhdsezvanxpeeawlxxokslllkaepfmkurcfrayfevibkkxyivgxpdtiuwkzbklgvcfazmpgipkuzyjwxxpexrngfaimuvtmhdwqckcyvhnqsgzyndqwcprqznybzddzdvceqrljoajwlvkrgomnawfcgyvptxeyqcpiycsigpiizdywddotkqsojpesjtmlpttiufvwgnacrmhplyvqhzswgnsbvpxwjjozvgnzbpjlcqjefiwhxmabkreocnhvwkznpdovchzjjyumoabawehenjshozmdvfgoiqhpsvksvolkzahlrxdnuszjsvhrregegdnbjkvxrktthdkjkwuqkzhusokdfkychmuvenazlsslejpqwwwhjoqu\nronyqshwxwfkkujidzcvxkvqbnfovqgubvtdgmlikgawyydqossqkochkautxvqvmwrltoqxggbjavnlihrbsoveqiezdtyngpaowmsiahkuochszclvgshytbyuqqdiwafdteqxljrivvdaxbqvmtmcfwehcovuxaesfctojvcjspgdjhvhxzdcjnnvrrtiytdljvxqpfmenzqpkgflqletaqbynuvznsxnjrieznzfmhhbhpqswhdsnpwjrvnggmgpboaiaxngqibncnskbebwjhnchgyyvbmrqiifxqluoididecilzmqyakavhebihebpxwrekwchjfhekshwnobkhufdatbxkoqvbmkscsccqjvdzsomxqywijikyqncyjunyphzdpkrlcnozlqxzmcvqfwuyghfbbuniqdsfwvifrqsmrgqcovjrfgtqtqgnenlqfxisdtmqolmmgjqavqlnrdfdjxgdzqwmoenqwjubtsdatnu\nzpuooqrpuvefaerynkuxnmqafcnqqjqwlkyweokcmnbnzwuywnmnbttfgcbaowudnmuuxnpsoufznneededavdwcqxnqxnpktafgoqunjvdzajckmblzrzjhuckcvbyxgozfdapdzyjjofmipvrwlsjfcgdwxrmdwzuxgwpgekdlqbbjcrxnnwpzmkocnywqmxdptltnvytrzgrjfkpiemndlpexjdafelhbbshcspiapolbjxpdcyxqfilraqigizvwhqohvogmajypjmuojuogsjqtbklwvqkajbdwjqrguvoancyjmbhpjhmygpscrpespqaticithnqadlkncepjrrhsjlvpotnothwysokzftfyqqfqpfpuwwwvsruizlatofazijpiobpiyfkplqlnafeunakhwrktlsuxbxwlvzznzhbtv\nraflrexsrrfcnribfrqivgdkybcvomvleeglkvbmhklxesljqjibfapjivfvtcdslmfjmqhssqbfgdoalyulrznvmhuyoxzgaakchhppretonbsfiqpqnadpwzgwxnwemgizzivhrxnqyuhssjaiepqlxxzmdfppswxrzjctbuxjpjdgijyohwlvkpmqvlgcyyuxuwnezqttnyvrxuxmrfzulsldildwlsluntcrxlshlftcovnvovlmenesezchmysfqkbxiffttqgojegdegmacumgvxqyzdwrisgsrhmawdsxcqnkepfjjcrgexpzxfzdkpufenlqfcpvoyhwjuzslrruibfwmsmzsotiqxdzwtklokgfdwnmwtfzordsdmrwvojzofaqicfnwkwwrxlzvwejzvwuthmxnxpvmjicixrormrgazfsmmxhnkykazsflxephdalafclmigyadrbutpriajuponbkngaernvfqyltdtmmocrwufotwulevfqamdhracfrmipabydxkgcjhojxpvtustzlmugtofvrjiowikgbchzlphymnyfugiccgjloryiyvfdczueeyszsddbzypawseskqsxlrlvkcpthgqkbcoxelqjlftllipiuivqpmorwiwkiuskrchehxs\nactlgkzbbmrbasrtoafnlsrjlatalhjbcodtzjwopavpzpkojogfoyxfiavygpsvqtbclkvaiswmszhbecpbynghmuzzyqqhpwfijjfwzuteqsionyuomrgzfkhapwdoipgwnzelthpuqhmkbmglfbwikmbyuspfmcmakigpdzzmlkeazishhvxdidmsoamvrrjkskbjznkdzfhnfeexufxqnlthglbdjvsjapajlsjkaivcceobarchkmicwrsvnaeytnzxvayvonminrignjgfuifeklvywjlztcmonxlyxibwmbfitzcqjzslzphrcjjevqftxmtjvlnaypgrzryrumyiyukfaqdgnhiokscajlnvnslmgustkimwagnvhilraqaubleaqeutqmqgpyvblpagpweujhrwntwpresbzeprwrpradmcsswplcxvzzbuxmhgyzzqwpnthicyqzhfbzqgambaqwcgafdlbsxfzxxynskvbayzbuecaabuiihrusylazgefmyxbxmtlmxnxjnxpolaiuaamxbrugmypcoankmoofrxtsuqolexzefczgyyqdnciljazxwzljzgyrfvsqpcnwezgibboqqmuvvjneptwbwdoxkqenngacqgvjlqxzaagptqwdbjhrltakcykrectmljlzkohfvdthvbdokqvgklltdazsfblenmpztvvijvfnzpkpdepxrwgblgaeuitufsrqmecshfldchtyiwtwkdvshojxztjlaiprljoznczrrecuglmdvkaufngbdhaxcqcfnxelvbzxubkrhoxzxkrpqfougxlpdelimhtaqrkzlupincexzludifmxmyqiuvauqvxgixmqvgjstcongurtfroajfcqrpegicnalmrgokbujfdyidbpelloeldjyryqkmocwwhvixarrgo\nnwfqtrqosxqzrobhskwitkpjptebwaqtorwaixbydvfyfxdexidcttwmomzrdlhzavqigwtajuvznhstslyeoazuwwcioiksyurgdlfibulcnvtyjqyosqyvpbzedkyyomyjnnluljrrzelgkecysmrlxkwquqbkkzofvucxpuwizgllpubgatfeknralnlgcwghvlddwszbmcpgqwteycdvbtzclksdgisxcbwgspbausadblyxbedckmjcpgkysskchxhsftanjkldqjxzqbgvxybanexnwreifqdfqvqialsoiytgdulyfobddpnatjqjyardbfojkyzsqzkegycfrhjhptufsckxfkacwixjfjbynprxrigeftmrylegxxeqfivcorpczcdszrfnypyxzomwpazmwemoghmbmtnxvwkptcmsoroxsnpeejnhyicpkhjnavyhfdyvlquxizmkmsgnvjeqfgxscfhtqwsklqtxhtaignvgnqsvcqzfntstqepvxpesdarfkuejqwjhtebqzbjptwkqqwjhfcfaccwforkesmupnpflduzajmtdxuungcdadhqpjtulnygyiorzvmpstkucoaxrydftiwfldtnggxwcukseptpwmaffihwkemcxzalkhuhnvacjfynzvyuoolkqcdmbstknqlijkbtioatdjireouphqgnznxwqqgvtcklasuovptqrjrsjuuceiintaqwceraznbdohojtrgqxoigyrtuvmagsqdyzcfiznmpfhjeuynllrmgekzcrvhkicfrxbqusbenlxzrqgtbtbghzbrwtdywrqdwaovswqcfcubipokptbziwfgxyxtzdmdkmgbwammigcojpzrinqeztgradnnhksemtvyinfyfszxqghvjxvzglyvbahmxczyqitybdwrxcjtlumoiyvhvkctxskihgbzcvfbeojzivisgkvduagaokccbbmqazkyvrptmcetyopuloesqvuxpvobjnnnfrfeixxhattmlntunrrsurwygjjrtwobstnuxtiewtbvvzmmvpslewcgnlaqcwxkctunvxmbysdrgxwrgjeitikiuxprznklwlmzboiaevdvkkiaualcupfkucuozfeuphohvxcaegxyrzgtjwfaqfrzoofhyor\nlacwmmoyrnvyfmoesegpvislfgaqgemxkawpqubnyqewtqtckyinldrdbgapvahnrwezaxrkidiaunbxntsruirdgngfyyuifinrfhovdqrktvbmalnnfjygxzsnvuomozuypypllpshkgxyqnynigcrdni\nwkfgtjtpnyvgxxcuhkrhrwjcnrfirdoejokxzkurspsmygxrfxifyncnwgtbrydwzbjeqhdkuncuwvfsrzgispssszhjhumlcoothbznfqpfwzpgopvcdmlpvtewbcvcqdatrivlbxzmfcdlqvgagfhhfcebrbcsjdvjitlzjczkbudavwxfekjmqwvbtijpqwncsulqfuoxvtnyjfcbpswrfxkvdqkywwipubtjzcktqfmkswijjbuirzrwhhmfklhwhyflwuxtwddlwhmpxsgvuwspliodqlnoojgqgqhtczgabuilsdfptquhwpmgiaylaixnqzlqyrbqdtwjfhcfxpfdjuihpseszzmilumjdhejklrwpuvfmecppzdheygfpyffnvepgzkcdukmyffdxfhuaeflncuvfanbrztbhlnrzaqeewkusbkaijkwdqgparodcefxrdvenjiqcykukzuhkufwbubvqqyupqhorrzcjhyfphwqmthfxlsqvarxauytanxojdcsfqoidjiluhlosuwhgmgidjkuxjxotkuykewmbqiuxknlnercvolyxnlivzawzchkfhbgcwnoaljjgxpxslrqbdvizbkvhsapbbkdycjuzqbpzptougkzuwugysowppnfwfzwkiidkggbownxopgkwqxyoyvvntqllholmxjbojikdqxmoxnegaandeavfudctzaxtlgzqhijibscqyreqexqhgnmtjzvovjkuxqmpyojvrvzlufdtivfwwqtzqfpwdrefdpbkqgxqzaymluagemgoplixezleruabjhthffmorxbsaubfgaoroqglvdcvrprfuxvgxxtgxmaabrnjwonbbnaiubkhgvbjefuyxfadzxfinjdknesmnibvbsmauyodgfpqxpyprhsgsnivtvyfkmiywcyksurhempacbycnjmlvwxzpdopculalzbpcbojhpgdfevbpdywairjawvzrozchmpcxcknpsnggyupjdflnvhrovxrnkaegqesekmjcnrlpbsdwxnxabrllattoljjbdhfthlzsavtfiovuuhnbdulnkhgexmppdsdpbitjlsfrbkdcfgzhqkvqfiffcotcdksgeodapdnpenpnuzhchijxnwsirwkcfhtolybbzzuoetpvjhwmcsqadumhwzutbickyaltpwbaxitkcwranuldzxgzvagvxfhuhromtzcvgznjjfvcqkzvrnvxhjpeympornrthnzttdlxdmrgjrsosvxmalfuzdxssadoijngszjerahqfxyonpibdlrusctaztcrrmvamaohvttlswmlfwncayhcdqbtahiayxsljonybsenwchkiurghxscmbmfhckatrgwklxxqqzqtiwjcmnuvhpieiqhlajtyqrffhmmiihfmhnujpxsefyutxrzmcdqyvltqfyrxheyiecgvyshqkuydnrkxgfuvgalcpwkovmfjcrjfisjyjtkhuxuifulnuqltlxrrljqjbabbamuziypseapzcirxvvhlvyzffxxenxwpfnckwariaqxjseamitcveheovaebjoqhzjcvicrjgdnqgtmsmqhjagbccvdevhgcppmsjccgrftczjwfjcangxfavfxpmkrcgbrrcyenznqaoxbgwxygekoiyrihjqnthkcqqyjablfzrixjntlnbxaaplonnyjytdzsownnjzaejmfsbnvgasepxsjnjjrsjwjbkuazzgbwdkzhumknuvjymaljsfjdogxhlprljpuwmgbtlw\ncwqpllhocvhdlqeckciutruvrrubsvkbhlwvmovakqvnvayvvaeljggzmpgbgdxfguoxhdvvtkbvlcxqvanebhjzsrrqdodlzpvdkpfytepvrwqibhijcqirvopkdujdvdzxgbhfzjqevzdjuspwummurbmgdsfsvfwvgtapqmuwcqcdrwihpdbqgspdimcroynpklrpwqpljzwkfchkarchxqjdnezqafdsogorpmuxkecmbmtlakergwkeupgzxnsuyksrpqosfofjsbuvhurkbhfwdigriffqfakqxbxucbwbascajsoklsbnboszyyhvmvihnvlpoclupomzbaoydukieaivcdfjsankjcpykaavmgxxlzxcjkhkmkeumoreiuhoozpmlkaqxbfyfymbtknjksjaqazuplllglltwjmdaalohndiazugwoyrgcwdeogzaifaswwswpcomilxiegxthkfirrssfekpagruepffdeqhrzyxyayxhuksmloudgyewpyvimiwoxvcmpccsxviuoqgnepyoobniyvokxdnusvnqqqrpimtwwxyfrmyffqinsfhvlzmauzeeoymudaktnyqaphldqbjhqyolvdyjgvukmpeumncuqzsvcivdqtkqcnmwfpldhbfbndtypijzbzyomzwsxvdupvnqlyyurttptcagfivhrfomidtwrxmtleztkkpvagrgbahjqrdppvtizcoskrxixldixdwmdweewrucgnfijbkdpryswbiyqpvtvzsyhwcrbniouqnjwinshmfgxbsuebuualnqyhlciiliyuuzzbmfoqdjlekuiswdlfbvlnxvjdjhvjcngceffhfyeypdpyxfnsoixgrhxoluujhqgcvqsnvfcefybqedqrhgiwqzxqxnhvg\nobnwpsxaakgeqancpsjmppfjlannlzdkcriwbyacnjlqvgabsfqgbtbfgoazhnpscolnpordldkenoqqyaavwgnrjomaanayfyfwuuzwlcjhfabtwlxxlhunwuipargjstswchvjihjxecbzkiqxripuomxpvjmagvcbwhqacgxjwevqgfwhohdzmtytodurbjztwbneiapjhitzbxnnkmyisjldkkwqfdikvjpqywbiqnknderdytsqcaiueghgaozpempipyljotmfcumelcfxtuzoaiyhktcgziniglvsxpjsilnwaxynurbaetscdsqftmplnggnssomwneqgvweshbuwbmyfdisegrflujnwwtmaavfpmjqayylwqboqrkavlctzckqjjdyxwbbjtxkewauerqrexiltfhulidrwysbertmbzccapsnhjaexlncerxfgdhradwvqkthiwvfvsqlwqawlmbtfirnbngftfstxdlfichespakshitqomflnozocgcwkwidmvochzffthrnkoinvktopngdwmzfhyvmvdskrcqhzpgmdgcpbeohyxufrsvrybfgsdetplblyekheniwazjrnhevtabdpkwztluwvtuhzaynpmpwcbvagnjcgztlgillcxlppxasmopnilijzsbvtbussxawbtvksrclrycrkzgxtawwkkfaewcnndlorflkpdkvxoakzhdaljalfguwtiepmzfguggwiouippnfcmdmixxiuqbggpdbpxrjrgdrffaapjjbrkycncnipmhufmhjgqeibwvilqfvddexfohbjmrqqrflgtvztqlxibpzofxyzcscmzyfeqmcpawlxjdtkkigoyaetpmyaczprmavobnpchbnlqhemigmlkmeswtpwdikkcckunraduhwossuusdkpbguycxqahlnugkwrqsfwclowsfritqxbzfhvefuvhkrnppcnkvcalnehakdnjtrzqafcuqlpmvfyortbywyffcvtgtzvgejzfiejqgmixbdpktzdlyqdwztchbuslzkftquixrehfxgulpmdyzvkxnteixlgotaxszxffwbabuxbtcvnaucyrpcemvmdvyblyrfynfysazmqdljxjkrzgtokqenbzmurqdzcbjypdauqxhrjrcgcuoecvhvqwlspibwcxvdmpdwwthtdkjmrfyiegfhfzkehivvwccltyvwcknqyqpqxeavkqdfqkoobakmdsbrooketekhwqhaheesskxgvnyiqfrozxiixvjrngcsonhtlbntkwzzynnimmksmwopfyvusmfqveikndgtsgusfstmrxtyqatqawlaiyornhyrtuyczcgmiuicpwlydukjbrkmzpya\nwzrfwgrntuylexoyhkdxzzkfdmsglogmuzbmomfrqvszdgibzrw\nqzwsmgezqrnxprftxrgmaonfjcolnqnbubjkbydbhzdsjtoqrhpksmkfoqveqf\nmovddpikzmajddnnikodvhojygtojnmztnyujrpfvvbuonquprpgmktuibsiqxthqjupousdbnczvsunpylzysvcpqmxjppopwggcbqrzdkhgyavkpqbrmlazuepmqlxiwmfshsltjughvnlchqkmwezrtexzlichqzgahckyhzgecagsqmojatalnhciqkqlfuykcubndwgzroywkswmxxhklsjolkqcteacndkudzxwjztxcdbjfleqtsrzzbynegbsxpkyrpwoaancrzgmcwoyzgeosubsubdkhnhxpavlyiihnioztumowrgioclmqeeurwudlsuvuccccjzookcoekmjwxacqtjhftccxixkuarpqrlsmuzflxdtckqyibpjaxzyjdakuexklgzrniwkyrvmjzufdtslnokbaorllqawgymwdlplcggolhkzvwribnrwlqotfuxagsiwdqsduijqoeaapvzoucfhcxtngrdsjumhxcuidmgorzfrutyzgzrbjlqfvthfrnzjbmqlgvt\nojggnnlbpdllvaazsbxffqtruknaolafrejlwbdolbgrmjifgnaqpwzghwytomijzbfudqoxmevjkajjvbcklcwkrsvifvetmqrhkplcejoithntpoftelgufhkcpucoicbtkryfrygjcsabtlhgyotgoqijwgjkilszqzgudbyiehhptczrqlospcutopwkwqfxdsufvxkqtdfzxffvabqqjwdxqjdwfugghbkiqcdjtiwculjnufeohuxphovvjgdcfzztlnnncbferoctfinwbamlzsmlchpnpdao\nxvuvvrjjftrxpvdfhmniudunshnrpjbtpsmnowvvbavohmnxnvjkjhgiwgcgkopfuufsipamdqhjzlxwvxrymavczvwotxqrgmfctdafwyqgszwvytxyxpnlecefduvqoiadhifvtqtvgkslbisqzrgtmtuhnzbuoffrbnilhegxydjdrjcdzwjvkpznmqcdcqwrhvptmhysabtmlwjgsgqhlzywlzcrrdvewqkbnszlsgsvqydjnmjbojbamaowghcskuhxngvgxtddsfqsazyqqeobajcocznvyiwkdqgfyxjjyvkuoapdvfbugonbgdiwglpzgiqxxkarhohnpcazkospbjlzwihhcgsihcsavajnmllfydjagcmujzxaydrohgzzxvshmcooworgvzowcvreqvlpdesajfwehyjyvdnuqbzllzkjhkprmlbtpkirzrcyopgncmqbxbutdqbniomprafxrujavvbtijxtwqdwjjnehyycivwjcjohiybzowavcrgmwpjhvtkwneogwszvpskdremehyutztbgvpshjcdrkpennuzplqiwtncsnawigmoqwrfwinhocdftjnqahpbfeqrllxvaktmevkxcgwrhmxpghfsfmgrxjdxzqfplwsoqpeiwfihyvkjcwkhulcekidvztcbxpswhcgwmtbgemsibthcrrlogbhbqwhzgtolucjhqnsiymmeahmbhrwvpxiwvqimojwxbetpdvazkqkiapfombqfbhgpextahkgoefpvezzhsbnavcvdwkzqasvltfgsrzrqfhmxgnuyniwizknclsqjobmvubunsfsbeqemokrqfjdkrghqqvlufoyjvmxdmhasgvrcvihsydthtkbwbsfvttiexccdckfjigeswdvsgrsrfmoayibevvapmheffghveeysuvipusxftfbnrnnzycxuuoygvkyhmjwsiryyklhzosxdwncojjicljyucicjnrptultnwrtmvutwijyrelvnexaynbnnfxzhcybyuzxaqszuclahbhejvduzenfriishkscnyjjdbkxnpelizughiaqyzlefhotytwymlueailqttiejnaelihggfyukjftkplpeuqxkiqvjmfzlwyvcyrmpcemlzcqkmsrpskxxehhpvzgwisjckrouqyzqdzvnouqkpguujsqqiqvapmiyivcqgwakjrfalitzzkrxsgkjdfqvjlistarpoprzjbgqcpvfbkdeqqzertppsolwnegmtnbltsxbebeayrgrgktpiubpekjcotchrpgwljpqyrzzlvaqzyorpthpbkiueadusckaphyfysvmaagbehwbwygxrimpcotqvtrqfrcuopyurkfcnzbnbpwnawnupdntifmythcvdhjhwcubwtjajuor\nrijxhesaazpkqjgtjwubdxbagxualojnxgvurqnbpiybjqdmyqpwscgtrolsdqbdfekazirlwkddrrafaslhylrjltxcycjzgcyuefsvlaucjpxisyrlvaxdokqlcjrfdixdljkthszmkfgumnonvzmplzerpjogxxtnndftvjyyzhszrorfneonolhuqgqxmcfkzyxndmkfyizpdxyvtpageptqajcvzizccuxspzdgmchnxloymoflnbrtkvxwkvcovwdhgkmuneqlirrcjcjagszkjibettfswvqufknachwzoltzdwtdadcsjbopruya\ndsjgmfjhbfiizgixxvwrhrvyzrlrgfdgeqhwheidhvjgootundwwsojvagsmponxnyizcignnpnvjtubmldfstaiewwrpfhevwqhdynhavkvrlwylxdxylnusbbwgylqbfcskuzapjqvaadkfnrqjcdkzylxshhawlkbgtgieflqcbuwdcnzgfmhyhhhkzyzwrqigzpqkbxadmxrimothqqaqoeadcisdzrmcpoauflwkmeauumzdstxzjpxiqijyccrvxhxyzbqfqmatpjgcfsnlxstdzmtsikocblwnxptwaliolarzdhqhqfnabefbjpsxhrkcqpdrwkgcgdzzmmrirrkwejielhyzjpwzgcfrnfjjepsyfwmevjecgbnymepbmjyvqwswsklhjszngkeakmuzwknxdiwdoahgplnonqizawvcuecloakxcnns\nogiuqczfjdvxztrlmtmlywrdhl\nnlzdqolicduhwenawzbbmggiaadjprpsoxwhvqgiptporxqwqfkdikhupazskypphqlheqdhtfnddvgkvbmivtdzsaxkgygvuzjxhrmtqqmscxiahhaheleikytagzeicxlgiokdriwsrhvmwuukkmbpiaaxijmomdsvnxufefueolcplgxcxnihoalpekoxqgtchiewelkmnaosiifkstlftixosfbgdwtfkruvhvnbesazayscxazvdxfjondoxrrkprbzerbixrzfyqqhbaxzasltoblmcnvcrcrcrzkbykbnalrzmvfogfcjybyggfyfmwbcagliphlrivylkhnrjwiyvtlovflfwoanrrbrjrngcpeqjykpnqmcjozlpvdsfzvleygdewazqvgmxqyvexwrxxmmixxfrxrwylggtqccvdckmzaxulliivjusvjkhyphbjykrmucmchxgbfbklkemuapmotriuyroiqggclenyelqawoszvffiajwfecyxmfdihvaupwjzcgijqzjbfahpvmgbimyjqddnqjgtxkujgdsvyocwmvwfcpmksgsarbmscaherrwxsrcepykqzrroclmqdnassquyeldmcozybjmouaokatakpvkgwbedwdqhbktrgammnmkgtumaitrxwcmgmsyzivmxsvzhsyzbduwslfzyaiwfncvgspflhjnstylqzglmfrqqmgmvhlpphevtgphucbxjnaxkdouxwyzsaxxlidkqofghfdjkbxtrvyhsanpyxyhlcmxgcixvvgblbtcbfgtfkixefkieevcapsovguwandtbbzegqtzedcassnfxnaapjgofwennprnfdtxtyubbxqemufzdjaxujdxfzphpqqqegdxmecjzblefwdbrynrpvjgpurgfsysidvcathmvxxzrjpxkjmknztljuxdeklplwythfwiqmgfsmzesbyh\nigthygbwygoignxhrmkeozmwsiwhflhqpaldvgwxbphjlrgttpihixabshhramidtkpmooartszokctzkyvysejgbrjudxppxwaadjigdutklrymkitfpkscxlazdhedxfpnbjuwqcxunkdmsumeqskofjubdlzwdmhdvdddomfclouhfuvuxktuonngfpadqvvdiitjaoisgcdyimabdoaojarwmauqyspynopwshegniojkjubcgrnzpkznwnnuioatnxlzpiouzqjholpbpqbptlkfeapndiptwrlzkcsqphmsfyiyxhqiwmkftwaypdrgqjhjazobjiizndyqtoldcxreprsegxilmqxckvzmusoizypwucoqzarfziqfhmjgcudhpugzsdccddnchrgmxdquwmqepaleekurdhwjcvkaeysqegfrcmlsmoedqzgyofxeukzfbdglzcvvugnljzffyjxlsdgfvpxfgmetpcxycjllunjvhndyttwojxqkdgoempxgfuajulevmdlmzobfrdpflpcamw\nyekwcwwdoxhaywejyjgrurnyjgpaosbxrkdikcosgmrcfzqawqrdrmrhvknxqglbaxcpyxwsbqeijwyxgipxlsnzilzjdggogsddxoqxmttixvyvpjsiqvtimrnjlsjelxmsesutwcwvarzszbsccmxmkctlsgytgpqpsyklnxuzrbzmrpfjhcpgngetffvbfminwyslvxzbmcvlmxobkkrsanvyzwkbvtsgsblthridmuzpmppdamslcwiccqvislfahorybydfthztnixaukkdkiiiwtkbtcddvntyiqnglagvwbjyjsywxwxqqrxsjlwgwpuvbvpekcolvstnpqbbawbyurpzfjayhuyawfqtmqotraxtkwlumqmtboulugfdnprmpkxksctunyolnkmqvhvxqyjjgtkvlhkveouljgzicucfakvneeqaaizymxbuqicfvammgahxpzwzqarvosuwmrswaqbomshbtnnilkgbnlywodcjmpgehnwthdxknqutgmknbkvafrxrrontlpkxwntzhgjtiljxvhjqtutdogjcgmghcemtxohqlyetxiebqkdlicazkagbyjrkqawcxglyosdixinijynsfezxiiktnnsyfrieqgrnouxtbpevdavabhejhgraqtzxkfowuffjovboexlwdlmjryxnaxygvsaodkyhwjckizrvbvijhiuevuhqoaflqfmmeulnhcrdlrqpicswddcrsprcsuhcywjfcmzwbbtplswowzxcukgshtabrnpmcyyberegghxvzmndreanwqxcdlpsivbrbayuuwgulljdaovinjszoqgxhaslqulbqklowxjiefxrrzwjtizlpqcbmjnnzwpwhjnprqjuqzjgzambypbjyvgdfmziipxblnmbfqsfvfuxgbjgfcpmmbwryzuqwvestoizdumsfdyjnsywxksnozrtggwoaayhutkgxymxuznueknyykkbdsbibvnmtkatewonrtqsildamutiibsylgzusehkpwqsttkyzsswuxmfxgzeffeglunwzpkvxhvzfoserdgpznvzkfbvixmlmzhegciyzvrtaobjuhqdzdasgspifhcdzkdizjgwinprlogjxtiejriwxdbpuwigbziblfonsmntsmajpvylxvfxqhrerjooxssfepsfaaudmfcfewrybywhjfwdmqaesovreqsedcslmqwhfdhnqprrfjkwawclvwmnmaymagohjziffyxhxmmymnbxr\nhjngjvepaoanmvspnwfizbuqfhbedqqcdsqtpmjsyapmsniqxlufodykbmjtatcmejlaxcgwoucdszuvgkkcqljuuprliuzfwaftytlmeamdqhjrgtsoyexffngbjpjerrtjzonapdmlwycopkyjaehzvnmtrfegjfcnsnuyjnflottliyhwdjmpomirmtwhyeuhiojewkwuzbjzgvbdxmzsgaycjdyqnqfkjmsagrgfnivulldxntvmlvdvaxguqqegbcyexlsaukqyslyhdyayfpnkrerjruliwuisgwdzsmdczkorxmgxacfcakvhepnhgwbwmmjvfiqhiocwfdslywikdfextzjrpwwubyjxnsuozhapfsytkvmysxzuwgwfjyklecascnjqyiragftvqrmztfvhltdjwuuiditomaonjppqhqmakaakxscrecdiuowssjpzcbxrpsnokmuhwrlvsikqhckfmbltfnttispvyluomzkysrnwtvsudhjncwuviyipxhzcjvxwdlukkbheyhagcxysqselzvproctepphrxhbxwlsachzxmjsagtaqugddxqyysrfcqatqxjxlkekprvlzmfzhyektgs\nlcfgcwyvmhyxswacpfdabcrgazxhuwswnljcurthqbfivhjqskjawyqyvapjayyazjuscwxuacppm\nvngumvpbpicqrjpshtqfvzwdqdmgwskejmrodandusjdxydrrcynswlnnckjoyozffkewtngxrkrxgthkkwwpkqbbwwxvdaknjxetvvicanxeakqxuscgslrariyzwnbymewwmbjxckeywpecthuzflrsmxhsuucycdcmvehimtcpzgxxmwybdfpvjaouznvyaluozlqjazsulpnjhndjhtbczonjkfrqzikwvnywplmmdprilrhjckwcvnrhhxcqxxuwwqjnnyafgvhzzafllaudsgnddbvlwbqgufcwfcctvfykibnodsrhnbcuwtsprfdxevdvtlivvkppptyiftosggtvbmajmxfdmwqewsatkjidrqyfyvfpergilbvxuziquzpodabtnkbqddpibhikzvnjrhjhgbivpwssltjrnemtpjhjrondmoovqrquvnzjuxpmtetglidssksfqwtjnuyrcrxugljohdgktqmgbwrronewbtqkfkfsqdqbopouaiwvmkwvhvlzhthahfcpfjpicqskgppyuurxauvyfonsiisuxzqlvdgvpraeorkqozfuzehinlekibfmidcpzdyxluomrmroqiqucpkdumiycvusxtqpomwqtoesfxxwryaocatpemfclcdpniqxyohgqewuqpvjugvzwojjyubohmezypgdifbjsgkuoummsalpfvmxantzcmfedadlpgtzcjbkdwlfaaokvibjokrpcjuvqtqrketseccfocmmyveeeagamniniadloplnakxjhbndsntdamqkobzyaaupnrtyxrdygnphfffowbzpjfmkkdyphambwguqvgindpxpzuaqaveqpvqmclbmgqigmlhpsbomoyevwfuofkruxnyniirjmacibadjpirnbzaxrrzkggfisdiqwqwvbzjvrlpuyxnrvrcwloteoazcpgmhtmpygssipgaawjwypnjntfutsvyddjyunrrkyrbgjluuyxfuatzflyfkpryujalitswcwkxdoieriuecfpnccmyfgjgsowrftjqaruunxyjgwmwwpsmismaorogrgjilcwjeximkjyjjrrqmthrlbackxudvuokepstjfhlydrpukhkdpzdbmvajdtzyugvfhcnfxwbyrdzurwmtsisewycfmqxguvxxbpfawpsjekxaksszdbryrtltxmobcwmaszmnmkczwffsmvkrxjunvtohzoyvizcsfhgpqyvgmpoypljznqprrhhdtnqhrvpxwpuwfkfrihsuqgjoummbxdbcgraucbmoaimsodnsnjygufgepqpwwegkhsgagalxufgwqrxjexqvajkhfjgrtsojihzlxqyapavipshvuljkzrxmzufgzkriyvxwcrzgiozicgtcqqbtlvblhmkhfffmsgijsuyiwftstnnesaootfgywxwbitmdpbeyosbuegonkxyehhdllokwxbjdjvaxaftczmsuxqyvittjmjdfafdcxtrsaxuyaeydwccbwziowkacajmueprmdycmkgobuzfjajlrlkxxkfsatvnukspswmabzjdqesbflixwlcqziwvchdsynkhdncjvbkkzbeihibigdvyynmpnehzlfbjruwlgbarhcclceiemkydadrqikskfztdmepvmuskmqqkwoqvlhmgmlpuikjxypqlklcrvvsxvkxrpbsbzellwbaxtoimjkdyihdxhjrgvvavyujwmkicglzdxrspuqlhjnfemuuajmvoxsjyavbgzmozeq\nwlqzoayvufrrdzwutgbgykafqtnxtbimlulxqswmtnnrvuydsuwwshnrfagdovulnwoclgbyllrrinkyqoligjptorrjlehtc\nkqnrsvvhurmmpnzwrmaurkrkztjoihsgyeuujyrxzhjhyihgiwgcceiwympvgspajdigpodspgvbypiohashjmobnzlyayhuldzbtdiwxvgqeemwlvgkinrlpuujushfjzwjeagxasaqetoloffimzplnudeffgachzrhizmaqeswsuqnizzdfivitaqyxubxqbtxtvacgqjtvxhe\nqbrosfwiociaemvxdffmcbjzjvdfnwygcrbyzcuinsoretzalydelnedsknhpbtxrtmwhkczzykvaecqrwyrhmueewkohdkzhnapvvzoqlbpcimqaiqcsaydwjbafbqxeuxfpavpwplgyuoireiqbizvcujplzsmoskldgftigpqwaabeouhodvzfotkyrtuffmrjdifognrjkocalwjhdfzblxyydvuigfatjninyyqpfnlzpspawmspzoriyvchiyfvjlquljujtskdljgtfdxzegwlandwhoizlwnnhizwuzawjtlzgzamjwgpdbebvuwjnvposaqadmqwxhsmbhfutadmaepyyrnztguzutobuozvgapjnyjmhzaaqvvumbwqwrwyqwvvadszoucnqjxuommdhxvmqaqmqrlmelamtqxqnnymunsplzjclbrsvxrhfpvhaxentcgbdbdlcyyllfaqnrlzlomfonmihlfgtaoansfrfrnvvkobplodacoyclrzcgxutpecqfuvljzdadjsxhmivkbxpqfvvznnrcokmpdcgvmnmkitjgnaqtgzjokkkfnmicvsvjyeemqrvmjwcaxhfuoqhwtzabdnoakunjrenpbziemvvnjndozrxkxifhxjrotzvuuiyjfkvxjwhdrukwhursiqpikuynrzuzukqemxuwfchcslbmntordzqbmlqrztoneofxbuwpupclxikxumgykwtbesxkvpbflmhtzyljicvmkmhudtxfyxprholdjupdjyhtlfgeiclwumlabksmownwvhqrmefuogveddrtztzumuiioltyszgtrtsazhvinubdrmowtxhrkiwlobhtxituoonplzrddvmjckkqzqfubfqekciuybpuqefeijckopmtjqbickmaameizjiqrmvzadvlhnxydircnwlmcytsdrwfbtcizcibpnyddwssrgamwlptedbnjtbqnoafjbixtdntmktzuvykekrl\nnupxutjmiscrndidhauxoenlnzjdhvbxxurrsrcmqjklgobmlxnietgfmtitcubuhdzpnngsnxliqchkntgsqknilggmzxwvntladditzqivtueznxpydxqnsiekwcdrnyidcqojzhefxgayrytaeyqrjuvvwnlpjuzrywvojlwicivspfkordsuhrlzuivxacemoalnbipohqwqlnlxtchegbbxcfjhsnxiqolnfssdsuiuevjtwwqgkcscvscdabvvzehlrrwaoggqkifycgbxzbfhjnwipekpklayndfdkepqtpoqvydycitqaahatbhknzpoyikmaffuviouteypjhfhmbwlektykwvhmerjyiaampmdwlxamxelzwammxfdiftkirgnnltsoaqzupoxqkbfluizxbkdoirybhkomamsxsludysqtgdedgjxruvasvylremmpcyuihzgmvqxroikdevlqmrszvsscpwjdtanmjjtheaygxhnqmgnzeylxofywzowcvfapzucltlzgjjlvppucelwyxwpnmvcsfewwafidzbywajyshmdnhrmozsyqivspjxdbsfwkqzfjssibwonwdpznhruouvmhrjvkdofhdtyplznfqgopquyfzdbncbmyaatfqnvygwflobrdirgqnzsicxpeqbvtcbwbfjuqfrxroienvawrknvpjtjrtagcgijuklyipddljrnglnvztfkwswwolpnkksmfrmukgjblzhlgwbscropurmvxgmdusodptpvjwtgddndbyqffxmhizzrqzrfwpvawrxwduuvmtixnmkahbezycgukatnsviqpjblwhaambvlkfipibbdeyekhsuqexnqtrwccykksubcexruojkkncdoyjjhgfnjbbuaqkytxchdpaxfibcxabpdmttanbpckwkuewpudnqhjoytbunwvinnbrhkciadgbxhdneyrsuwnflhbngfzlnrjfaoxgcosgqjy\nufauigzslutcdfmcoqozjajvzxkxysnkqezxbflakczrpbqnjayedsgmrimuywfxiupjgjltjylgoctmjqgayfidicexbbztlxawowxrwupmnxljtbsvpahaxawvnhsqsqxosczpfdtyvswwatzavmmoyislvexrmliobtxvykzmlnqllahexcnncokxrimbovvhvrkrbtveezoustfvambekskxjboutpcdtxyqjjasktswcnftvgqfpxhkqspyaprgwqxggairilxccxvkzbxaentapizroimfrprcfrszuuoblouiqeguqarxcmufkyzuhygadjradlrjsqgtlxpvovcupgsfqkcjzlykgujpzkiccfmhihbuflktvitmpdwvajrxqjwhbckjgeiynxhxigprilnoeetellbnpbrckwolworuxdvqhnkwxgybwflmfgqsfajuqksbhpnbnzqavgyawnhayiamghphzhmmcntezkmqkwkdnurgnjsrjjcfnkaplznowgndloliztbveuaoodtmeyjhtdctuuwqdzevxlffctpsdgxwzpeelhjejtglaobyjempykkxfnwlapuhjodnpttkmdfhfasfnqfipebrsncnwmvjvlqiffhhzdgjqbzgectwwbsbkldmticaiadpukpmdbdjwsksblepefqlmcdqwdjhcmhazwawyedervtmvrlxzzjwnfwstjzsegrkdaerzulkhpflksezeunamhdypbqspejzhcjxtbblrvakdsqdjtkjtsomlaxcetwsewrhzbmlnrbirdurdppcqqxtpyfxadctjqtlgjwxmkpwfncufcupspcfmsyhdxfwkvhfjabpjcqyvkmhykbnbhvsejmvyebsmjfabgmfpucsnyjqnydeyirvgbfyfwvzikwanvngdfyfttelcxyayvdbyhlkhwvvfhilgbxzebzvxrjhwbeokrnevwdlqsecivzoihqejunuiyzcmhjujjocggvihjhlsidewflxulphmmsgxalsqtunyrvxxacpijcvlfetcvtlcwevvwqvyuhniywwiphcafvtqavadjjskbjsmykbhylzfqygftcwtcdqcjgudwfzipnoouqkcniewgtaejdxnksieqzpfspnlnwlzjqfmlgenbtjsloimapihpfqulpvmkyfimqtapxldnhbxqhahjszzrriuelznggchjwypfgptqvuynlzxitrzsn\npudqgagldjueehlfuphqimupmqeqqaufakomyarcahqxkmuubjcbclcayfrjdvogxwgztravclcjlrtebmsqvntlivrapolplsbqaofzcmauqwohbznlqztiavapzkdlfwlvqlahthsufcpfjtpeoyujbqdjmlwkosookzappezzjqijguqlnrmlifxynqhmniusrpetyeznuemiebhlgqtvqiwctaelvmnvahcmxvwgstsdpxtimvwryjfgafcuzmehodzwyykbfzclyycmsjhznenbjkgxnwznhyrdekhlkjxneplolryccrvndtikihitkbafwhqmlebyelsdqdfatmyklfewbijosrclfgqccwujzyrlegydxgygchcdryccelrayrtgvmihhaewfbdrkwojppwozbhbbxnwahmujcnymwplikgfnbskfskzsromsdypqvvuyvwymlcmukgvwregiwketlppeirrwzghmktbanhfyvdzlecvdklcpsgyyxgxpwrhpihslnpcnymvgdetnntvpkgydkbykxmgihxgqwowqupnehwldfwmbipqbaonompbznnrkzgwuzjsphcnqdyrijjifwrzutycdmptbqlseyyfuoyndqvifrmgimordocaoghsbhdotqfjiazezgpyvfowbdtokoxlvthdzmkonvownvvyluihtcxqpihrdrunnlumjnwjldumlialavlbwqrvhxpfvzsjjmifuceikmhklicgatgnvadcunluubxbqubfhwvrtbuscdfeahswapjhyrucrihffwknxmnotufkeqnbnlwjmvfwczihoatsvhxhbrjbpxizpeunuqoxkkbnxbzmehakcxxzzbfwatptaxlouxshfpjfmejckkczvrvoucvwynszdxusyinaobbxopsdkfoeduhuklbqmfmpzbpkxscribpjszfllgqwfwylofoiadcjrcjbpkzpgyvbdgiidtyrqecdgtkyngkyshobtwfqrqvrncojfrwhtqslfnwdlyvcrjigswgqcxkcbfallxawdpooyftnmldhewfnzhkxzimqxnkagjcyiygyobdoedacegkqjmjunamhucmmnrglzjwxkrcjkbwwbwtzvsdxjpbwqqmdlnvhanqvszsycxzthdilosykcomielefjcfmgbodvjhoxsrphzaahakivmypdhdnpcsctzkdernnonxihhbubcjuxflntfweodqjaixbmbavbtvkxipeixkafbkvtqrwzqxwylzspbtzskawlyevvohgpfbpdhbnbmtidiifdjepeijjowgtxpmhgbtlwomajlspebwgirxpoxoxqfqsrzbfnjkfigknulrxvtvlukauandgwrhgofcijfhswtpsrrzndttaqntaisuokfbrvfpxpmfkjpdgjtohimetgccpdgpcdmnirgycywsnwojtjtjrviwidvxejnfhssjkmxsthifjcbprtjoihdanmgczjtqpchvlvcnddfwefqmvkcjgqzyceymtetuyswxvflhivmsjqbhwwhwpxztbolfapagyiejprzdbznvxzxgufspgkxeshtaatbqitmojupraiqedezplqnhxkptdmlckyamanwuzbqjlhzezwdcjseqfzvoyoezirdeoxiqwflxljkqpuyrvdchmswmutwxfqhxrpadwtqcotvxqzxrrblbwweaqwornertvgxbvwxisjwvoigfrtzsmunmjxmjmvgufzljkyzyowhhfrxrunzasvnhxglcjgulmgqesunoaoetewlcsqvbecrhgeggqkrydoarphpdegiinjlceneftcgwdodgtnlrovyvjkgqlkumzrwrexbvrbtueehizwaejaioisfxmvtqgapjyredy\nklpxfwzlalqfclqqwexmpcmcycfyguxcvnlzwsibchljwomfayogwpofftntisnmpzftaekcffsrbvxzkhfezrocjubinuinrbnpjdpdilrgoghjcioavjlltihsdecopkhokjzrlaljcrurgvnvevppzwfaaspwkxjdurirfkdxhkrnzdcthsmickcrpnbhrinwjyxmqhtpffiocgibhkpptkoohzsmkhkyouuddbfdninncesjkvqbiczoxdejgubzejzjhaagimlguwvgvrhdwweqnltdwjqspyucguadovclqmjvvubekzdezufugrzfcoatrsnpurodwhtmodgbyqkvnwufludnklpryowhxugerdpajmehzdwblprfuhefbqdtwppudmvxwntptsoeohzbtorwzygcvfjumagvdjhjjfawipkxjosbxwgzcyqnrmmbwxeeubcrtzwtayngocvzlvisefktsnsnvclwkncgfnfpwblzyzstnumkypqfxodoupgegnxrzxbvjswdghawchyhfjfzrpuvnehhrrovacloqgdhzbbqzhcuifvwaczwfemexiycxrqpwpwjffwxviigtqdbcbgvzfkuakxjwaogdifnmuboupxxgttdgotxzxfyzpdmyyparlxgitenwpktqovtzentrwhzvpbfzjxhhtbelogjyshxakugpnprqyzmntpjklrcgmicvfdnrjivoasbjfprrjwpdlpfkqgxqsdvycjjqsdqtruiqcrqbpphjfmjtsdvuhlgylfhdazxswkmgspqxukfrccbsmjlvppqdrnomztpzhwliocolsvahwzezgrzjtgyavbabfnjkbjxtrdhpbcnlnkshjskzybxejcqaqjowsvlfprwygvdvbfepnxsfsehegzbpeprwsyethbybfltncvlzrfsketvyeyaqjalzdbdrfwqeauzhzquejgolkmutjbyxjgectexsxrjqnusrvomxxcryeizvdcikrprlgvyxllaqidizimyokgaocwvwajro\ncjoibxgrjvmagpdnofgrswgyqnmxbqknavupkbopptfiswwqdvkykoqhiqygtnrvhoajbcdinksweulbznkovektaloovhtbhpfpkweckyjjhdeyohdhfdqfpqagbsctupptdaiqosuxqnepdtpnvxmqzorsqidpshwtdfmvtrsoczavcwtwdcfkyrwawprdpvajshgzuxuiaxucflgafxqvnvxudbtztqploegyrlbfvafnrwaxatgvbvxcgtxquijschwordgvtvpyehwlyfkiesvdegfgwfzfpighsxjvkvdakryfbmghysduojhhdwuabkwawymrdrcvewvhwisbpgvbmotvwcluoahtgpsiwgizupagtxaaiysjmozqmxavybqfmncpbzonnnbxaevlglngwajtlwgjdumcwnkglyfoplnowlaownjmidvtjbdaexxvvjtdcgbokchbmjgrxtzdsyvuvxlqmtfoxnghnjzwjlpiyjlwfkvhwvahrgqtrsxskizjkhhmurslieptsxbruufqjvtvjryjhavljnikwmxjebrtqfmfikjppjorpmveugmwhwjevdkqsekihgxgovicykdzhamxalpeaycmjkweimidajubwqkfzqrfpqnllsvzfngundffgigjwwsewmmewmhzyzgujemfaebaxtefyjlourunbsxprkbrcmdmjdjifbsyjfgambsuklgwqjgjknonxhilrkjwllctadxkgqppexhlzydiycxnafrvatyhsqcbitsttwizluczuhwhmkyeevemedkzwsgungbdgjelrpxoypndwcvrgsdmbshttbuuoizpvuimaoznrugmkfvoropigfefidsfpevjgmlqtdmqbqpocwuiydfqphpcsnmfjpivcprsyddeekcydweruviomrejbsewqyuvrmtcqmblfhvjtlzjacyqowogzcpzqujzbjdwfhqrnaulyukmzxwyekpbmgweowktcwasvhtvwoudtqjqjuqqncahrqemyxkbjxdirukjsturtoloikeszrsmtknfdlkyfkqrvmoczhphwtpummcqqsjbkagsvnmomokrqwwoignlmokxsjxjwaqoaqregnvgabvfuurehxkjtqmwxgxfdqeabzcvxrecdugyjtxqqerbfkndvqqttvidczjmyirdwoswgkaakxltcpdoeudiaiurxizrbfuqcrnrdziqgqlcavofgppbqowwmoumvuknjvmpssdekqnczngyofcvzbjdkakuovqbbioomnpfsplljkmcifvuvyyygradizacyyfmjqjrxyllcrzjelwtkgaowaxboctwoeuftwwtblxqtnstxtebampfymxkyxiwewugrxnrsftibytfqicosvvcmrbyjjamnxxrtysgefuzevnbjvqvrwepkzwwlzhwtppqejfokqpwagyekwfqnwqgmxitoelimsrdeyvthfzqwqhdgmmvyhbkqrjdtnkizngybuzotxwxovlsdleurspckcspafiduxdzecwpkn\nqwyqczozsajykynwnoifbhiuivcfxafzpmqfbgbrlvkixyfitpbizfijemiemcmicruqkbdruyaoprzpzvyqfooulgxxxqxevivctjvcrswdsuxlzhbkydauqwdrkydaizlqwedyloygutuecpxg\nwbzkrnfnfffiilcrqcuoaojbimfqhtevbudjketcguzfjqropezaqxaheifmunfxdaxvszwhvtjyzhmrigtywtmiryhswdqzqqcbynafgfgalprihovvjrygpzblduetmfqwbvogclbndzvagrklevgevybxemlwakbokoxlhbqxdclpmyyhejbajphynuftbpkeletwvivotbjnqkrzuvonplfjfdwoovmyakhuwjvwmrvoooszfjkaskxnsoshtwiwvnefpxdwooccadansktcyleyeyfmsilcvahrzdaczvrfjcszovhyiyvxokdrjixgxygvuxgpexfxzjtxinzeagzmihujwpokpwjtwuenijouanppummpewspnvshibfuzzzilcxfjcaxazovizjilfqgvtyhvmbdtybaeoljbtxkqunoxvifpyehmjrkhhfvusfqogqpezterllmvjkrczfajhyiqanfktwmmhnqgxyeidwcewvkvxofwwptxmfuhszsdwpwfocculvvlucknmmcbvczsiviooogaogarovmoznbyucbzvtkfqqynnvheasuyijwgavtjcicruzqykrxybaotufmtvkpcezzczmocmvrlxcjnktjqbdsdeuelwkxnvibjqsjcrbplndvruqccwtgpofnaolxzrnqiwhvdkyqbvxhxmmuidmhjkrcezfnsalqczwejipfpgtvumabxxwaozmxdgxexpopleocrygyredgazjfbzbdqgnmfowakldkhpaterkxkcelrzfvecrkvoudmeovxdptppatrvyiiczjptmjjnimmigqcruqjmgwncyoqnkxbxqttuxkoleabheppuqdumhaflhjjobkgrirmlrkiyfssaoshozzyhytzbkokmbwdnmsizfenfalcalwcdgngneqctlglxtpdkqevnutfcodfgjjbyqhlhmkdafwesqocnozhucxtjmqpcnqnppovzwxymdafaleghvjlzdfbnaubnuavrrxohpuxijubngdgzyefiidbdwtiayvfoudwhfxarkanzfngeuolaivunrheaqrdnarbsvxeutczzwibowhgcxskfuuburuqlrbwkykgnwvlbngbcsnsxsevcgjznjcekyimqqkssilcumowzgzawyxiezqxofmxhkenaevgfqbefemjgbzyunxjilgjhoisqyqrfhxegixjjeqcesxcwsmtjioftwwteesjopergyakjxtlgdjjampeyqkctncrvirnwfuhdbexbznjxhzinjboqv\nuccwocbetqsqkkobkgexybtzbkuwuozkclgcwaqrmrgajlksqgveovdpzsolsjcoirgwmeateiwmugljdabecyuapglazrszcvdkelwocnoqepabkqfmfzrryvrprdedpydsfdchahnoiwarvlbyhtcssajiidrkjdajrvkygtkejittmirjehjgsckxlhqezybxqznqtqjevmwmwsxncwxzgkhtwwnthwruhbsudvvkyrhjhyjmlfrxqiwsxzudremwsmrruxoeifbxcgjintkthxrnnuagunrpnnnyvnlhavvtvzprsssbdiasqzqaqqdbqkwpyyvxryxbqoxyenmuuuaqspnzzoaqwtfvjhqeotzmwsbytnpwyorhmmdsimabarvwxahmhlukpzqltppmsxlbqrdpsgawmvofcgjhxirbjhtepodutwsftvyddtqvmvlknoqxopbtbehdcjjqrxrqbtelliscxaheqfjsecpkdykaopsaqtssqoaooyizpcvsvejjambepkbtzshebohmfvcdmsryyzvytfokqzvhkgiquheiiawgcbgogblfptdharvvkskfwhxnpofglgqkminclmpwerotjkakkqvkacqsyqxpntkupfdjroebvzfrkpmtfqxhcwuqrnkpwvzcvwiwihlfzkgfrwsyknaeyyxddjmwkoncviuxoouibqoafcadlpknhzzhjwjywvycpxcxwdfksmqrekjkujnopcxwzdojwmbuhbzkaumdbjqpudhwjxtrrssovoxhomddslzvainljgdpicntdpsbpbytrgzebuqryzwosqegzqafqvqepwnprqibemruutpapwqqcilugglcuvqsfxjfctkvbuwwrmtaykqlnhsglbtatswhjgdsckjwxokcqumvdmwqchdkcpshporvjtzobqqobjzemerppgsdkjlmrntojqrfsfvniydqcudargpkscpotjbuolhoidzeiworxcbahdcqvhebcwolfcmmapkcvfoanxbkqhxcxaweqplmyizipdcwqpztwiesaizaydxadytqnapckvispldiytibqdvclfdfzhqnvhzlkfannhaadjiciouesyaupffqydrpryglnlqcrtnkshgoezyzmcagznttxsopykfbqogisfnxwihnjjnuarcaircwgnygyafthubdfgofogcpnmdlfnnugdnlmczadtfwjwwigqlsgacnazeojbdchqikpqugyjpmveflxrhiaonqzvifwiaxjcobhledlnjgetigjvojvdgnrtxqvetzfimihwngwdqsy\nvoipnkjeojkmjfyzrgcrcegrcgkijftcuzexphktfwqxbdtuasbsuyupgdomjhyapbaqixlzgtvdcyltfpggpkrvpmkcqnblcoedptwseyzwvmvrnnmzxlbofdgrqrqcfapkyfhxzkspapplaifcijgltssndpskowvzglpwnlydttjqjfrtasfbghfvnjjnvtgoclrwfildfithhfvpakdfbszjylkeunzbizfkoerulcnjugvokywhpjymvefjhbyjzahnhnofibrbyhvjhcccwklkbnksvlsdvddchujtwftdemdjcznvatamrwee\nfntzirjivhnaxwcxbslybqbsxmtfetenrrogmxxyrmbvrhfwklaftsddipaohlekzpailbsqaowxdblelmudhdaptrclnzxhkntetanhfgorlanfnpoelznjbzouqgzkijndwbcjzsfjnacvackktmscubzlwesiqwqlwhgfuusvbardpwkbfxuauythhdhviudffgwokfiihvtqjuhyszhwymlfkpniplksqnwcojtkgqqsmagykhxffnytnctwzsmibefqougxqydsawngvyntfahwjxwvqdyknhfmbbzldwihbagastqvndltrnikttwirdjpbgjhtnpbpzgfhbylpgfizsbgzasvjilwncssckjnbhlpothajkigrusxeuyqxiyxxptpcwdoziqxfugnnfccfthuziavuhdbnhhyrhtasdfohobaxvgmfavjuczvlkpxmjvrhfevcyoykxrqftwtweddvlqjcujdgfgvewqwcqagwjuzoqyeynsxudffunvboeyrdxykmqccqxgymgvtxldvfaxnpnkbgykfeeuamlideasekbivuuimahqkxsgjzhmuvdpzdxeikwnwxrpsllyyzkwrsvrdtsgtadinpgbpcbdifkmummrwsjxvibuzoznunfcivuxrczwwwyilfxijgdnzjikzaaeywxqzhelvcttlcrtahrjkjapzjiknjduoljovgtulozwarcufqrzldsrzgdjjwtsklapusmdenxqyuqecmblegaqoxzzvzjafcyozxphbpaodtskcsfttsqfxslulxzqzgropbnpuct\nkcarqudwedtaefqtokxfpbdvkkkqbqmuqjbgcgtwhdzzicaerhinszbjtduwrddbhadszuvyvzakovninocvekgcjqiyhlxzzxouaopozvzxcicsgzfssuqkotelkcianklorfzhmwurfjxrqnsymlnscvckioszozsllcbuwgatefumgmflzbjesamgxqvkpyhhtxpiouxdxcarvlweqhhznffupscwojysdxmaufloiyzvxacdazzjoxgnuvmijncnbibqifzcmpuhrcqrfvtaqmbjikjdaakfkkuhedfjgptkivdzlpcfljsxjrncrcekzzlnjrpvjkuqirduxfntnanvzampczwfjprznbgucuaviusjmbukhcbfcqnvdviktiermaqhlvzvdgkpjrfqyxfuwccbeffrrzkwxgrscppwjudnccrkwsttbqzedcftroobxvqcclnzxrwuyauqagbazjtxtcmdsmsjejjicpzlajdwunohdylbtvtxzuwizcmzxoxweclugbseondmljcrisvroynpcqlvtzsctxgritrgeaagljomfmtiuekgsuvegdqomvvaaxpapgomrdnpqdflteuxssrbusyavjstunttulvzkjacfbxyuuebsklvytcdndlmohzesvhsdnzznxxcaicctprrbedmrecwhebzhwgrcxpzvxximropjvqschlfrxtxhczoxbrnyzrpbqvzhpnjjwuncionru\nugqqowcrjepqzobvylphbgmpjrfjseejrnbatvvfqkvkzxqjaueqaujgxxlywpjstvtduueufhnvqkfjulqrqifexlerylbnhuacylpxzchfgkohfvvuyxaeakdvvnnigfmxaeqjptyxgodgrkhpevcanlwapzhwbbbtrkhrbzqgzwztdamxlojavyaifjgmtminmvdosqffsbuvvupfdmbqhrzwdwyenvsaodkusfbigcfonqyhlqbyuubipromfevwpuoxofyagjgmuoqlmuvflfhxaiuvaakruvdnmuwlhgwufyjpfiflyomflkubycxbglxzbfvnvexyedwoplpckmsytcoabmiuyyyuyoonfwhqqwzmaddisosfjiouqtlqdxawfonpqbnvbdljlzestlkqjbjsygenejlnxgcxfdjcybiedazjutekvmyjjnqumepneijthhihdzhddcicewglaxpbnsxemvljxhqcboduxjcjususqbqtmgfurbsprcnaaehnqkehnqaixbxqxtcbewicnhwzrodwubwmsickbezqhghpoxghticusafjzalrgtjtsciywwpynvcktgezqjjxbaxpsirbdjhquxtkkjsseimatclogonfrqknltxyojeaiogeoxwbqqpvxxrmvpbgdguebkzbbgdmrfdgwpnlmqopwasrmmpgiruyqxqzvclccspdhyvkhfjntouknywohwjtbuwyneaqsiclesffsfbrrfbniqfkizhcwatikfkiwwumedjskitbnwrbwqegwdtduvxoodotwxlrmkjhwupefusmyzllrbtfllqodkvtqidqnsdhdlziifzqrkutrolsqeegxzvsmrofwgbavrcmonkuyznprslckhltssprhocndphqbcdejhkcrdsjsbvyakznflpomorspffyfyiecopfchxrcsvqhohwscdwcyphzufzhxmfsxqxafdineevhitteyhlqjvainylyqrzrtjatsewuyyxnkohbozzyrvpdrkejejppidtmesolwuqvvlkfextegnxpmmcsugtnkyoiwtghunnywssjcxbbcjwpzfxleajdildodpihizykpdpgaqanlnnvjaxhsrgevyttfetkwopithealeurrssoiueuvvynfsazpcxbulathtlbllhglzhedjntecbhrhantyehfnaxrfquodwdmcpfnwbudtzdmxwfymtpmikfyuyhpmbltisciqfpngnqmagxhfzfkbornkfttshfireclfzmjcgfkcjskqhqrckwuvijmbaixtelqmgvuewyjqvzmdsfehmofnlcsswyxcwlwxgnmedgtpazkuppnyhkxyqxyakajygfyqrhroxpdvjlkqxxbvwzzcmvmxmvkdhdctqesjbiwfutdgbwjoxqgbzzssokllhaxbbsepkjevwrusgrlnicuwonavimet\nsfumqunaadnvmzfmxixhfdjlgfgjoljlfbblpkvvhszrajjtvyixsvxevirglbbbsoupcfkntyzlqmifdkpyggtedvqdltvmalszgzmtumdlplituhjqiirfhcecjjjmleffjrpdrsonatllzbywahhfgjbljkxhlnrvgsnxhqscqedxdjylafalxrolsrlmprnfzsdkykqqbzecvqifccptswmhiiemlbyufeltczfbawgfgwfkimwngsptxxpvgwawcaoglvpqfwcsdyxrjnectujfjhgbrwghjnmdbqqfyiyzmldwjfneqnwzzsqedagyzeqoxwnngrepipldrtxmfvkglydijjeeczohmqfqofygmknmpmyqhucgrzvqpngtbngoluyurkoivldwzwogrlthpiclyqefmthvwqromhmygbhgmszbpndumprdajutwpuuscckxrymivbcldbxgbbrabcweduxhsbbexvbeprwutheyxjrimvtjpsvuzyzytnojiwfkvvprecmrhpdwcvopotcxreriaqaokbshwcfctwzppozgdrkfmejipfemnmyjbadydvaxmgfwwruzykittjngzxrzhlybtfgoccbpctyllqwoauwyhgegbyqghfiadwtaxfvvxdphqdpxcwnakyaivkjsqufcgsxptsqesgmdolcoiatummetzhwxhuviufibtomtuvmkwnriepwpuixirqyyivcrobuhdhlphnmpqhqnwndaldocjycevmbyfysvkcsfnupngicykkewspcgqhkunxygxgcvttzvtflovcwkmmamziwjpcwhdhxfrxvutbgywmankdimmpdljxjsdrsqtdznanfrwnaxnloxunutqivfmryokkmkowybyjytctxrhkvhksugmbztftuaqffjpvhzkxtlrvmtuvziskmypqviditwskiuimambsyvlcymsqoruzpqmalrmwvvfdlggmlxdokhkmmlqfxbnuwectnvpncmituemctnsyjmdgqvzsdzatvrhsqzqkzcsyunmsmlbovepimqiouwlvsbjatosdnynppmmvqlpxvcbxolttuahhykxdqoqeijlvvehjyqhdrfvvtawzwylpzywcjeetwejateuehgvtfgxgqlnowtjrjlnjqmngbkq\npbmkyopxwqypafwcysaybsepqdmvcrmdkffooobauzpglfnfvinvwglmyjxunchtyfqiiplunipqurctximmhysfiwrisrijvqevtcrpsbwbnorhkjugocnxegopyurvqvnuexbdnewgigapnhavjjahccxbwkecntelqdjizihbemgnktknwuvqhclmaajaoflwjsbvoqlerkcbskoypugureeymudukyxppzztufmbhntbnjdsowbooxpdpfzmbgfyayteoqmiukflhbajlxharzjllxdhzoxjjyrtknlkdqczfbolkezyqzimmnelrgjupeuchafcjqlftwrvthgaouuxglzvepoiqtjfzinogkvvxmbfnhcyrubocsuzelmtogsyqtevabisgeskbhraheradnoavubnfyyxnchxhtpkjkofqaaotcawfavstmjqufqoaoiemjrbafboojichrs\nquivyctebqwenatgsfenzvnxwxiyslrmktgbcgytstbjztltaghwwbydkhmfenznqqpcxwwrqadaivnxpvpopocfsvylhiqyqnqyekjovyzeqvwzikyhzyjldogksbgfqlcnsvdzyeonahylkcruvytqvycwzfphdzxmyuekwpajerrckbxhvokayemxntaeoqlzeyitmikthwhdtyiopjbbuumnuqgkpbjgicrkubnurlyopjmjrdvfskqckqihwvctxaxxexlgibovwzckefkgfyehykyzothiamwoglbwjttpnfzlfcjonnzqyvgafxrjjnsvxmzochrnkmykuxbvingteazpdayigrvjejykajapprerdhscscgeqioksbonxrtlgtfgbijkdijccmtpmlnlhylolfgjueptzjcufyzeksvsuvahimriaztmhdlsqjgmayaunyndddrxpislwezrzlhmpmnicznovbfwzpxtqaurdxifzokmydvgcbjzmsovowwcbalefdqazvavuavynvgabiirqzhmeqoboyowpqowofbktryxhorulsyuigxfraurgpvxihzvkcqrerjwduylpvqyxupfxbmebczasnxtbrpmgzmifqydsrzebvieremkydqva\nuxwmwuhndzvjmjsdjhqionbuexjzojeqjzzrsrzomzznurpsbhnihejeidlkdpqampgkstcxdhovscucdhjhlveoimolrblcbirmdidpuyknxkmdqfqngaknblghqjytsdfdgiddvofmeiskfbetalauoqmcuzbemnltzzekhmamemcdyjobbeosakadddiixxygqlkrxedsbnmzgegepveunlpivgnokxzlozbguyrbotmgdwqzannvikxchcqqodbispmuogefedaecaarpszkltmvitppcwbwsmnctyqtpdqsmdpxbukkwvfqjxuhggunzrqpccsncjsndpyqjvjgbawawgnqwudqmxeeswiwznhlcvlpfnoyxpdorkavwbmmxdmashhcpfskwymfpwbfwyhnhzvhicluhjumorbyxbdnfxraqutgyoyhnfhpqipzjfgnargvxxkuirnlzpfoybwdganqyvdovppossfyhsoqqgnfswhknhmhoxlumqwaukpbypmuuejyjpbnybzlvkmumihpmrkjhuclsxuatphximvmscqixotqlduihpbukpcjuwzxpfxmsxjtcjgfownqjqmhuatjxhwisjpfzqrzroxpxsndwzofcrxdqfgwpgrbibppzkzldjmkgdbqrtxzzebhjzaaxgryponibrsyhivdfcjikbotvfjfjwhsiagiinllypozcpgarghkgzafqtarhxkwyumjmabrbrwujuzxjfnzqjxasiaiciuihfmqfrqvwfwosatplyhjvfvifvbkulzxnihbfgtkeacqjvklmbrafrfmfopoctzxcxyfjxorklpjswotgtktkrrlhqvnhublggmnqrlgtknunkmfiohefitquomrvivinlgqgacchhzlghaqnrpmxkmeiaqyrntvrkvtqnshgzbttbpmbukizisxpnluqlwdseyapzwzlrtrsxrivceljprqrbfdanghlmmiqoaxbhoclumjbpsgxbibviqqirlgdubpfqeszikthipqacuergdtlrdqfqigbbrpeziyjwhzxmeuxlaujzfofahhfibobptfkhzylbqxaqrgicrzdxybgzuyqcpfmkpskpbimhjigcjdgnztugofpsavtsaqekttbcwzrysvjwqagkpjthqmyvugfeegvlajnovhzakakmolqgjhvuidtdctzfoqtcokvcevhwhmcyqzjwlhupzslkgrsjyhfvpusakuvswyejpaumexwurkejjkaziwflmjekjwpvxvazlqvvgpenonqejlhxzijlastetzwmkgdnswezxkhkxwrmvoeuuvcltbmbfihlycwwqrwaygifcgczxisixirpzgevzfuylgjifdgqugwwfyshzaxvsumdkffdwzcrgrdtwprdftbuvfzakpoxvqgdovetsrmwptwzmzwvbhnbgltdeuymopieymcitsymydumj\nvriklbwxycjindincdpxomahwoizadxgivshceudzuwsaaqfqyrwgdrppmvvmynjcwijiksockyufymhjciwefopxnheerxvorlwejnudicdvbmkslvmboaoshhzuxpbcytgdzditkarreogubypejkyeapgbmcfxxiixxyxbgqovpdwqstgikqsigpiqqfjawsqaprnjqarmuytcmfclmwdowezppjoxpmzpoapgnwhbhjsgcqyshogjyaargrabljclqungwteapqazmtybicmchmjhfwcgsnwjqxgczhwxkhpshmxtdryqzmnlojdjimuggjipbesovrmpejcrvgvhdwvaofinwqgehxsdqoitzqzfhdmtwzazrjrqnlcogqtthdbroildsshryycqzomerbkozhtjkcdmrxmezemtemevnirwqjpyswmdwzcdaokyjiigrmogvbyyygiwupinjjufihfihtdxsexaalqvthrvgwovldosgzopootghkkccjqjdifubkocwyyvolikoojcxmodunzypwnbyfqfytdyoluluxzcbigwhfrwdiidvvvlmwzegmoqhtjcqljihzglzybzihgwuzsfkmxmutyktpuazrdripuqbcvujwjmlklmwlooqgfwwpckrahhojrsdbkochqdxarxwlenwgezgrmdxxsnbywexrkofatyosugfagluawqlgerzkcevsfxxfysfbtklydqsbnoedooaejjdbigedbtddlaxklpmlgcfhfhpwtpbijzpbrqaltazdkvvpqbzxgclmsvzivntuhyvykyszsxmfkkcbphmodcmofyxuzyxqvztiwnaelbggsukpg\nhxcxalwxitsevbcejgfgwotiftzqffwlmcgqtwmvqsjphjrangkdabxdzmqqdvfkadwmhisjtbeppibxnvcfatnpcvkuogsynhneydnfrurclrhsedstebymksvncsfwowzqgpitqkuykczmiuzlaoojjqiwsdvcugdqemucxftcjnwlttuivhfhemqowwxpxgntuzmpfnbjybkkxgqszxquvgypnvbnpegezuotwtkcyyloetmskrmblibnmegwfpqlwfpofmptfbmryphhsmhyaggafyynwdulddoxcaktnowsnvvxvjjqpomewxgoiudtycucvcheqvnuyrbphldachddtwktqjzxxlsuwlpegvdfjrgmgqbgdowbanfoculokqtgdkhxmencexdowgerzhfiqesekypxsdcujpnuohutlblrirkjcsimpimaubaothqtavxzvuolmczhgsttrykivfijodyvluqldgeigvgrrfoulqayhlkjynzpexirqtmzfwqizvzlwylagnaiovsumpqigzdjemdgkimeiyqatzxdhldkkbgbhidjwxmqffcaoelajkcqvaafgqlxrzpcnjtzpkujntmatgmliubaqgjmarvrxadcazvijyhqmqehlpmiqyrbhyfmdafvyydymbijkdkbwutvihcvyqplbephmlmgwzlejutpgovbiwwncwrocvjveimvpxrqmcvbslnajtvhebxqunbmtwagoakzxrviubneldnvpbodrgfaqkxcvxpquekqwhtbwarmysrrayhamszbywobauvmfxcrwfxbiosdtkoclqzhuoaqwplqwxprniryhcmewtnnwhxnuikskrhualzbzosjrtftdicjizzxckbtuonsgwzkwptawpvovmprdbslsdcgyangthwsbynmovguzigbpasztvkbmxlfytcwazyupzgafddsvcqvlnfpazfrxgfknrjkbubkxnhkncbcxqklxrtedyyrzljotqxlxxsblowpfhuzdvjwjdmroymppjwpsebuomseelkhserijrkyrdbanfsbuawikqxpzfiqscyeedhvnoabmelqcdyrqdiivvmuwzdwsrtrbwlphxgmeatclnvvdhmjhhzrcunaswwcexmpgjjwarzkxhurqcdmbyxypslixfsqkbpxhzvllcdzeborjqjbznfrnelhnnuohdzyslraynpuxgsspihfqwmkkwgctjqksvgkixlmksjxujbpgekzxndjarezpolvblhmhdbptsciksyfnkkluvomwfavpowkuvxdjbsiewwezhqawnucfgwvfmfnbpgupujpielcicqeuywqvqqjvxxmhhbhbqingbyxpdqnfgibfdkosez\nrmhhporcofxzrajomvilsccfvobbbjjevzftxelvncmlofhiitrnriovshaavbnagxuzbjicgqhqeeytdjooanogrmezseuaemidtvenqvxvtqrzejxpdqpaidopzazixzputxylnmiscbmchjrlotywdmdlrqxnzomtrpztlfzzwzgkcwfmiimyiradgilsgjvwyjseeyysbrbbrtownjzdhqqqsowmwrxksswheeanhyefysfkujkweixwmmoazwjvssjmojcodouuydsxopyzhcgnttcerswetzytqvcmkvzzlnwdzvianltohtjwbdxwbcrdlfzmuaitumzjdlfwyrabxqsjtkfxuxdhsblvqjzpbkdqcbdackcwxhuouyjwdduhpfxbmqbvfbxoofttbbuvtjkrnppsjopouqnxanezwywyykjwxygfzazbmzezckvlltcdsrtcqkcjjtozafrdjktpzcucfwqimcfywafjkfdzzoiakrhvbcfpfrxnempsrxvboalningkflgojblgjgssiretvxyqwghiititholnbxxwobfxlwnxlsopgfewmfrypzwljzjxxmywvxykvqvmcwxxxgpxxysztpqftaudrmqftldiatxliplwuxalnfocvckuttowuonwplixkcsvfufgryytqjmaorqdvfkyiqoeboswtbbhbxpkctqwgnkrealqfbbbqnszjlpsdahggyabmxrahqpgbvsizfjmmjclgaadwhiituggpskijkmasplfsviodckdjtjczzpakcxrngxijovdsyuuqibnhtymwztyzzlpegnkyyfxbsjgxoqiqkamumudimrpqrtfpsszmmewicioeugrgzqiylgulcidjjqpwtfqntktzlzjxigehrwnxrzdlajfcrldjjthpjafapynghrixdxionbzocbghbbaqiezravjhcodfpneuomwzfdrsqvxcighsufpfltvbagsogkolegtzhlajplxpvzcgsemuioohathfxswczqdqvdrkziggwcfaejwmmtlbjqdowkrmterjfumflbuazkvhgcwwnmkorlydoisxhrwcibvnxfezzxurwjqwticsitqpxhnqgstydqxlxtxialmcktsrxylbcossdxpfrylruvdhmizeqinuxyanphmtoqjuhjlozkiazfztctzpersheezdruugbqtvxcplllylkwqtgugzmgyjwvntywbskfntvjgksoapgtxpqgiihdjwrsucmkgnqsumkrhovhteutqugbqytipwtivwfxtbeoeyslgprdxjuxzfhfbesgouxabtcbpjzhvizqcgeabpgwnkjprodsayfzedhjdjehekkkhxajgzeeumckkzepkbrjjyfajlazjaduofreukueyfpqbzxuvcekhvgrcbvvawvkscqwmkfmhzul\nlzhgiqlepifzxzabcwuleyqxuoziwfcztkssysmagitujrlnicfiazavydtzfhnacqgloowcnkiqbnjqqakzcxfgsyzfywzucexjrsuuqxmokvndoctlhaxjacgpalepwkgwadjqhpyseupxmqyhjxddqdfutuyishmxnfeciqbntoatpxqgvlrtmbv\nifqqjlovvmvbjfauvcqvlmhgzugvonyfxzfzhidpadzhwmqhuojjwewjhgtiktndaanmwjhpmfqvkdmwoispaqihjxtnigequreyeybnvepaztvaltchrpcifxxslmleomflxqrukwspuqaozdudxyxgulnopbxawhsorjgbthmgewkaugzpumgcqgqzyipfhtciuxetdlmtnwnxjzlhbaqhrktkwdfcxqorxrgotdsgdiscuqqdggtwadzkdqljqupsuzjqtqvrjvimgxxsdckppiwttegdcdwattlbzqxqkpmxehezemcodlckcukifajjemafvnlugazhhrcpjvcgtoxtvbwnvgtjhppgtfhsanafwdukmorcdqjfucwrutmfufcibfylikeyzjsudjoxihxdzkggyljevwcnnilvwxvjhhykimcuizrxoafzjtqtacazkabqedecpdvxzlcfmneatnuawfmouvvxivxvyxcmhpfxthkaqoqdiuretrgnrjacflbdgfqkmxnfaenctudkdrueugpqsbkthfivcrreafsslqtgsrwgeocwfiqrufoistgaedkmtpoetgmialsmydrlsdvumrjtaxuitlehcbzqvnhxkbbwrpcioghnnfxxzcyflowylmtvgftlcrbpmnyboezefelhjujacnrmndutgygzlbzbgsyvazmbxgevpmwogyhvacdhkrjgnmdfpltubhdxkhlcznfdlpflpttacyyqhacullmxduzzkmprpswqlpqkebueffsqdszarxyhagvsiwbmrdwkaanybqhtdezfaofbiybomuuskngmfslhhkdhkgmihueincpwkjipflltsrmobfyzoafldbhgsjkfmdixeeejnpsecnmkvaklwquubqics\nwwmdbcwhuicsokffihitaivsumpsgpostyzzszsxtopsaeddaekqfpmdoypbtpyalsedinwekhewnwvpxtkcghzgdzkxqgbcvwthaxekatkzwgzmcroysaznkiswldlvrlvindsiliwpweozvoveqwwccvxrrjxitsdoctymiqjimhceexhasefrwypnposjotitgvprppyezudloxpzrrkopesqevfgzpzyqerjupvylugkfszpsrioisfsnvvephmnyolomazydumwwrceajxokbgnhaqtjnakfvafsutshglayemjmshyrrsgjlbhbkdsnmmewrxbrkkzgiskleacweuphexxrqartsxhqiamegfyhwodgewfycmwoaincanmdzsfpeshlwuyieoxrnifkpagesdqchbzonczxgnuupfuabkwlfrezhizfsieaxdojvngvqjuomkfaqyldflvycosynztbhjmqxerpakfvfzqcjuagenmeoghqoburxetslrftpdrmemzrjaxdihjrhmmbzovcyoclfedmsqgrfnmxlpxttzpkolybyjjhnmtaqpslnitzpngulvqfsfzeabbzjugydeybtafadidtwidlvgkwivnigwyvyaukgxkvahcvjokzijrrmcghetvfwafgrxqmugpjfdldzkskglnmxxciqctwgjmbafagpilbwqgaemfchefpzvmgvqdkjzejnucklynzqbstlsoiramexadssuqawynlcaxciyrctfcxgrnydocnfwmbbjpxmrtmjinitrzwhofvefwxgtztlmdshpgbduxvkimlzfuyfwqwsdwoknsygesmcydrpquwhbjhxgjzofuvshmgfddsdaygizzyyozgndgfbjqsgpwvkuyuubipkojyihwdmacnvnevlrrebtzmbiqhsnggiexlauixzsfnabnzahgyawgpeahampphmigditypxtwlmrlarmrvfsrxkuxxjtvfeilmogoqwyhqtmvxtuvmokwrxhqfvjlktrldtnwwkvfsqibcmjxnzoqccncrwwdttdpbegvsydstignhzkjpjqfvcbwijmwlzdmcwpcnpysofkctlxfmyexfhtljpqylqnbmtovuugvpqlbqqiastpragvapcxdkuqfghxuirtctitfpnjuahzvpzbuhxvgcuexmdmjcktlzfyvxcsflpjuonzglxqhermqnauwhewaouishlhcvnnstkpdquonotmyggnuicawxslbwzukowaxldjqivrwbettmatqebbcbbyzlscujloarpqmzjwkrqxcwpowbnoqngwhnabasrrxkwcbsidopednzvwcqlxansnjcjxosxzsdzrfmmyaiopooljxyyijodydjucmyniuajznduwivwlojghpcivvrbpvdcksrbxmnrysbrjzzxbhdghmnjwqdfeojszwgbmlarchpubugchoskdjmmbllcllykvkiuesitpsxomuxfutkrawekmsqdqchqqislbwispzszfpfknmkrufzfshpfodtpuuwxgefzhoovmjnwogduynmdjlvspkvsghzkzhiyhfdnlswiuzpzchesryjomiyvgsqgjkrmkygezgtbvyohddkidwvosrcdseuqwjyizjcuktpmxzfjfjvoruohdrudmlmhfgiyqghqyjjveeuxdfwdtbbnfflrustsejhfbxhrdiggmwmzltgpbtbpkmqqajcxchkydxrvnmiahbhreaoskknymoyxkcjehxgpbprnhdeqsfzpkbxmuqqwetbipubpiaettoegchjblgghdkroictybbpojjmiqfffsqfmwmotntglbptqoqoazytbavhnqhmxsxvuwx\nsrnedurycdcudtexwgaycxjuzfsvhwxsolaxvrcfjsvomjfimrbdvpybkpjrxugxlfodrdsnmtxbjrzvxnriipdkjykgcamxttddjwupvedolhkdkagmkxyqvwocnkmvutmrdpcmemeqzpqdpkqdsjhyzuiyzykjkiwxsocsitjizwjsndbxjxrxlwiukkqfjypgjljsjcuztktobkefbzqevbvjbbusgttrccwvjpakjszwqxndgnmamqgwxhtrccccydlomzidsdgumcwcjvozhbmkdqkyglxmgaoafowzgjjbjpozfdusoedgjsnzawgfsixwrqsxhacxzoqsnjplatocpbknufvdbjchivvoykbtydivlankqypvvfbuzffxpsiascfzltdqskcldqmeaccyxyhngkhonimkbfiplagmqwbwlplcgpkepdhcskxfczghmlrftgksnlxhbbifjshsebmljkdhwpianpxjrtsyahodrsxqbvxbtytyjwpkmxhysbcgmokvpggrjifninvonjdpuifyvajoijsxtvrtqckurvpiqsnmqst\namluxsqpglrhdoljiplflyadiozosxinxmfkpavqilznenigkdrfqnfbwaegogzoezjjpggoxqjiyqjdjkkzbwbyzkkzviqqsitqocvblpsxsperhkshrdncchaiihncyxjmlchkbaiwvjwcseciiyolskqmjqtjipekggvuoupkyuzdueoiizbinbkumyuwladcastwqbhfbcdsacczguwlbjjpjvgkrsktjsrxgjziedrlokvpttrrmhjiewkhbnbnuadkbwixdavhyaioszwuwuvkzimiyhdtefpkryvbcqbrsqhjdsqjdbftsiopqmqtknkcvtnzzqvjlukvqbozscluhbztifieaoprmqdhjtstrxwnhptjekkpcpuygmcdymsvapagdjjmyhhtyyemaliuvlnfrsicmlhluhxoynireajmtqwdujpkaxixugagkzbqmjtigbbeqsolqykdbyoyfthufijveuktfjwsmzxchjjjhxfchyfwxftpxqzmpryjapqvcvokhndduvkdfjsrrjaodavxkywfpeoypverlcyhejzryxwhjbgovcllmyislfyaktiqwqqamzohuwdtnpohizzpnjkagicsrvkrqplivriwaostvlsqpvcmmejgnencpcueawagfntbworakwzcyuwbjnwthvtpgirkslegulnnjssjgozsrgtgwlbicjjjheifjuebhlzscysifkebfhiitykebcfzdtywaffgfbjzrihcstjonxirxhxmzarbapkizekipyuovsdzorwqacwuuooxrjkwvcfarnyqhmcivnbaveyvrejdsyochtcddtwrdyqwtgfhjcqhchxoobgfwrskbtvqkvemjaxjnbejmfevjnlotiehfpujmlcujmggvpvxpzdguvlxrgrizvqixgmatkhvdpezgfysjsolugpqzzxrrbnjzkziktsikwowkavxfbektcybzylgxnnwyofuawghavgszuqfjfihdxlbkfaimhkemzynmvkzsujmnzbvzyzmhxplxawhddsodnnsaqyfjnatbhbgalncayqhpbpcicqfilqyxrwsiqnotcqmraczamoiuuwigvzuzlvpkfmjvdeyukwrndmdlsifqoekiinosbfotmqsjzlkpegtkknubygtmbdgsoeifzhagcssbatbbilnifmzyqehvereglgdfhjioxyhldofouljecfaykdwragedvveyzjlytnhkxkrksczpckefixfpzawwykrhufutcszksogsagtvhtnvykuglfdagyntermgkiacmdvldpcpqliagvcwcztkxdbpouivbfdpmhzsmewkgumqdrrwgqpgadqztnxudyrnvqbtfmibhcadslfdgogmptjnzenorhgkfmsfrncsvdhlpyhtgfjzjtjfkfbcxiepzhuxwhlfqpujnhsygepablvdnbaufyyxjnydunmtahgwqfenamtdnsjbzmbbtvqtbqfdtfynkkzlyfntungjvdomaqbqnblyvwiozfakprcixqidyvafmclvfelfhcqezvsrsanwlmstlenoarejzabpawyppxcjprqdmckgzbsbzzjoqvclyufwhcungdoyxdfmmijjxxrlrhobyzbcujkecfitaqkuqwfmcejfpgwnetyqwnxarvfaxcgbwgjiwgdtvyngzaiqbmwgvgylhznhazmqqzzcgblpchgflyvruihbpbklklbcxqjxhemqpugkflvhmosix\nbeysebafvactijuabwbncooebuarxguhucoxwydsyfayldbddekgkruxhjwlpchnfvdgambefhdcetjnzqkuxncqerzemelhsaagobafvllaejogcrlddwezdzzvbfydaikdzlzxbyaezowgoioxfanbyhmyfocwajjnirkzeqwwydccpsjfllrkkhargxwzxgicgdmcxgxzkianvnorcwkpcidrbqgcqnxeopkoapdvmakjlqhcycwcplkrkelfnjeoaoevgrlkzuyofjokyvvhgrfyawsdprjrksqalkzdcwsjnjvpzqrvtirglfduqheotydnpnqisnjqnxiiewcafporcnxclmbnphrqnfoxxqvvphdfmblfsspjarmngcrcrzveipwzonrpugkbdiiknqcebazmgescqlrtaoyzvcxiyiwkenibwotjycsquvlzzgczbephmsiduafwxvkzakvcrqtzfcxjvvyxgbrvsycqzfdcyjsysfobvuszgvovmstvvsrdsvbtpbyawbmehddqethmbkchtljpbstrmizpgngc\nkvyyhfaphqdltndsppgxvymytzkaszkdzukdeuvjrtsrencajvxkmsfxurknyrpaqxalwltnqdhqzbvniuezsjuteuyukxqjhvtuixmsmgvbxhwwixrtppbzojoltbjqfgpgxpktiyzhfobcrcdhyatuigkpvbyzperkxuktdzxdqqmrhkkvuhydxvdaqfixunhvdqfikbtamuuxkccqznepieeilrhqjfhomqihjyvxnsznibfsyckhzhtgfthwowmguetbygnskhnpbmemejsozpsxxdffjystakkfurxiytxwdxpkbyoqtnmfoldbdaejyquykwjomhnfynkandngbxdosrtxdmqwrgtxuhttcdqdlshcjegksuxlvaqpjluxgwhlppzkokgrrgejuhxikouimarqesxiletzkhtaswlkxngthyybcnlkmfjzpxxrtijhndbwmpitffwrscbivzuijbkhgcoeeigehjrowrzdxadeibohlgjrsikhyozkrhgwjislospuuepcqiyqlwnokujsioubpjzbtbznaumtvzwjeykkjurihvbbckhomkcqmixrcladcsrvphsdsktwzwhnbppjdmdsxuwjraqbaveutrmejhrabtbkozfplzojsbsmezakavpzhdzemgwzfgrxbkvvmpschtiheyktfphtbuvqspubnvjuyitqpsqrbkdudzhrpeizmsihwwjatewdsdnjnhhnbyqisqdikzxdjqzkwqpdmbzjuprjwotmknhzhpgzrkauuwaejyxzasajravlnvmhvqkryaruhuhficbrwcmiafxrbvvbaoojkjvddffzzkptkofcjrykvkefooesijfwpdyrdpcbhqedxwxhdxbeciwsqwlrayswxblheiizszqvxefacaxydrdwbirfqfvkbbyrgnhlabkgauruzejlicnutcatfmaqxfoegzxtwirqtsfeznmudahpoksypfxjybegnzyczibrrppuwdackqfoqjshfbbwhpmupyiozegoozegxudgjfkoxkthgskimsuspesktykkvuzjcelnahfghzunuuimryzfrirudbbonogvwshellxjglppknnrdahsafewcoupatdnwqfzatirueymnvrasoswdfrmvbchfntguyrhgkofumzpbzjiwpjmmjpmqqdwbimztwswwutqxzorviinxnujizihutvjcxwjcqkajaljhxqxkejkskpkwtkuouectgwtxcwetlqnjwavyemknhvfzvsxwnhuvkgohuutqjkzialibehuhsqbvycnbwtgurcqzvuzttwgogosycpjpsxrsuoicqepmsrslhjyrpjrqyjkgcqwkokufquuzxqukrqmuobdccffyxaueaaoystxpypoithbtpvwdklabmoidgzzrgcoxbfdkfgpoysbauifytjuxopzwhpwhquipmkvrbdbqmhebxfojzxkyxivnkxqsnnrykzfhiqfzjkvcicbxqivrddpvwlqxpndaweygzrrofyotouubaamrwvalqbevvakualuvzlpdyfmcfwcrhbsmrsidquzcgrrzvnftqmgknggnlkdysqsbiugxlkvdaadorcigxcomswewcaibjkapsuugnlyvnfmxmkckyazclsftqzqpjunkpixfsftympfloibojtfiuadkoxwsnveauxzpurzdmfce\nyntgpbzxgtxdudiwoiehljlfaovpiopjapilwzuuqpaxbisbykjwogxjweqsadrmtjaazixxswntsilmsvsurblgvqsllooqnyntgqvxinrbhncktmktqdwprskyrwjphepyxyguufnjpmhtrwngisryxhvdyomujbrrrpntljxrtrzkoihrxlqynpskddcxxuexkupmwkcllglhemnvziawviezufqayemoaymmxwnhpqzfkbuwxygmibhfxhojqfmwmjhzqekilmxiimoqpzwcfhfwwmtiurntqoxuksiibsglgoupvddlwubfwlquuddjyfmrxctaegholwhljmoyhaibnjtqqvtxtrrtpzapdplkupjrwvzbbgcwnhzcvqgssupkzwyxelqjbufnputnkuqsgokzzhsstxgjdmvudziuidtacdzqsfjjkhbtclkeirdyjkgtbsnferyunzrklinnwzjogpkeffgdowelkhxyxfjeegbdcexnjwykqxtijqmeivvcshyvhyygklcbiymgktrbxwcamwmjqygzovaultksuptkpdimztvvlkvkaiemaqpmco\nqjpyhmhzsrklqstgskwbmudevyajnasfcbnyvgsswwjassyqrzqutwmfvtxbmzsxsywibcwqodraufbpgotfbnwxgvgddywsvylolhilqpdqunzzjfspdbiewsgeebubdikmqtpbcxwfszxwelafyolubfygjulcqoyqswiokejfldewfoyraniknlsaonqzassgpbtqmpnkxekxogcxpqasonhpoelfnlhcpzcpszjrfosbrqdzvullmxeqlqqpcbceqypxivmbafdipzmrgpiqyfofwkwafsxihaefgoscoeoirponzdkakpkksgjytfcmhaiibgspvhmdzgossvezldhjuuuhpyioqqjpxtsljixuccrjwjdpykyavzmplftdremcybyksasaytwbvhgshclzbjgalfseoeliqvhlbljwdouoqkcqazfflsnopeeihtiztoczebnafqmedylflfvrkbwtrtylqqoxrmlimluyrxsstdohitusyswlxbbpnfagdzjylqxtzzhdwarwsisekpnirrcbjaylbtieucfeoqkqdcyontjoavkhodpwqhwyczxnlj\nzorqdapocafbiknjzcvvyrbxhpiaqmsszariwcvmjnbwbtrernzkkzujziuysepkzgalnzocexcjwppyzzclvkatnhnstbkktqekoxqijabkrbvixqvsscsmtgbjzannesrblcxbebhorzlgugpihnivgbcsladarecnacxbukemaceyhfyekbxzfdzzsbetmfxazrhxuwmftmjptitwavmrefhzukaocrofyzatjdswzdgxevezikkojjgjackrasqcqdrbtaqwitjbytxxzgtctqouloxomduailksoboctybodtntlorinqightfaicwudbgpkirmvjcjbrsznigxarwrbdsrnriopvrsdrphmdklwvwspacylzabaxvigevnhnnzlkznsyevyavpvqvecmxiylyjuqtxjhzhxkrimngghjenlwnwhtbtvfzurjgutdpqouvjmcaglcgncjrvzesieutjgzgltvrpzccxgjlolyxjkjosngnaytmmsliqmapjelomoemeuhzkltownehhafuklxzfiaexefiqrlhsxvuewmdbsoghbpsqqpbattzeymcujiivggjoaqcgjwidxjufzzwywdcqeykypkzgrwxwxvncgapmgvnbnfkxmkxyoxdvurwlzpjjirkiacwgjejpuzuqrsqanrtizqmejbicgkgrkztbpwqypdifixezkfygoaacicrndrriugosebhxfqgbvujfpjkgxdgtipfbidjuxdkzxdojaujrvaxnfiofwjmezipgiebjevdrzoxijhmgzvlchrbobbhivdwjdlrormareqzzjjxlhkogpmfqsqpsaaeahccgmwfgdtgcjyinwnemyfujwoutwddovdeiktstoomktoepzkpytoiuswhaxcikyapbonwvopylpbjbltqpcrsnzwskjzzzbzselpphuerqkxfsojfrwdbofozpojwmaklatfahadlanpulueoxmidfewnwjeyvpwidssbqramkcvfdwhvycmeutkvzdihxchcowbwhmxbzgiddxhjzxmowtaxudjiawmuppcgvnagruvxcpmfljigntqrshlbafkcvnlhrhjfrmgglnbzpkwgpwyjsiaamxbwqmefefsocfpliijniwmsmspbsmgstpbyhyfrntkexcvkwodhsyjjjtdeivnhwjjsrnpveklryzbxziwyamhijalrbbfbwiknwkjbigllrbpkrnsvtcqxvymexdbzrvwyborszoinafgevnceyjvqinzvtlpzzycfmmemctawdxunqysdymkrqadrbrwdfwiuwcmcdbkcdtrocxqmetvmraiwxgdwnggjdtxethfziqzebzmftlopktjolxxnszqxupjinrtydlkscrgfxvhexpvadajibtmzwaczzmzjidycdymblvnxvvokizbvduedyqrpinluxxiwlwefcmbkrctcozuuzfybfselosjcfbsqsvctlblfojcbycxprvnvrgcxkaxddvtiuifgywcdlrlgusouqnzixogbyqpnvoamsinsj\nuhoqtnzrctqbzmbjqcpwdzlvhmbbxxwpxzoicyhkvujrabnqasgybbsimibwkypnlvdcbpsmlvgzwuubapmoaogshuyqkvpukqurscbhfscrrytjawohsqegghvjxnmbcghboqkjzmnvofzpxvwluxviiassqgpsmjntnauqaopourvlgutihscyhasikubvkgbadkjvmonnnlrzrwirrfensjadhoznbnxsokeogaufipdihwubqgbjrfvykogdiiawoxnzsjsixbxfyehgzmqwbvkpjadlzamzafqbqtubkbqtucfexrzcchdjgtngmbelvanpkumsniajnwuaehvcarzjphozngolftuxcceyarhdxysshxkqaokvcovcohvsbainzcisdcxxrbmiyglvwnfsxpokguiultcciraqyntebowyfczkrcimrfwrfqatnbeondptqcbjctbrkznwosoecqtmbjaozbxdjeprvzqitmhwxewxfyqptojgkhsghmbvkybnadcymeyjgdajrvnmbjsnuvpebvghwqqemxgihhpwmycuhnipkppubenikbymvpmuxnxaojthrhooqdnkwkkqthvlcptathtaflypfjchcrufzbfclafngddgemkatwhprcqozcwcgknygzbcdccbkpcdfbhjvyaxcvqdxbqcxmygycgxxxkmgennrgldifptehppleagvapapynhzsqrcnocunbbhuscoobdobhhcpsszxfxhzzorjabrahlygcemmzjgqodknizoalu\nrnfjmfotynripfxgokobtqxcxnklwdbxtckowuzjetieujpslmqftxwcjopqnboeqhifzbkybdocfwfuezacdvsphwuhbhihivirqqcvrshkyoqwdzwudmfcqdmpvqnyzxpqkoceghofjetsrrkqyaerodrcqtzbarbtchhezrpppyiytowgtiiuddrqufrygiasorqrttexrmjydirhkszvwzgselktspgclnifrusrrjwredhaebzwmihmtuylgbgvveyuclhzuaqrwwqigenvomtskepsivrttwynktaijdwnsvsawrrudxtklgaemixtaasczlhfwmyejxwargdxtyahelblclshqywfajsyeqoihfkbwnuxewxjgowbusaueyhnmaugskqxfkwobogejnjgykkgisuawjfynzthygzgyjhrxofstlvhyolwqueubgqkgfxksxsmwfujyzuvybeqppdkehyqskhdmtilxzyzwxzapkhvtbsfoprofztatsthpyvsimwuybegttfydudmnvneqkgufayswhjngqldlqkjuuwkwvgzxdyvaszqtogwiqiduvmsysxyzkwujhjlrzajfdkbrdmwfemoewajvdpvkgqdadsiponanagzsrgaiwjiifuklylfsqujqiuhcvycfbfvnruuoryivbapdurgqwwvyftcnkbmghvduoycrzqaozgfxxtdnvhrkoxaipmunnaiphdqrqpydxqovxswbxevncpjxpunaylmjjsyratmvzdvrfgxsjvcskqblcxvblfztoriijukxvmtrxxxvkmylzyizrvvahyeytwgdylkzznatuwvfbjugevtsezsbnorocliabaokwuyftobppecrojsszycamdlealhfbjdtdjvnhjmtnqxdyccvhslnauklvnhcjptssxhtdxamosfokxsprzsoenvfyzalkvipojhloknfqqakbnwctwxngymhcrgstbcdbahfjhnkwwoilkioltfdeehlfzztpnphtnubismxzmdtxckfoesdnkywbrfgxazuatiqgxefolirrgmvujlgkihjtqovjusrchsfsxrdckoynqksijkexyjuddzfibwqgiyfzuboonlftaekjihjtbwhsiyjopgbedmwkbjgxoazyjzbeujyehtldhlardmbvczqabvvghlzobrraawalyktjzeksrxjipluynuvzxksddklqvrimmsmlkbkkdgjtgtdhnfkfczosxistjsaiahduskorxrguoapqzgeegujhpdqfochspzyfitcnpwbvsgbppvbwmnyfyhylbzwkfrvpasqdmqgguuututxcltmhmmncslhxaltwbjrpvmiaclyvjlsbdcujljbjjokbgmhpjhnknycggayoztjbaraqconjhasxemsxcmkfcdisjoftiafphdsiranbygkjioybzerfodofqpvxnqvlgemwqimqubamuirqkfnngqrhcsjhehnyhaaogqjosxebfwfbhvimcsciyrmnfppqyhknhowamxgfpsuzverfqzuwnscgtwkganuwwusybjidtoegeagyplfhgfpxyipdqhsmpookdjfcgxzhaekmtiqkoiyfuoxknrmqknehwvgttgxasyudppgjurebxiowefrpudzwldfcqfqblukhfszzwsqgcfbvgoosxahdwmwwjvfrdyhnppkfajadgijke\ndqiqwyajvfjoopyootrjavmwerhcevzxegqrhqciktcgjwogrqxljqbhmhnbytqkycymdpiwcoljklusxhasyttvadsaoifdvyltqhtvelhbafqfblhqwzpzqhqnpjatrexirxxtjuvcxeyzcaaqrfiardhhmsjgkfpvujfnlzpgvcgxbtpshiqexlmckgigcggdroolitvyjzuqwstfbraawwehhxbbuumshfishwmenzynrnlwmqkytwoynbsntuuah\nesuqthzzctgnbnuotlreoavjxxzytnntuupxwyqwacgnsehyizksudnaiyemgplxfyrqwcsafriybrjhbhfaffdjjgvavqsammjdyowycbaroggwprztknmltugvsiaihywxkiiwecmayslgpgxoknsknctqghfebifipnwevhuviejmzmbfcktwcudmqwnymdfhuynrssnxccexluuceqoreygwmxxrbnnhhtzidvaglnaabikugaisfmcqdhewlxyjurcbvhmjbnxrrtbltofpqciympmafotkqcbdtwobxkwrdtgsysfuoyoffpdkhsigekhqhtbpymdztyjoftsxutfzzdnqhpbwdfoseaywmjogfqkkzqwvkvdtlyjjokwmdoaskgaqghdfplopeboyodywpjjsjegprprruhemenkgrotszfdheuhxmwjslfdfshxazrmqbnwwtdrwjitaowartswyiudfsnvwdyywuccfjjbbmfogstzvmxzxvbhscbsvzwurxtnoesnejcdgcodirrkoviujgdohqgfkzezxbzgidkifwmygdqlwmhybztltebaqfnsfbuuexgdogzoonqggswbgstptlvpcntzpiplxlqfovwmxqnquatgxftxmwtgoevauybyqfposuvnqfmihjslfinmxrpfktlxrwunasnnmcibeaxtygbwpwikrwfppeezetjkobrsbnhiqdfqahorkruzxlxnhuyymxcyjczjidkynbnrusmxlvvdzlnkvlxfplmglaavqlhzdxlehxlpnozhkehjeghmqgjyxyrqquxnzvjnqyzzfbmrstitlkezrupooudqbbsqdqvkxhahkfuveluzjhsvnkgqhtdusyzejvnapekhwmjemlsseohwbvcwjafgurnbagyuqxqqmezlhhprrfakntoplvkcmsczzbinhutjlvtqafrkezvsojocwtcjunebtvcvywhaehhpnxktrfbkeynpuqyrzqvezcesguxtgwzwplzenxbgeazegfivmojiripxihriemtnehbqvezpiprfnxnlaexxtnlhkhvtjjhufgwcsbdelyrjkucburgkdelxxgdptntvktzetyrxmahnithuixwdcfxjvvtltotimheywqlyampfecpefveaipmvenzbdsufogrmpeotczwvdeosbgmgrxupfhivvbqslgmltamsctstxgzwhegrdcupuqqkgekqksdcqrxrlgiwjjoihlahrsqzrwasnmokbngilefshlbuzlcrekmbjvnxcnjfuovsrepuzjkexrfxmoinvgfhibiioixsxufuygkznsmwnquiucfydrbsmimpjmonfobdbnumykrtclciqratbyfwgssoozmpqxhhmhdmighvbbrfltlozsyrjmubnlvoxweeitmmycmvmqmlbrjhoywmsbtdjxcckeynqwqyanvjmvgdpwidoypdckxwhjzibfwwquemqqkjxchzbbegpcjcwpwkulfyflabigbsjktwsgyhaasfctscprqinveuzqylfjpduhwknibxglvecovvtijklqxtvmiurnbowxfnhuyqkfefuqudhbrspdyhfdahpyejivk\nndjyjbmxjpcxmvsddkasmlqoejqwgifhgmytwuvgdylotuyjuofjmcgztzmhshnojhkzgenzqyymtjobdyecyivrhxwtjiyickfobufaklnpjaedtizsxgronambzcjzibkfardxydynaepdpdximtiqwkvgpeartzuhttwjyfkikiwcstgheysynjldeocxduxlevrouinkagxuvtgdxrzrsattdwskvgfxqtzaesuvgdkckulteereqqhdxdqgsrmnmthsxknddcgiykrobiobirmisapppoeqektmlzlofjiwzauifiluleirrwzlvxaiugcsbdkeetwfxfozukqrmoxcmzmuqcpvzdibbvmaqcjhxjcknnwgmnftlddbaxbqwjnwkuujebpkeckdrmoisywcfamnevxoxvhzdgffmrarsvgochobscvcpqvemfdjpmywjkhyeqsabnoivxgjdxxsslakdoxiexkppdnrudjzkhackncqqcmolfhasynqasxeappurlrrjcwlcvcpyexskodamxjmbfhbflqvdkgofcajfurnwncydsqseosisbkyolirisdvixqqarjifttnlsxxucelbxbmiaumihuowkryienughakqbkvlqyfjjikixfgajnleglvuqjbwafmxmubhsjkcezpzehiwqcjfpoubrwjklccjvbtqelfpzibeifqhclqvwgpokcbqcybhwfzpyealudeutpxfhyxiotyiksgxwtgyemshuudbaybmayjtzbsbbplpdgmkqagsefiasplwadzfmkyyenncyohuqtjqguwwtmxefdwjefrkblhzmztwyviypjygjlogbogqggkjxuvfmnytrncohjoydblddpysigdxaduofihbaijfkscjcsapzfaspzqbuqmpvwalrzlftgxycergpdxmfbabxsdgxoexgxxmoxxoihikcdefzsvgqzppmegyrqkpxyzbkwodeucgevcxlhuzrleedejmiqgbdbyqqwhqxhubadhungfgcuvkqgmisnclnwlrszbmsudgvttjmusaczeeemlmdowvbtmvlfzlvbfmyofemtniccsxwkbzwlcoupvxqnxcnsgingnkoqcmysrxpavhozmmqipcedvjjdofrypcnhekutsqdukbucyiatfqdjjnhwnlngcnkvcuvtphkqzgeyybxnpktrshypffnowejqmgogesfifrkzovjqzdghjiwcshodbvmcmrokaevtnbvrmelafckzknuswqtwqpqyyviznakngyscpowyjenxdixlpmgjsdobdpkevxpvtvmzuxyxskcuvqzxheqvbqdncwaxmgnqyibqnognptcasjpirtskzvtdtzdhtowzrcfsefbfetapmheaarsguttxwhyjtanbipawaxfvpbmvpzgmqjmtgvepxxjjqolqyccijckjoicsgasdxbzjowqleobpsbevmopahkfrirdecmthiakurdxvyophzpdfetplyghrwnobxnnxfgiazwahcqpregvqmikspbpditipdebveirbiisluwkgwtipudojhblhuorycibrbvbvgqsdafgmtrwetrmvmaemyikpjlhfztchkdcgllofvwodqgpustlejoaywuprrrbpxaqejqxkqozfijsihsoarkhtragldtgrpkucw\njprmgsmnhtguqdgheavumrxkzpuyottypcciphphubugpjntjvrnrsnexxeoovaoqvfvoqyocevbyutxyktjagioqhepeaqsevpdbqauiabyqxquytpsggtxznuternypqfooviojdoilpoitlghplscdqonczbdjwdwtliarknabcswbaugezlioqhbdajqdsvleqqrexqorpkmailawwkwxdmhkflcrqxqbewlkexdyuqbzndwtngrhbtjmenqbwgmigfvffvttngbljxjeflfjiucdzksuslebdconeaulujbkigwwatlxescrwyupapwajhgqzbxwjdavukadllyhbldpnlnydzljdkkikezueuzzljilmodivxtmsodhsboxfrsrilucpyzmpxovpwbbzojfmnjvlnedtfdebnonvvwbhvxsspnqvvzsvbwzpisolwnwdmgaeorgjvqnxjawujxyakdiktyqtofqutwhlckodnajsgnehwduukhzuqzhpyummqlipuhmbbcqlqgaockwnkyuxtbauntabbcpqezobbxezhwhhpmvzohhpbekcvdzhvgquufzfuqkeblcjyyxmzstiqnxgeoigcwrczsqrrkneedpsrieslezfwpwlpbkqmlzpdrtwfvxdajbduffymfyyajcvqsgwqatzmqemscflacpoqquktwcockpqvkemthyzxtgnmhuwletkmqbsakdccwozgryvczclwlnrjugcxqttwioptrzmppqfokpwffybsinwwqkeeuwbgnwtfzmsvibwcywuoeohdfysyanhrvpixcmwbbaylrwxsrdszlvdzdjttwjncdpohjgawzvmrbxkogegkpuhlkknjryjjptmefdqsmndphzxsxcdebzrhscwultlsuhymtacplmjyupudtrulmphegsphxlvekfxeilspjhiknffluzrtrsakepcrdnlohugrvbxohjkdcseufwlsupsvzrvwoizukhvxjsljchzsmpbzltcbsjpoikcutsqmrkmcfvslpddwrsmzlvqakqlbelznxbiubchirnmbnxuzehmwuesllfsgyvsnjgwtjskikgtgkayhlqncosurybeszxrjlancyowkufwervncrlywahvvgynrwtjkmxxljqjmjdibbsuuvmggikznghmvkusuqaailbwjmyxnbufcvxyozflhunrxxtwzdyafnubfesihmuzjsqbcfypobicfgazykbvdeyfphcpozdzfwhfrnwpmcopgfjnlekyewewovdcodfnumfzuaelheieomzygzsduoghhfwrjsoloapmlicxikthdwfgyppfovogyvskarfcubesiwogbxqmagqnvlnwnupgdmhtnetlxoeahsntyeunlmgkbrfpvcstsslialfwbeigvvpkicroqmhnbccgiqcwbvnybhdqcqeucbqcxqniqrhleixzqntxwtibhbazkkpssbkjvmdvwbrvublhnapqtugddtqvqpkjyucrphclzlydzesmjtkzmtmgvziicllbzjlwyemmugbpboqbgjqqjbbcxqdqqfzjbnzsyqiwetdif\ngyaodtzpvblmrxzpes\nefilwbfonkbrbtgpokarpxtekvyhwrcvtaablrbffmqvzxvjsioiyefbgljjnhpuymvdsqhcevsaxhbtrkxejawbeehgrinfaycvrzrdglzomqbizmvxnkunsnbbnjwulctrtgtscnlgdoksrvcgpskaiupohjxoebcitbvxrssaxeyjrpmdjrgvdyfrqoteeepomilrmoaurleswdjusgknawmefymmnvomfcnxgczzqlmtigjqefszfefbtudqofjbffldofbtjehcygeuehnbzpaategslyosvmvlfhnrwnrhpsloamxtqaixqgfrjpovukznoxjvubztygaelzlsadpdrwwvqntpgmugobuhyrwfynueqlywcgpfdfdytgnjgwuyjmnobsgrluiissmjvkaljtmnvnefukuhydwasiarkjkhinmirqolblenvxapccbkgsprcpmtepwssbbtppxiqkfsqcbudygosqhqwsdymllvximffazqphcestdmqaetjofpsclhbxmuqhkajhkrdewugxnkjuntlwrmzpocuklyazvggclmvdfieerwteksriekdaoxmwpjwqayoowxqqdkfjusiurgljgpjgnmmcgpbblmrkguhryirszbjfjjqabynjvobbsvyvcczskwwuoxjmqbeskhsubxosuvznvfkarphzkfuiyyaenqkybugsiodrlvfxnloqkdjgaiyoovisrkeddaxygwqhqlsyqcmuhsyrpfvdioijzenzefignlupjavizezdwhetnemhyrmkflatxhgdwsjrkszxqaywjumxjkecqhjjonfeeenknpiqbbzlaognhqnzvlinkgnyyujmkhwft\nfnsriagiokchudmzjhsepkxkuexhxlvohufqpmyrnvnbcgebmreaosxwxlavffpvpoyajzutyylnjddxnmmpvfmfmtevwbpjogzfcpsbpnkxcrvttypvnwagydwllgqthijtroshhuyyjslqvflimzhagqbavxtvqzsojsztyjwknfzruandfyjqyyhicyuruhaanviavgyfazomjkmusuxjhgdnvikqcnneevzqiepqxqxzblbvoefijnyoeorrdkvzuptplkxlvbypbytaxehuxpsnognirecbcisagrpuxwawpqqisvhtbmathqgbeaeespyvapxygauiqznkywxxidkiubmgkuglvgvonqxoccdbmbzerjntpvusmkbpxtawnpkyrdtngseuzlwsollzvfzugsxpqkqjjfxngndxleflcejulvsnbytihnvvprkewrzulveconjqmfmjnpcwrqnphxpjtvkabpovmdkmujsbpfttkfjokrdzveipetoqxqxqlognuqsybmckhwnwcawysgdccbwsotcmwnhnvujwxualzzgyquuhpxiugzwmzwtpqutuautuvujxbbewifnuknzdzpxknsxtrwwacjenoneccfhptejtrirwncrxpwzzklmpxdgxhjsgwhlvaowsiejqwmtanklgfdbhygpqvlvmyvoiffzwplzulryjrzgwvrmaecmznsbowavpbemqztcaamqelquhlhjserrogsgmbjaimvgkmywocuhflbrhqboctdtnlmwwvkyvjjjuptlkozgvaynwzhzbegnfmdsnhcszkdazuhhozbcugkwzdsknkascuttgogirwpvnlymwkdhgumydvrrevztzpnndymopwyosrxceuficehpovoetchaocefuetjvvxwhrxveiznbyvzooujwbyolzgplaojpqabmjmsicnixayeehkotoognwnvxdxldnbivxbhdzqjeocrqfmvomweqlopihspdrqjbmuxmojselacujnlqklfdfurqniivmtrxaglmcmfzowxjadakkknmqmbmciubacckigtxabehwcqvhhukkhalhkubvbdfqlkhxyjyzaeobfrsaqrehgwzjxsnleehpslvqhureijyurxpqsdwvyeeoseoerxeitplkkjktfpbgtfpjybtxmauqfbndwtdeohkgxqlptqpeenxpxuobddbwdfyiekybxurdqofqxyhfoyinhowtlqofoujsgnhzmwupgffxkfkxkyzisikcabulzqotmadlukfzynwuunyphrpsrerleefuadmspfcngsiojmrsxxpxkvrvjsikjdtpak\ngigqsrysvkarmawwarmoozqyfrymowlcttbfhtkinjjgihwtsqyyfcuclsbtioicoplknsmifwrovqieeyfhjwewuacnctpyfzdytjlmsgnfpxozzmgfshpslrmczcqfnrjpbnpujupebtizcohruopvhyzegyppmtchwilnveczpbwnwdnchqpphwbpvfcwfkkyzjixwtbcibwzbmfabjmckksgjjhdxuhhztgavmemvtxxsxmtbeelcgaxobstvpbnclnzhldoylvlutbzwoxiauhooaucelqwkvlbbrpmhaviarudxfvjktlucghqklrsvhggunlepwmhuravecuttmmwvowoctyvnyfybbrponuykucjuophbbhywpaycyabpvtjzamxzuzdyrcmqvytnfiaqnimnncrgbmlydiqhnzakshrncgtqjnmtbtkraecuituteladpiqbhxycvxfahyozapfrslekfksfnfusvfjjvopbpoioktslclkqcylwylhzjcljlsjpjuljpdwadqmjwkrmcaowfqhqlefdiqfjatsmjrnbqjugruarjqjgafifgtkljbzdvqsfmygxkxkllihakmikyzjbwgeddsangvnmmfhhwykfwerbndkrrifsvfyamxzbjlyuaqtoejjrhayzjdzpnrspzxkacilojfgmpccvfeyxbiklmsexxdeqsrovmgehzddxfxgptwpkvbschspokggsapfajpwvbfbmlhwlbrcazxzjrpoamewhjpomgwhycborqmugykukfbdzidunmrugfmzfvrqffhxhqqlcqvjezqunpknvdvlmohwtsdcfguopghpwibpjfqhvuvzwltfbxesrhsuzbcpmrvevgmrcldgmqafrhiqovelhkecwxqzjhlbqrnrvjdvmmisyyk\ndxpdwxpzapijftbcyecxjtocpskjsgcoxjvovszresxffuvbwzpoqrtsmbcmtpmwuecfxfbiglbjuizxntwqzrdskwkbrwixxoslzstrdapnnnxqvjxssbugdplkpkyvrnniwsjcfbbgaadkfveaglbmprijymsnrbtsfmsvtdwvoypicchaawwelvzzykojsbxvqfeconolwqdvbdzjfpxxbvtkrmnkwntauvuqjemlzwafwykvsrqjmmsmymjgadtkeovwdicpksgsrvqwcstqnwyfxzutggpovthcirqbiaaeynbblmqfhobytbukkntjaxrgpnotiktjvrjtiyytlpbpliixfylqylheocsdaemxjiwdzfhqwnoiyzdyyqbeovqnlwcqtaemunogmxwapdmwzoibmooeonoklkodxcxqfysnafsshzrypaetemtjztdlhljhpgovrrmzgkneeyawzofvccqvpfvujipojhklrvdbtahspvzmrkqhwfachfszrtmklczdstesociyfxaxwfdtmojtxnmzediczmgmtxjgltozvqfzwwgcxongtrloyujjuhpsjcwlvjgsoaqotkpexiejjfiwixdaulonijrnpfgdhohsmzqraqczyshuwdmxdddixwyryxkoxfwuqjhyqgiumjickgoyryxticyanuefmgqrzdqfcbmoldplvbwrvtsaalrahnkpffxjjiwkoefccmieuysmqurprosxrskmhdmovxxedjerzkhezknbhrsfdcbrcuietprkrogivxnbbeifkgaapkwfsjfktsuiwxhkozwnlxwsbbljyovewuxnnusfmeettrvpzytncxhmjicajxyagwnriitdogbzdiztjzvojusjjhibykggyhddntsmisjiptwszatkdleuiobzonqoeigourkctuzvgaocaqyzdskgcfhpyfadfhaqoafuikwseejwnakqqworicqhbwnnkgwxizoymotvwoiymvwnemfdhjyqlnzcctuvxujycilyvfruqxeckutjkqdqdxupuqowybihkekasdstmhalykchcxjzbikypucbjtrpjxtkcmhxddodshenogleurdjkscpulsvigbqkiytggkdhafmpslfsfbpnqubclgfacmwrzwxatqxsguieanasuvmvucxhjmvnvxulzvjwcmxtpzqhxpdzchnduwnqogklsitdbwydezdktzmpbvzobumkdrwghrigthrcaveqtxmqsxgfibzsffbfvfoezdsozkkvpjankxgxktvotjlzqilrsrjjxswklujdimgzyuvopznfdxxqqbytnuuxtucmlzppzmihpsqwhnsrpaphtunbtyddfhnnkacethnuotrgubfzfkeebruguvszsxrsimsnlgvvccltooakniteytnaxcaopfwospyrylkvrqfoqnrjbxoiqrtpdyoghlminnouatjpafkwtgjadxvapvosklkoucyzfmehzttjokihyoyulasymwuicswhgtfgxgulrlzizfpsrpzytjwrkaazwrollcznaqvlozkvvenyjvqbpdjrinarvcpebbqfyxeaibbvnpugcapudujhspmdgnvryokofhdtntplegyxsovxandrydjvyqowoteuyrcnzabcptvyzmibbqbbdnzmnxtahhjmrtfakdizycusacvcnxuqsgzidrimbmdjclrfzkkhsgqcrjopyyjtlkrjnyshpgalvryft\nhrkbndkybcqvrkvkndurtgmfaehzytppddmklfczlgmcmphwqiqfzmnxebkpakvxdixgbtguukvbmxhwkbyatgwwcqzqzrlcbtbfpgitspopdsahsbtmxdtgqezgbpuqfnrpnxzmuazoyrhkopxxevbnfpnuwjnfdnmioziiwdkkkryvinvzipztotxltezivqmym\n",
"3\nabccefghi\ndogsbarkatdogs\nhowtheydo\n\nSAMPLE\n",
"3\nabcdefghi\ndogsbarkatdogs\nhowtheydo\n\nMASPME\n",
"3\niccddfg`i\ndnhsaark`tdpgt\nsniuheody\n\nMSAENQ\n",
"100\nsvzofnfwwudqnfkwbggxcsvcrifxdflnlyaemuhgqh\nucoefnayepxgbgotoxdfuekngmghoxpmschltxrobmbsubgwlygvdlbcrhxvwdvtjiqlwfnczboczidhwjsesrswpcdkrtnlyzlvoaafbugvfljaspmcsvpzyyawjoietuiddcrqzguaoknhyltekooqgmnmbzrzxxunfukknwsjxifhyjylnkdxtavkzfskocxbcnsmhwxuwoavtoljjuxmpqrqnqwheymaypivrvjlpnbpflyeopgyobavpvujeocbzxfeoopdafspygsltxfxcykznerswvsakkminzmffekivepqcyysycwmtsyvrnprxggperpjkt\napojgtqewppbmdknuprgelhtcehmxuzabcauspppnvumeosqzdbtatmmyvanrzspddeenoifpijizocqrsmhueejzycdqmketrsrsksfnuudxbywibozwmikzqfbhhclljuzajzdrsjpeixhqvepnejzqdjkegggujlkhsmpd\nmowzdqyoxytjbbhawdydcprjbxphoohpkwqyuhrqzhnbnfuvqnqqlrzjpxiogvliexdzuzosrkrusvojbrzmwzpowkjilefraamdigpnpuuhgxpqnjwjmwaxxmnsnhhlqqrzudltfzotcjtnzxuglsdsmzcnockvfajfrmxothowkbjzwucwljfrimpmyhchzriwkbarxbgfcbceyhjugixwtbvtrehbbcpxifbxvfbcgkcfqckcotzgkubmjrmbsztsshfroefwsjrxjhguzyupzwweiqurpixiqflduuveoowqcudhnefnjhaimuczfskuiduburiswtbrecuykabfcvkdzeztoidukuhjzefczzzbfkqdpqzikfobucdhthxdjgkjelrlpaxamceroswitdptpcclifkeljytihrcqaybnefxnxvgzedyyhngycdrudmphmeckotrwospofghfozqvlqfxwwkmfxdyygmdcaszsgovsodkjghcwmbmxrmhuyfyqgajqkcklznayxqkqoyzwmyubzazcpkhktkydzivcuypurfmbisgekyrgzvxdhpoamvafyrarxsvkhtqdihersigbhzjzujxmmyspnaraewkegjccvhhrjvbjtsqdjootgpknfpfycgfieowqrwwwpzsqmetogepspxnvjiupalyynmkmnuvklhsecdwracgfmzkgipdfodkjmjqwiqpuoqhimvfvuzwyvijgfullkjduhsjafbtlkmfqrmyjfjnhhssqctydteamdcjbprhtnegyiwxgcjwlgrsmeaearwtvjsjbaoiojlwhyp\ndqbtklzfdwduwziimzgvnpwvkrlsuhlozwpehyzcanhuzvdjxmannapxuawvajsjwxyhnfizvugsbztargfgpljrkbejwscvkqhbclxkkwtwscfmgliulhiceqilicsdqucwqnfmdwedevmmgcwspxxgwcerpvjarxouthgbozyckflccaubuzjxkyrhenjjpmzlszfjprovmpvgqfrfsifomcfkhqvndsbazwotaexkphpugngktowzypnotdohnttatnibmzglgbygsjpwfyyuchtgyddsvfyxxebixrpelqyxaydiatwwtxsyqzlxxxiptmmcwkhzajewohbpenkmtqrsftwcbuvmviqnsnsmfavzohgpnzdivontrvzfmbkxusbyvdlvuzyttsjyxppegqrjbayaiyzwhpmdngquateaxcrkogtyxxvhftxoajpxsxfvctnbvczkzypdpzgwppatukzxvszlqbvmepaxlakomdpckbnjqpnxjwuxrcyxrqkyaayxjtrsoduqcehgjctmswqdsorzrafuutxnnkrazpaxcimnqotgtwvywbjpwolmrhbvbmcwnqylqzvcuskbelmmpojwkhnkvspmjjvxoownuhtdzgvonixpkjratnkntgtuekrsdolzdetlmhjddjlyggyhalqdtaunogrgwomfpfabzoxyrvehjjilxywsspjffxkudftwrhvhlvpefvdkqojxlokjuufdeeafjstqzzljkxqxaxfhnkmhbqduumtahxusijkgyvhdtmbekhnvwkcnpqbogvviojiomnzaswsrcnvffouxbutbdzdzflgrvlmwhtoujoyywzjybporxdvdlcwdtnirajlcobmjhhaxfvkksjodaqlindyloibtykggltwxxjrmxtnltjuzdxthewqfqssuivofqpoqvbabibghwxfawnonvmsshkmksechqusfirobwmenepfvgsdysdpmdntpltkmpubmlnwmozpquktmjfleepnpklbfxpwpjfdxqinwirguqpchzvnyhcpurszucpnfsgblftoslehpcmhgsqsmllojsbuhicfqsbwwgujmnzmlccrfgfnigxhwtbovxlrqmzbxrwzddbhcqkcpypcfbgxkmlgojogjpvvgnqgbbottxszdyaaxkccdtuaczvmdfxddnmuanectskhfnyvxobtjwesufrzxduwrdeaxxcawznnrnigzjyqrxnomojoetllcadlkkzrgvlcaffrtkruhmakqnhpmndghmchmgjsuamzkxqwcbolyqorpugfnbukaderdqrugycrdvifgeeyuvirvvfrydccjhcrdluaazqfeahjptmsjkwfjgqerhinhuaghjtlznogtmzwegshywcahdytgyfikwsohiurv\ngyyiudsjvezkmesbjlkyertainexhuqmjicbmutqdklaso\nwjxptxxeumzfwyucpabqseffunqpkfnnbecbbcjpdyjlibitllplxelrdkexdtquvptteyhtlqlbbbvoqozkynayyrbaqmyjhzxndsiyfsexwbioewqvqrtcdlpqmvjifvgymkgotzjmnzqtmrpndevnmthjitsspaqnjrdoyjwpyatmleyqsvkpamsvbmvxrllivfedkjigavyxjveqvrbacuigaipyhbbxipbzncwhrclirizxoqptqqweaafjeqiozpyfauuqmvhxkmnxmsyamptlzanotlslwuhtfqjrrwbwhmqhzkhdkcrfvbeiyipvfvpzhyujabtqwwtbkdogkemhibyxrnxsxrzletbqexkrqoiernaplqyjpqoubvjsebalwnksvloidzfpirwycztwzzvewxotakudkpedupkczlhwuskdnevdcplbklpjmpfdcyqtrcvvvtrffvpekkqmcupryjauteuvczvicthrxsxclprgdlwxfaigayrueicufdiamhtkbxotdirxxgvzqmeyrovfichqnivfjzauqfdftgmopsrgpugxtuhlcvspihazrssfszwxbqmurwmxcdbhumrgjqmvnkyrtnsjvwzxssqxnjomuyjnjuwrsyxwqyyxcszpoklwjdrltbsciedpiwlaqigesjsqhsjlrglmwanrxrfnwakztgjhxaunfqjvxiohnjqrjshymdovwgefhjesvhtiziojljdpmoxbyuyopqjkztvjgkwxkewpzhbjsuthsyoefjgwwyeozluhmgabbsqrhcrtxmjvcaxxsufahyyayzkhuhjrjsvoqhtydwpbszxsbziyrvgqmlunwscpirzfcbtseplkgwfkhrouoysrwmqojahyqmfevsdcomryhgdmlxukwyzcprskwgxulsuckbsepjeiszsgcezwapqrvlwigrovjcdzxxphqlsrzihmgzrioqrqetkzfbldjiemsfzbhzfnwywmxxgdpylraxglmtbiylbhcwhlsyoyhgmgopprzaxqmomsyhgagiupjqbzxthtopotmitnqwtoetonxwzghutifklgklrnuwkmsyqcpuivahqatmsckmaalkicsnxucovtykrxawzadjxwxqmndhldttxsknxteznjsqtfbccfqmwhbvssiigvijsuxiicaahmkwywttjzppkwlbmjahtputiebpbbmuegyrhlthxwgjprwvhshzyavqyecztozoabnanhrrbddndodxeuiozioiuozxqtihwauroqrdqwcvlxzipodiispqnzomcwvaptgrgdfnyytkwwqqtmiuuyvgaihfshccxhuuyyhtgdglfciebdutoeunfhdaxphbsywztpwjngjncpxrjvbvccefkbemgsdymzmmkwdehfkruqbyvecmpesromdxllubryyeshqlzmrewqnkqitxgiigquskwtcznlterxbltzydyzvahnkixjwzztdjpqsuowkvfccockvrjbfrjpcgdjdrwdnpos\njgdrqrvqtvppazhltjqvcclpeztsjpynzfrotqpoxmwhhwewnvcbvdkuzififrtwqqeojueqbnskwzeewzkaojursqgsczvhhujzumigofhwbkkfluwzkctkagxksmfauwinsjlsojtrxhwmhlvbypecjeiwwstneuiqubpgugwgnmikdwickdilsnpdqsvmterdfblhwbafbgarcsfijylbiimofgxeirpbtywqzapkkcafcomvntmdhzxlefppyebeoeqznbhycwmfyaqqiannyhqouizveavgzjwoblsgwnkvjlnivqcwvzxtcthynmuxqkwwmtfisgglgcoxpipytdbamrykbokmwgsddpqkrzyjchztmiepagwhroqkhwudbcihpqwaqzxugkvakvlavkswfzsdbvqidhtbcdeytmpphkuhsxorpufwhjrutksslhlrxlydxvkosaggmpbgzvbafazjohqsswtorckqaxsrehnrlyjiwtmhglkozfkmmxtyvoxhfkxopvybjzoxhzubdntoamzottcjtuegmpqkcdbbgckjqtebichznpprqiswbdhoyncsaetlgbfviocfwxwdrnlffbfhvyxzukjwocyhzqjzdhtbrrrllktchfnctpirnawonydwwvuabuqcimcnlhqodemakmunmaxiomkeywcofqbkdmzoizgqipzayixrydwsovhztkgzskwptkqcexrnnxskywndqizlzklnissamqazhlndnviltkoiafmeicgguzxhrdjzzheruswavnvslonoasrudrnldkldkfztagienatjzwxclkkulncaqptoneqlnbtoddbmivazxzmcojdhiswkaxiagtutafrsvpphuraaaixztwdyruumqadjepvvcvoidwmtpbnmquiopiwpuwczdapdzghavviyirojnolsowrmvvjiqswricmzsxavdqamnfhwfgeohskkefutxxibhpulnlwxqwwzdgdjgeqwapbhlpudoemnntpouahgxjhzjbeplttriabwucrjmbvbozvmxobatkhqsqchlhtbofuikwafkcowuuntfhpkdeyhokquwqvwtthhhugjzmfeuinipbncizockaadalljreqtkhudblprzlsrwxoccslutwqzsqtijvcwnpflrlukdiaohqjhraglgriykldkdfrdrxjstcwrsxgywfnhcbkpmesupmtrvipfbktbwzfahoevnhxbrhhfobgywcvhktdoxqtekiwwurzblmldlfibdvemunnlxubykvvrgktrerptisizxgrevnxquezxkugroohrhudidgvhtjhyezkyhpfxwgprpseaccxkwvixvfhqfawkfdjpyeevdggatfiekixeyrfcpxscjkcfgqmyhjmjtimdspizhwzizcyuceglmmbgygfvtqvzqatxlgibyzzkiajxmbhmkqlwhqnghlvlzgppxooeoqxppbpmblxnkeofmniumjcafcuyvdcueterqpjjwaknkxtlzqfljnwkxgkfylnukbiysplkhjucfuwohzvphjbjyovdlnbfrkvbemwytfjynqmgzagbkwekkouxdcynkhtosfytlucentoilfuldvrxlonvkxzecxepkmzzgwluahmjyecsldjesdcpjikvpaudvkxgllisaambovjkdqrkdorjfnyghhhptzifawftzqgemnhpqyictmoyfpcvkcaodakjacqauzyowdzsfqhkplfbyzmnimdlxmjydaxyjnecxsjjbhiqnvocdenqmwilxxzoqfotpikpqudmomikppzhdhfq\ngbxiisyzwnhxyfvydfmpdwomciudcnyndgcnfjitppmymxiisnebpywsgqsxdjplwzfmjoopyyifvkmwwpgpljeawpvapihoxuuffbrwhpevcoqrgrqwzhibnorkhzmlbzfhxunrklibvpszznopfgaxzgfltlsxbtumilocltgcozgtziufuzimxeekwnysbicrfxdiogcseozpscrhjotyczcwmbaaolsvubpylonmwajgxzgyzaovenfvocikqjtxgvenksppwwplhxtgybvmajeyfaxegseijikcmduclaaioissisiyppnzdubptsaveszsippqmotjhkudnvqzbkatnefulgexktrmhddapswptfvovujiuwbmibructtmrvznjrchjwzwmozecrznjkfrvkrmrdwroaocqpktlmwxwtnuamqelrwbgbijilnhiiulltovbeflwlpbhyffhbavhfuahlindjdfpekxglixlaxxtolhglvwxkyvulcyjeflloqzhltmgtujdcuugnrotlotcpbnyfhejegcmfptqmveghmfbmvklsrfubvxctepvmljohzxxoolnvlayguokqdauptyvjafzzkqtaxjlrbrukkkigjmxqrbazlpdevpezpbwshvpckldqgivlqpirqvwqquyxpixqireuqamffsvvntguxesidrnwwtqkdozfpkduulifzdpohcgubkurehrqbbxajefbfhkzbpkapbszyspdaaoxraojotjufsturtjhudpetsgrzuigusnwlyrvfnkkmsdbuhvhfqtdvtnlewfquuhtainkebbvzhtqbkdbmvhbsnjbtvjtqnbchiwfuqlzsmxvfjtvquitivyhzpxcdjwikfatcanchxssjluhlyoebcgnsqfzxxwgliuejobcfpvnyrrpkegeqpvlhxeeocmerjmziudtsqqozvejnrtibvnjepfqdsmvstmmwwwqknnrmqmjccpaowazfeurgpbfryedqjrltmymhysoicwuohferebeacazuvjoxyipmsgufjiwlcfywxteyyqdhxwjhiudghyxyoxbsceftdrqelxfvcfbbjjyfsvkvsapdshakgdvhcfmceztgjcmhxlhasqkauqlnfhggtagrnffmnpinwlexrqxisbfnhjzqvoxkukylzcrupmibacpjzsnaclmnuqnbdifzlujqvnfjxxvkczfkzzjqnaqpohygjsjtakzrsosyqhquhkjcjyugtedogfurkxiy\nufotiajmwhyilthmoevlwlrxpwpzhsvbfzvtvhwycfznmaomafsyvyrqpizteuoxgthfxsmxjrwpsursgwthhilgdhzfzaxadtklhyhqzfdimsruyecxkqkrudlmzgdtnhmivnnkclgarygydqdhltrsthidzyqazfnovktpcotchcolineietymrjsbyoeivdyhphljzhezo\nmiurcpblvwaajiqugtaoqmemjlhgoxprurtynkktdbnoxwttgeeqimlhcztctyphmeqdsuyvkkjoplmzdcakpjvozimhxxqhduiqedlngwgoooupnedksdgpmhhdaqbsqrfpdrsykhbutsnuwjppgdeebjgsdyfoecqqnlemkimipecehlbtmbwnkdxymeclsshvkmywjxeshoihmlgvxiljvwllfpnjzywcpamevwtygfphifubttnwnphdbytwodclrjprseqwrdwsvyncgfrazzaodggxwwbtjqujrmcdpomjryledhufhwkhzktnkytgjpmmgvxjcnjgzuhwqqsldzcsfojswrqcnbqyxaagibpvtxdonpeashnrohuvogldxhsprngsoqdjfqtexyrwizzoeowaqezdlmwafcozvqciewgkekfgrcyvzsahpszobrixwxkpiclqljtkvnbimpdkyebcwlfkffrlzzmkvmhnlcivwhwztzrbxjcrtuvtxfkidxhoafyesyvizvozsqorqmqlesixrnerzoowrvwpmibhhyffuvkoukdwjcvxqglschjagquehpnhkycpmjtgludhrbefjjfytkxlbnvmdwsyxhgsczhyjgdfgnwfpdtlkhpekhjncylcqmssyghwdvaeqjkzmhiydlxdjohnscghbtuswzumsqoykiidfwfxyaaaymoivfhjlrwyaxawgeurbrnberazsxtkaquehjfcewctbfjtpqdljhehjobmarguqwsokldzscsfacxfzxfjqoverscjzbkmzdndosiyhtyavoxhtapyektuatprwskxzcznfdiuehuwymtxdrnklsmduskvutkfiubzyblwmparmjdspxywxerftzlkoriebsupcpxcjwkuveerenlaitvycicyzalwuiuzteyctmuifefygaiaioiiedbywrgrtdxvdkocsaehfcilqjoevajnjttknrsprtkrlkjapymuzrphzlcepaytfaveopszrnkv\nyufvdbfzzhfgajamqikxbjyoeqnsazthwlttulyxqcocqrfjtlpjwpgqlbzsywbxrvweoggcrhzbrjjehtqvmpkgnzfnhuekybkfftgsbdpehwjucwxcwsfjkgilnbezkvdhmpnqunfojwgqjqldomccdcdfmpcmfphqtsfmqfqcibojdpfdskgpnzdxyarefpkrgtjgnbihqmsfxpyvkgbhezldfpxsjxyknmawrldvdqeetcreooudkwxrxjrlvjnmznoxddwhcxfjzecrlqlajbjnmigurrrzsqdjcmuejcowjxptoiszfeaqlnmwoiypqhmemmatqvlurszajejbfobldcbomwyuzokgplurhetcnnppojhruwarojouxbovzyimezzrfrzzvafhazqikyeeouidqltorpazvilmhakuklqplbafzuatihyqkstpsaiscauphjmpjcpcveqqvfutqgkifypcbuuospqvzantceglhelerivjuobapnugyvkpvneopckknukpnnpocrqsrvovcmcrljetroaxkbudneeslblnbrvdhoxscjkdhrwhnfcbfaneqlkdeowwdssvqadxivkyemaxecthvmqcmzolxdwlhmygvfgjrvdxqseyfhomvjqqmwntyshvijcrmtjmtlgcmafvtcvjydpwwcumzkygfzfrmhlbqztowqajhnpzzbufmjglodrdtgghtoqotvjtbuwdgkvebkwdbzjfvgewcunohggucndkdyxjvtvzpudpbmmjdplewdspvcekpkleeqdarbaafeifrfsexvngadwncqcajosetqdkguipnqrgpojubiihuraiwwchyryfwswiacgzqctldmqmtjbgitwduyqhfjamfppyxltxkyrxwkvnuqpdpxdirmxniqpwrhgryxxcdsjdscnqysdpjlogwoqdzkvtllnegeltcsczzazetvfkllvtrczadxdsaccqjgusnkiacnnievltlglmocudkhzohkvmpdiegbuwioufbodujtlczlhmyuoijbwssdxeyjxyqfavmmbkaqhlpzebmfhztmvllvxqqfuqhbizhbhqgccejxlbcotgwgkwebdugqnbyapuwramjrgfxcggaiqgnvzudbbxibokcixfithhsxslhxlndognaapvvhlayjdhkvxlqxznfodwydglhplwrdzbbpdntkwxzrqfevmtaclbgezjlizxyaosfziuvqlyjacegttvwptvbtkybvezqpiyhhwkqlnnerudlrcsumpfgtxzphfmcolocenfjqtsughnojojcjechyznifjubvikgyfwcdoiqwlqldmfypziodrngfdjqkcjthdguseyrohxkjozenhwqienesvusbwuztwelxllxwxlsanfehozchmcioshkdsyvypznkqwseuvzqjkexcknqvzylachqmqokwpvrowiqzozcxcydvvwkanvwbbkwkporhbltggzwqztjutcffwolgftbvrxbmsrndbgqumarftjveoqgqxekyealxzgdsutkheyxhbqwfirccssizofmqrfyzomiefdduepzugjhmjwdbglfxuenepoxrxzckwpauaiqdqnzknlttvowrjtzwzvuskxqyvpdjpdotyvapnsqtfbtxwqasnrxbvdibgucdjqtkfvkocjnrkmuxvramqeaknlqowvpixixqylvmlgyglqxscjbpltreiuocygmktkrohayvlfztsjrhe\nfcmtyfncnfpwszwarmxvovioiulfogurrzjjpbhylkcrzimfghhcpyqyfuvxaomecrmgmaoiweflqqngjbiulqonipzzqkjcqroledpvkdtndhbrkmdwzpioznplyokymbpspakmdtkqyztjhhefodqqbubaiqpqchkxvjyqowvxisajqaqpzenumifpibjblzfcxtgmsyrorcutxtqpqiojoaphmgbofpravzgmkcoctcyddyjdvlwoagvbmrbmwbrxdbbdgiwtugiejxhhicrkefwekbuyhrttikqtekgzbtpqfcqjvjtovjxbsszjmrqswejszgdjaegunupeptwgftrsmqaidruvqvyinoeclfxpkpjcyjglqjiqqvbsdeajcbezkwuypcfcycmeyolvdayikvnxrqddyqaopmhtvdbitqpetrvoymmzyoncgwxmlwrxiovehutmkxdfyckrpmpghwwembpsnbuwtilvlsyzbxmexuidmogcuhqmrmyfponffxgbiepvmydysqsuqrvqbycptgecffgdtbqgqwafaydwggrpsnaxyxhiezufnpwfpomynrfvgoyfuvqogkxcwilkrcbtyhcszcdxevftuojmmftucislhdbbgsthgrkzhjltberksvftsoebfdzdbcrsfffmhzruobftmgihcnonlykwtmrfedmtsknbqyavmkyosefyylqqregkekzirgqbenukdxhjnbkqjqifthgevwpibxoplimmbqtaeqrwowwqkltxuopivdxxwiwmspdpxaujauqrzbsmlhxgluwxgxlphnimwwpjyxukrznrlkzsynftcsozlnatpukvrrbgcmblovbjydsggttdiyfipvgfjpxeqvmvkrodxggsygpavhqrldbnyvqfmeyfdtdavzqfychigpjvvzzevbrwmiuqyprhmdygaewckxtyockrvdwrxkqgytydlthfwifxniyrldwovffsgwmvjeucnabbhgwmwshccxwegzytbvlowayklrelnebvqfjzwflqmfjmxthhyyzqpjktqvhuihwxhzxigwrvrjsyswtdzutbtyactovqabubiwsuplamnmspgtseexbskprjelioewmbjmzlvgdjpshodqewddhcrpetnofwmqpgithlabadhmqybfrmjbphfrczanrnqrjeifmdqcciyuailthekqllsjytvqdynxgvelxegkshgkzxxbstwcsdqigbzlegbewrwnjknkorzelablofmunrnuywngogxbglkredxolpiwjbqsxzlcdiqqpybdndgqclgfocgdswjzsjmqkoryqncquglaoghckoxrgzmvdjkladezwvmkqhjstjcqgeiezmdhtpqymzibaumfgraiifbelsmlmicomewnekfawssupzciilvizlwovivucusarvbficmrsvzgmxhseutguwnudacmarwnruvlr\nwnrmfzgpzpoltvnbmvwthjsvhbxsewqyckwexzpmiexgrjxjmdwbqyuipxarrbphnzwkbclgbvocyuzutzypirocyyucclqzcxtawhxkhalpukjrmgsxockdraauacxkpmrflspdlqkewyqjftfwahgqohkqnkttiqfyrhdsgeueivkrnezumcirzfqxozfcuhcnscqkcjbchvrspzotkdbidwwygowwqhnzfjqhfgimwjgrjvqspooslaqkxzehzegkwutiypzvvztdurgodxvaahguigpsglhabnqbwtqmbdsmbfzthyumquowldnovucoimmqszmsrzqpmaddcvhinjjdfywrwsdagmvyqhtqwfyiaistvhbzvroovjftegskjrjynglsshitxzgfwawlyzgkxyspekdarmeqdhxjflkjwnwwfzinwtxscjbpawnhbskilhsdudslmcrfipqqbpbfgcqyxejhgahxwjmskgaplcjjltqtrozamuinystpklzlivfhvsjtkzmnkabbaleiztjpzhztqhvnsjbjulusjtyynqgpysvalzdfedgaufchgkgxapvwbnuhymeahscsnsiimbmtjstpvrjufsikdvwyrizublbbgwadbfzrwmohscfwygavzjaoxrdilpomoisjjswfdyynvlqrmhjcszfrzpsfcctayvficqbebazkleewjynezrxdmfqywokwhrgvtzcdvsfdvhpvsnlcwnndaefgenzglnxhomksignqhq\nnlattapsruuxevaibsjthsnpbfflhmraeekapdsmneuzxhesrhylsvdribrplrbsciqpfzbhmzmfxjnkqlorpsuzjlfivcefhldwmizxswztlcuafewpwxdrkbkwfrubdemviqrqzyoafnkdkalqgplcliyvxlszwswjesydjwsbbawhlxayfiviyhcyrruuujrjjjjfokfmaijwqlyjkbzmnitlbzfktcuynjfsgyqnmeeplikoahkoyyomukilzwccornalhlqsypkfcnrfqheulwfqosrjxotsyzlcmuwmlhfwlzulrndzkvxoweppinxfesetreorbjljafonbdzsmkpbpunmzaggumvhzdinhyfsejqcitahfpvhnztvjepethszfjiywfdswlwinthnsftazjugrmypvyyfleacqjnpmekmmaiwmysakwwvjvxeiesfghbvktmoalqgsqzdpjurcbwmknyzlzaitkvgzrozxmowaohaarnaybifplwivtozcecldwrretbiejzgmdcrfgipwktphrdgebldulpavbqkdsrnxkzitkvmubniwprceigstnjdjatkiipwugovykncnzkfkkevgievhjqodbctzivvzicejevxuqybpacjikncnwliqhgxywvsdwfdzhzjkzwuaxoizztnsjbcehnhfllbbjzqblpgjwvdsafgchjpsflthghsmzlcrdftikcyyuujxodpgbbgdfockvrknvwpgcwqafydttpcahuxspuxedrlsrznmrfcbyqandtnvwcoqtszawwmeezvqgvfzgdiicppmqetbqgqnzoveyrahxsuixaogjqrjsqaqirjwjdlqxuwduazypwazebjronfvetkhokqedpfkoovehhbgzcpkrygsakghxqvgkadjnvzdbdqpwszrcsfdpzgvjfuubvtufxrdbpxpfeztwugktwwahkjfqjthjdhbeejmyopnxplhlbseuheinbyzxktumjzcuvtepsvabennafuxsdlwxptax\nbqzronmfdwgpbepeuhgbjbvnaxrhrvuwptsbzakokkpatutbdjevvjjoqrbmaqvjqkqwhapahwextjgxwtcklkdaoxfqkaycroesdtdlzthujqupnrrkaklcxgdcgtfoxkpjmrcixnsdoljzxhppxllzwwsmztolxglqtlmcjvrqlohvzxwaipjwivmnvqjbzkqfjjhwecxfcoeskfkadchwqsqtxmuncwiregvulrwlzwhifhdnqubwbwtcyxwujmjqhbjmjyfvtbmvwhqzjqrfbfdxdxgmfkwmlplkprltgxgibtafvdirjmsszgabdvxilmgqaqlxfimfdzxxaywmvykpwxlzionemyrdbvowpgwmooqrlntgrrtzhzlolmcgvruncmawflyqrtbbohdymiggavytlbrrbblygyehefihvfewlicdpqromvutbxujqyyokcjgbecatmjdvmajkpvunlgcbnwwvmlqtzzrbuoiwqqypfiiyzurocacwepxejxxfvjeglkctgavrygkjnhzqnxnttihvniogbjmvivggjzqxvdkgqyygmjuxmvgrrpsmnruiclcipomcsijvjvdfevwrhjmrcsurucsdskgxbotwuxhbxvsvandsewrnfwnszwgdugnuqfbkooqpowbpufjlhobdwxadysonqdgbnpzlerqooveibtuakbmuzaqviouhhdenowzyxezbqzqpgnhobduwbzbdftzrainjruucocigrajyfaazgaigrnbcqjcwyveflclgteosbnbfvutghcjekknlsctwpopabjpliwzkbndgpzbbxomkcjdzlquodwmuwtidgdphkvexbsztrintjappsxgtykuqatmjcrvbsamzlvztawfovjkfeoxkykdaobdcdszgcovkqsnhgcgbaiosrkherchtqdnlywpyviqrfrgemkogqvqehdrcvrkmapqvdburjahmttyqqqaygtwrxunnugtkyfgvsmskscinmqjlgccfnfkgphxbabrglouyqprlrnqwtoteigeokdfwfqcbylqkbyxvofglfmjxbmthzbooxobhxrbnbewhgehlcdimxufhcgeqfvdmjyjnoaqtcyrbzzcyrjbusmddvcmjoekrlzvngdhsftczzzlhojlcektmecjjtanfdjjbazsvopqheouddjethwmgwmvgpxutvccepmnoqsgylgjndlbhajw\nszworuorrfamtjcliiwschpptjgtrvusfkkdxuwqbhupxbjwajjtnajpvnxnuvgpzbwlwyztycvksiuyhtjydtdlqovrlzlasvgodurinjnliwsdqumwfgqssmdofxyktymryzmmmudfyzckhunxpvneoyvpsrlyroyzzxppdkqsgjxpnslpbgcaqkppyvxououwqexxavqhqyuwwhspltmepovdabzcmhmevnwvhkvapytdspropbaklualoorjuzpuakubzhwqkiuoshnixfkxqanuudrzcxgsnmfevmuideqyopwftrsybquwfsstqfqfoqiqtcgzerqokfggzubnkcympkmuwlpaxqlkhzzevimpbpcnhemordcsfhhjfzjwazksewppivxdojxdivuyttabddpzcbdqeegsoigxtqithzkgxhkboxfmtqdctpwesowihpzwqjtquheefeccualfqmpxcljjcewusunsfcrvprxkqiipewrxcaegxwynecofpgomwkvzmqxjfqhyzvoqeunwxwespppxsqzfrxhnkcxteukjvzcvctnbliqhtzjjktluvnnosewybpvimqsssmeylzqdcekryrmizbsiqdoviolordikjdsotndzfamfovcdfdyqqiqqyxtgcavwfgpfdqjeelokkdgrznzfcwnwqcxpjhctcfxqzrkyrxatmrhoopbgjdfghkmxqczuhwwnwnvppwhmehmnymzqsoxlqkjlazviggintosgwcithroyxgpiriowwksqpkdgjitckfprxrqrchtvhfcpifaqphwdhfnapwbfxmireqdwrbfwbcrxbszqdnqfrkqxqdbvpbmdxzbdsbntytwpvlimiqqigdbovbsruweytacxuoelkwgfogujzcutubcgmgvuyxbvmzibfmlkjpagsroauhtapmkclwatwixmywxubaufvecaavimtzcyikxnvlvzymsykdzlbdxnvulknmlgtemndbskkwxedjrrfsgzxnqbymyfvrwthov\nsgcrwtswnnbntrfmbnwgscjxxfpmtboyuprarcjpdcdplftiqrzmnuvesxxksegksefxmuopwrkveszeycqwxllnnbfnonushmvdmplykyisjhhvszhjpfswwbonzummwrhylyjlbuwxywxyqsjbcxqnsbujwverqnvizakozdkscfykpvylkufcejdbnijjycjnppsavnseaeyrqqnbucwxglpxxruuqetpxoebjnrzodfafpcsxaxluopbzetsucqzzffskdokroszvjztrqgtlzapbvospelnnqxargfxvuqjoyrveuqnnameexbaebcisvmmhzttldfuroujregceyragqqbrsdanmnhigbxyglmfvglxolymflmklanrzpzuvejiewsbekbuzewnoszajzxxnevpuikxfvftcypgzyifwjenzsbdoybvqaurpweusehrpmszbxbrqoaaxwklouwfmszmgerszchaoeebcvyatgajtntrujkuixzvwrtzlnqpzaghsbjwzcfgasmuohhohsdyuyzpylvprnfeqmtltfaegziehowkjscuevznwrcnuhkmqlfybghlxwmeihvphbaozasehczxmiemcaqpoilyodkmntfzpnyefbpupsfanjahrjpshxupmtefoymgpguoukjvdpuihijdttcouhptxjqsxoorduujidxymedewdmmadbrrmyzufwbecgfvlxetwaxidibgvhrguzmdfmpvtpbdohvlzmiovriwkbhbybvebyerlkqqbasqgxnvfhbxyetaerlhhfhetdlvcdzfkpflhwgrkibxgwlohblnqcvovtgiyytklphnphbwyostmwhsjrqprxntmlqylkmnjgcrbioyhdobnxpwdbpbhlnnpegbeoiivalofwwtgajhrgpfdgqburvyykujnugjafdutwplpefbrkrzeeutlfbcvcowwdztvhzzaxwuyaqbrszrcyawwsxhgejmmunolbvbicioeheoxmiwvpilvovgslwopgbvtvvpdudlfmumsdngistgjojubpmgymwjlcobgwxwtchyobsjnbhogoarh\nxnatcufpjg\nenbvdayhdbdecjjitpilypiuuewrgobyxjklulffpdcipypmcrjkgireznuqrqcibnbkegxhallbbeempawcxuqglfkxwyxualayyiucjvgvvkysxgbnmngyjvvwtabktybjrkxmcwafullluoycnhofisjnnnxwnuukkhgvwllyjpvhmnzdheyspkjsfidtkoxzecwnvdiupsfzkixevkjgvrbqvjqzyhyguhjjguxhzyplwiirestldulakyqquqgqccslrcgsqhvdehnjljkwomipksjeqxfwhilzboyforvespphluejhkgotyzudunghuuelfxmgezqdngrtnpkggiwpzyoklmaekfxpqqxmyntpiotqcvgysuyouseysaqnrywnttrydluzyfhukihcyhdzjjdyvtoxlateobsbrymvtnguiwrjmhuyshkrcxjabnlkdikayvrkaljfkwowycneovtchrkvgeewqieboshtvfekxqhsqcueohwpudvukjavfepisiifkknaknhuifjuuzsfcfmasbbsmthyhloxnwueeosiuupszlxkyfrllomgvpsnevmidmrpbhepwgdmezxcdptwokiioxhopmtrbqbpdiqhohvetjedbjpahgztezsbcvlgnefhpwiwuinnfvplgxtuqwpmyqxcaciicdprelazhpxaxuhtnlxbylunbgjaggzyrfxdtubzqcqvhsikbrvvulnnlpyqkxuverkqalnyvzzfvzyfyuazwrioqvqwlytewacbadomhgnkqglaviujfvzmjrcuivduhqtezgbazrfwfheitdnruzvllhynrmogezevkmcwpngfjsacijichtxrprxznxiosbrbwdjdoknxftxzlmmvvntdzqfpviyrxgncvodqmxfvhzvizopvrwxetiukpszrswajghzogrnntiggchnjhasntxprodmsenwopfrevcfwmzzwnczfkeyqjtwnrpsfnwepphzlzexpzakcrfjzayvipibpazivnrqorxekvoxieyvlgaziabpmvynehjfkdgclnyyvmtahgolomirqjjzjhzikppsyurtdinrlqvtlcmwmsfgopgminkiwhnqodmlbnzpcgvunqmrydtlzdviacdsnminqpbcpebxugblhdfsjwurjtangfufuoebheeteuddizxytmzdykljyqgdednhiavqbqdfqwepncxcyzhponwerxlrpsomafcjykbkpwuxrpraiovcwtmvgtgcmgrkhrpfdhuqggflonbtgokdmhpziynvcikdvvuotxjrahjyjvrmzooqdagjcsexmpjtlvfmuxjjxcknixfeipbnysedyhhhrycqxeyxkoyxagwnilygiyjhisedolmiebwapqvscuiktgvyzhmbphpcolpkkuczvejlgembmiaqeitgdhqywyjonfhswfpnvtfzbvcalbcvasbikjtnnaciwpvfphqocgijfxdoatzyjzjeyfoyeudxzdpmtfhkknqezftiorttfskwifwpwaafxmmqjhfmimakbssuondsadnftndfstbwdfwtbbaulffdbncumajcvpxvpoc\nvsuyegomjwyocavmfyhhvnngozvjldkjchtzxqmqohynqaftunhjfklbkxnjjtnpdplwhgtujrcffovyffkmzcdobkmhxuqvubpyjmniexrwvtrevhhwnxswkbduuflaolttugfhrjtdopvzdzceeksiiwsqzimllwgttaphnrvntgnrjqmvlwobuvghcwsrgcuikqkeewfwgldppvytnevabzlqsevruablogglphjmprvrqoomzilxzzrkpomqarjsoevutqgliryaawguvogcdogjfvrlvhqhrmbftgvxsxeuoijsqxnfvsnjpxhhpruwyeopyvcjlnehhqgyxqxlwoikczgbzzcznkfwnwggybzmcfbsrckyobyevssdvmqllmeizqfqhxjxmibldfpccjymxofnxzpvqgyuahubzrcscbwieuiorfkfoyfdcimgzjzmlonupvfovcurtsffozglohnerehweccptovpsfhffobcvtqriwuwkrktpiwpmshrxsfwrbuvdunvdxvytfokqqkgpkmssvqkumpodgnzgpshthmluwmgbpkrbzctxludvycrpzmapivxewbcipanscegliuuqvbujriyvfdkxdwkpvwnuhtrwvesqrtwlsiffkapackjhcifxcruvszyycugwjfzpapveziwlijvysyilpjiyiyqcqmxcycykwjrohfurkooekibwayegbombbmmznejpnulelofvjaqmioehdywiazcbehqyphwijshdrwrwcdtgzmhmspilmbqtozusgfwidxtseolrxgdowmryrtqhfonlkzhflaxwolxcvmjjccsvlbrfqhddnymuyueowdpeqlaiejnntnmogteqpemeiqfxkgjtoepfovtbmxolapgqwrsnpihlkgoyuxiuwulrhqydptecbsfqdjjpxkihlojkoovimihzjmtxozuxlybgyyupqublbcsncofmnimzcaoimeaxrqecckytskuakgfgxldtisbctkgnthczyhrcxouexiuqeuyrcudqhyyzrompymdzubgvqiaegsysjkzlmbrlpyznloslrqhmmjvrwjslmoaqvnotvmvaxdylcbkwhplufnpuezogajukqhharjowrpxlwpoqt\nbqxpaofdmtxhvbbvxnngdhkksqntbokvducnmenpqkxdlkdpxwwlduvytmamfewfyhnzqmmqubuccxnqxsfsfecfjgcekvflcczwaxsthprcxkxynjdpekjvbojdjldezawsdzvbuibjwqhogacfprvcczihllgrskbadnnxnpqbglcsgdkqjthgeyygoosyzyhtqgvdyeiajqjjfxgxzxxvafzpeiewazlnhjkkccwtfnvbcxfdfzokonebcwlrqhxoqjpabyogpkmtdlvxrvljsupqiuefburedxuzrnsyvqwvwndwjodyxpbrwtvpmxcvdgsnneannqrnqyqisvclpohqodestjfukejgjefscozvnuiexpiisatfnpixojbtsiyaxyyjueyhsglfipipycgwfasxwkqnahsjcohxnvsvfxslpftyqvpdgnvcrmtwrmftodjaqbrfiaavyfmibcodwbtuatjndyuzigdljpjkogmzewlzvvzizetanviuymptictwdupivshvkahcixujsheyavyrsplmksqgblopltfgjizziisdaiqnydmdnplfhbefmrbblqwcwtllkorcopyiltfklzjotyozimgysnbmgkrhxgluyryejdjjovcnhlvmkrbkprjyosspxzapyrmerqrosmtjhbnmnyrfabyfnfncywxzhjnmfmaevmefbabflizedkdzmsdoygkjjdxvtouhhxgtmsilkzfzwdbqrnehhbpqkqexowyrvhlsuqspzggzvjseyikikzoqhzyuzzvdshkgrzvjamjplhzxbuxxwluelaukoatgonwvwlmvpdmjwnnuzspqrpiyqwrttsnmdzndhwgprgozkqwybnajfgrcvtmbygsagxeyedgrxtmpbjbtduesrrfontvollcgnwmoyedhovgnobrgtldcrdeuhcsumykhyyhhbyjbqwvwenkrxabrfzzrnpuxztavyppukvgdfbwmngmkgazekpvvwgaczvjpdnaxbpzurprcjvsptbkjmcnvasajvpwwtzuysrxawdpwmdzwpalzsypydtxweoxgnlxroqmthqgdexurdawqolnoisgxgfjizqjixivxkflpknhpwqvaukzhjolovdosqekhkttaxntzzitqrdxrjyhdwixbihlfymukhoiqkwqdtfjzlpvyzrfqklpksqrrfpviandfshtsazjrrhehsresfczwazwokcdcibnybnwydhisljsxtvxnzkcpqktytmmcprccltssikmutrtrcgdyltqdssxxasfprorxfuamljmgxsdhlyyjfquiimkvgjtnejkyopocvgufilapzknymvxychpanhlmlkwhutlyyexlfdsffuerusdbnefnztrqpso\nxsuexhgryfdpxcwavlxtodownixgwraxqbrlcxhvdttktmgnoujscpvrwlwagexbhbzkdfnzslyvraqyzkiyiawcmdrlubzmklldfitzuyhgftrmomxuszatfxkpafhzdvxvooevucbwlnztkvzcgkmijoohmzicndfudzgrvofnxjboojiegewbacgbpaloptookenlazjttykwipemfslyoqyrltmvphlzvrwfacnajswrqqjyibdltqvsoivxlybxbrwwgqaclxcxgttqzsrxttatfwbfnmhccfhstxntohvfqvgcevgyefjknqfywmrjuqegwqjaputsjnbzmxyosjteqxwevvtshbqdvvwfidjsmwtbvyazuwrfuakcywewyxjkmdurdyiglaxqxinvzgrrriuqjolwmbwoxqntzqmocqtkmibhpwzabilywkeytdmbdrjpmrvqlbxztvlukamyldzgddiujstqlvuvkzyidsapbxygnxbvmqmgbreoickybowqxrwwbshemcisgxrjwdrenvqotvqlddpdommatyloejqyxpewdfhqrztxvwvibmnwcimspxaxtzgyqwgydpjkxsbtoefhcajwphfpzhdcmsymgkdwfazvueroafhepdgxreyvmrhlpfeuuctmuzxfalmjjhoibqhzgvbjanycwbhwyudskhztzzgqulftvqyujbhazwbbqhdgofwyrxvewjybbrkkskbixngyuiisyqchwpqshlbwh\nhgosbzzflvcetxcqthiqbzntbkbobnflhmekcjvdpfittsfvdeyptzqsouxqzuopabmjhmttkkrhsqfvewfqsadrkflmzocegfybaevpyfyzinxbohxxbewvrrcqgfwxqnaedhtcfuxrcwrdjpedjxrvaurypegtijqbwxlobpeyjldakqiiaofggwoyxlmnarjdnxauysysisdekesobkgoalrlqsrrfdcfuwjfwfllirmetrvjffgkstvjkfjzifydlimlbcikxuqhsdhzkuurcqqukqeudywkqejhrbtmdhnoyqsxevpmzwainltqupqtomolcbwlhobszmwhmclekitsiragugqbqcogfiyfswwxyaggnfegvqygtqkzgevdtsdmzmttjbzwrcwlgomnbpggjhjibputjcperrabysbxjsalojjynozklznsibbiswpzhttudsvynieztyhlbdhlpwvlhusuzdyytomlsldyheqctuyreialugdacgklbrwwmeklxvdiqirhpdoazkdzqfwv\nxvekxzhtrrjyvwvriirmdjiifchlbufwodmtiqipdfukecyqnegmgbiuyzgotvihfdynmdrrxbbxyrfdzlvootrevtpjvonlxxfavgxbpaenmmutsnutdanazrrkxvdybdjnylebererqrmkawxrrepwmzhdcaqcniizkjlmpqgzumnqxzflphnzktgnauabjutgvrzrbhfpkoslpnpiameodatjtuifjuilcfgaboqicmukiyfuutggjmcfjxqevwcirnnzdzmzqejvyaivysiothwipfjegeeckpsrcpciwkvthbwgexhunrmpnckpkjtgjugwhwngwvrbwaqsotnwyprytgosdfawssvgoionddtebsikihelhwgqsnwodezxbvgbwhjkfuwqqrbzwxfmiianwupmelfewyaapmdiypjpxfszrlyphhqaheeuoduvjsssjtdxeqfiikecjtydotairyqwzqvchfxvviaqzxlytskpboitzvnlslpltmehkfjhdgnudxmkwiudapflpvvqlncwkzyubxrqogrniynugrhqyukfsrmqjswxhfujlbjzggrerijxlvtnrjcujunjoicpuxambzwocebokmakpisbnuyfwshnlkhbeshtghufmlijn\njbotpqiknnmiididasgyzuquqxofntotuquovpppzllbqypdoykjhomrvlyapvnhbybdyruxhjasgxmkjxknbqxyhdufrkmypkblamanarhlqdzbssrzmtfxnnjyehbjpnmmmwrwxwtofqyidwcunttmxggrhpqorjbqeeoarronnezvuudmnltmsgdbfmjhzmauxnfndxduomfioarxnrvrubfupzrjiaqnpycjuoejobuosjqbrynjmbaslkwdauwxygkgxgjmnfmoqhojclkftnkiknaiwpwkndtyktazgnjoglzjqaesauvrzxtrruegfvqnqddcmivcvobpqykascbvpxrdisxsabjdhioucegqboymszdnjgfivqkbkbeqmarcflhkimovfabmnelemvhugscuyrtkecksdjddlduadccuoiapjfienrsxfkrbkyycshyxuxtehdujgbwyhtrsaeqitoqxlxunujessjdyxqmkmqphkvwoklkdxayjspdhcophaxrxtncpmiorropjgkskilflqnvuwahyoyzaydignjejjpipzraslrjzswbdrsqndltwbrrlildhgarroxyajliulensxvqljuniivaogvwfhisywagmzyyauritdrxnhcywiwpfcpfxsdhtatmeuokgtqwuovmrfjcwbtvqjngyiknehramlocwzyeyvfnxouyhrewgqvdalkcmpxrhhgngpwfghmpzvqfldtuwusmpgbkohhbnkbcrarpssphbnvbccfzmoytcecdgzmpgdydtdxngdercnsvraxdiiefowkfyhzoptxswdyzivgplnuagweoplvuzfjyzezhvrjcdbrujxcmqudxswbolugtxzggrrbpgqrwwnvcccczvdalzgytwevldbeslozmqwfijgyjtppgbxcinfxsfyqwtzjcfqjbvcbjtsdjopfokrrljbrxihnsloixxjlwlaqdos\nmrjdnsqeafgzflikpdshigcwgcnrujwoulwglwtepzupvflfdqgdjctnvcbruqrnxogcwizlqceibcthplhtmzztevhzxtogogkqsubpzmmxlxlflytbapxculktvrnmxsrrlftnijlyqisipldqorggnwvlqshgyzkxynecncpeqrxedmdteupwuiforpagvnimfdffmxhuclznxositwupllmfmyxrmoyotptuafoeiwrqplkznzubnuhgspgehabdhlvtpwxuxycgzdejaxfbkeieizqfuryllssciclnjstarxzlcnmmbuuecocprxmnhwxpawuwguerbyywfwbupatkywrbsuvkrkmcpktksiynccmpvtbidamdrwwlgeejzsgtxtcxgtkiijviifrvsveeqkvwprbjsudodjusoexdickjchfhunplrodubzkmjlunzmjgbnwbjfxdoagpaqqnvhbmovzaezfryjmfekcueehhovmijbdzcqohambcgsczaeuuvomvydifwhakvgnjubsnpgzjrbdmizufrnoftjrqykalrwszfcrznfjqfgzmclnnjnzcsxppcghklrfuptfnpecdoxklsfpfuqjwcpewugkyrdjjosecnlomlbiiamvhlxgubxtwomqqotdboeffdqagkwvqaagbgyxfupeixesnwriceaqkmhhkmfuivnlwizrczygaynqnaeqeuakabvcenmbwrjxaluimmgrkmjfsmqizfwhojzsxebcj\nkhljfehprgzwrxtpdndwvnqrbhenvlgqwgfunohtiuezphzbgoibvdevrezuahpolvrczwdewoevnzkmhrioyegwhizckyxhvdohkdgxjdcqcgnwqcjyzmrcqmvmktorsauzagyvppuaqnxtvbpmndnwlsnkpmmoopfclaswlfknzwskjmkuhmifiqufhektxpnxiknehdnaokzpbwctrbxxdihfykyytvkwhjfhvwypdzmxfvnnvxvaauskszuxduiecgnzzqptqoqsvysydrmzihlsnggygdtsevwboqjxqtoxkhumxomrvzpjketdatznpfiebpdtqfakegvnrpaehlnxmuysdkgqwwmwwvdjkbnrtqavhdajrhiwzwxzabanzlrqhlqkysmroykkbhgoqzssfnjmpyzdgwlgodfuortkvunhvnkfivvxxablmnblwdoougmccocbkimscazghzvwhwbitzrdjohodybqyovqajlitbitvqtpncmkvzskkkbkfwxxqrgqcfhknxfoqjlwarapbfzeljdarzrlatlxzjvsghkjmlrxosgvjpipysxvakaiejuhcgxwtodjlgqcjrvihkpnwauzcwftkmfesduhcfjsrtcqijhohitlpplfxhqszfosofzshcsguvakgsluiixbxfyicupycxfyxfazgsodendaqauhlwsusvcozrvvxuelkcdlmbmtoejxzwcjxuijpsfbaxzakoptpahcuuxwfqfxslpxbfjkjimhhqdbgaxhosjgxztetgycgbcjmudpmfxsvdaqbgvdbdixirmsyibokgwjddmmgktbprrxpdotrslhutjrxternpkxfwcbrxzadseciomtjoyqzbydqfdlzipvrmpuebnhpfqsnclnpwvutwjpbhheyspvpbfxqjcmjkuuxeosdntiscyzkenfyvcstuiftqhxcksooesorejgdeotkptspvpiawfeflvuknojkdryuuhtoemlmlagdktucgpeekqbtqvxbysvkdgglfydygncrcshbplpfmmmqwhegcghpgfjdmoqsjqzmwplkjlvsbazauamufgyusowzxsgyjiaypfutnhethjhhrqdzrukgyii\nsxsjjgbesyeuzsqnnlwppwsvugxzzoarinbitcluxbtqottzudjddybcqbctkqyktunvvfvkppimycmxfapzvbrisyqkirxeuvsshyzljuzkqghjnidlukdcfixwtilngewdnrusilbkdwcjasidyvlftxolotkjssflucoxnkiatkpvujkwmpclfytleiwtbogawqnqogltjzavihivdpvsrrmogopwaytssafkueqdjszrulnsnjhrnkfqbergglvkgrmtziqcmrqnburdkwlmxxexyjcpwgowqinrijvhgbqvuolsprjpfhuiynhhaqbtutioztgqarpjyfjeisozeankpwknnlokyscfffponpusyilbciqkyaszyomhzzvsfkeprenfwundoyvhgjlposozhjkxcntlowokasyfwyzepcmnlyvwbjfdffaetigrwyycraudcksxpcsosggdnlvhcyozvrncxdgnulpfdxfhnsmiwrefwpwhnalssemzqgmymnfebbokrilbceryeosettkjwngdovlvsjuutboakgjwgdmgbseimqzvgsrruibyjwurclxqnayxhxxmwwdzhyvamhdrpitgmsasdesiuiekdnpdzrbiagyansasfatsugcbvdfcaorlyzxubzdnckafuzkuhzcmanmergmdneujjcrbymbxdlzm`kihdsgkjdcismrtosglhnnqotpeoftesjiiqvguagqngkmnnudpwiyviltmmkgjbhcpeesppvqpsijjlaepaibuzvfkuqifaflaquhcbzkjvxottdffkgcovfpirweyxwbdxezultsmekwqikqskekzohyxdkexjyrjirjamffaxnbmjwzuzplfzdivtowpfpolevpyrlfvcwfbdtmvsxfyqylozjgfegijzahqvrhlpwkyafhaarkniezppwkqvawbawnkxdugwmqwhfriwqqmalfikryjjiehpzdsfdvyilxymegdvinbjgothxgnliregbnzabhnvcnpjkxhowzpsvlcdxxztuxtwllskjidmvlgdkzpumonetnwzjuuqqiqmeoqwxtiiadgbdwdjjdtgpgmfjnsowarexgdowfkgmosclohqamfcpnidsppambsgiltsbgkrwnfhjrhyitqzkksbtusygdkroljejdfyimdkkdycviwdxjlizynoayvxfuabgglyzxomoptndzdabctqdlkmadvxeaprqvsdoeiucvuctitpmrqfzbindgpfkrocsonunranqtzcadvtesdvrdprozprbxnolgkljltqxtgvdzggcxmlazzugkuoeviuinzfwuhumbsgsugihvffvohbbdndxdb\npcscpxwkjzfwklhyakbygfwcpgbcbykyopqqheenhzjauwlurllydsaudpudbppenjclecpsprlreehngpaskthgqwulbavnzekitfqnplygwymynwgruanejfdmgpxvzcsrpagdjgumpmuekmrcxlsqyxsvtxxpummymxvprixqqptutctwglxxzqqbktdtbxjlsjdgdeavrrhrnvkibjzdgsunklcocllhncjfhdrttstefrpvhrozpjmgpcczzxehufxxlgszfbzzwzovlaqkmnrcoetlwhkybylftapquqvdgrjbdkqvnajsudmbzrpnqrethxhjmbqdubcthtwzkkocxjxyfzcauyikoillteumqhanorobnellcggjbhurutyppwhprxutxrkonkdopiilqmowbtoboxwzzjpoybyfspczdvllrsvbbsjutjomufwskadwasoffzmmssjaeqmcjemmnxmflpzadfegazdmhwglgorqueihedjjcihtecpjokkbbafviqrvtmbsrgexaeagwihtienbipfmgcjsrarcvwcjwwichliqzkgmwnblmxuitplirtqxockuwginpmxmwzzcwvvximumqvniibrnqmtocrauojkaitmoquymrlxxeswzlqcbjswiafdloothlkjupiiblzpyufwazruwnjljcdsbhckrmhdhckflfilybupwstyndakuoojzrisacprjgojpwadlbioqjsjlqpotcwihuqtjpszxbhfmyfbuuscgbtrabptzadbzjhtbjtlazoalubtqkyifmyelemgtumxilxxqbapcmrmghrkmbopomlmdckniokgcbszkkxyfoojatsvttwgomorlnlyjotqqpyjmbyiqtvvfsicaayyaztnorzuybqomvuigvvjxvqdnzudmclkzsyipattkwbemoqevqsspwgsbkuwnpgnsfvrnhjwxymlvdrylaypdcjiirwcsctxazrtfqmbadnaoszwsqvdmyxpqcshgydqgdsskptwrlgwzchmozimnzudbcktmkgmsfteurqaltvrukfvrbewzqgrmxytrsyitulwmjlrbaqfeknrmllyvlvddabmygrowyuyhnyjofmwhzcxcmvoyqhbnsxmsjpoussyuarttgpfayvnsasdskeeaunbwakuuvdfeljpelljytknowklsqexawcofgxitzhnfylbioevcrgcffokfxbwpmexlrqlaqbaulhsvbwzvvxeklapmbozvyfytbaypvnztxyqlupcylvtuetegkprhkbbamikxbfefnsgtibuetupwfffgooewyuhvwuvtjvqkyfmymzdfqwxcmrbhjziybnpltipyynjdtbglvwyuzlqztdspvmfkuwfzvlntufxdwczfdefstnevieghxqgashpmughdvrtrhpncdiwwukrpasgbyerqnqdumrvbmdrorqtcgqldcsajdozhvscklzuqqjqqqpiezsthuwjehspeoqxqgzfuzmgtjuyqsgkkvqpihojyyycngbupgjynqbpqeyamyirsicmbuudpjycgbpgitqenpwisdnqmezivbmksulfeomnnkqhhwuwmbdkqkvgeibtzcutvzjtfmkblcypfovngwpfpwudxuigimaqrybeqldngnvwipjzoqapaqirsqotuolbgsunqwambyhhbqjwjwljopagjitbasygzogkqavypcqpktjfunhzbnibhuahctlsimhjpznhlnlpjbogylmbosteaypvailykufwacstkagxghdllrkfsaunnbehjpuympeyjcsodehclvofjayyiplzskpexgoslebhcstjptaknmpynwatnlotqqwsxmnuiyxdhqjjnbpnnjjvltlqwcjpihlfial\nufyztqscjxkoegvwqcvhokynplwkfjraqmnhrvqwwoplqqbjdkxgzjgdqzfnxpdaisssyqythomsiqsvnmnqsgnzziikqgwdjbdxfdqovwuxpkaepfrpgarlfsymbwvgsnolenvovjbzgchslznlqgobaybnfdemqrmcvnwdysbjchjmwuiddyaadxbtpjfhmmfgthkjhbezbcmbsbuewkxzqtolhcifreyhiaaeiemriccjitmcozpbalwahktfauxmnvslwzzfhmzciilfuqwkmcxibppkqxpyxgralkzqyuhsjltwjcchqsnprwfrufcevukhklnykoldypkzzzamtuhecmjwurwwqivfbvardljynccsvuejnzzxeqcjxazhdsrtenoijymgfnlnkspfbldoyyiigelttuklbowyqrtfqdtjbhoidganqibheyzimfkbrgehppkdlmwpzeouyxptetfggpvdbmbgmrgfwzbairtbzdclbdjnvmjfaprezobucoozqlppqfexkouetnlhyezazxqblittfqdjhqddemzfugrsjkbnzkgrnrkiqkrtcqjtanpylkogornnrsffgoiuhykkpactyyfdisisactabnjvsnuykoinlvfahfhwcquagpmzvtezuijoqmiixvyassdmwoayfyezjftqnohgonclkiybcigqzubszjfhlckcmvdjujreqhwjgzhywtoslbx\nzgoeqxiiokcfqkagsbtigxivaijsxmzgjxxkgcogrggnfaglnsqkbgeyeikufbsmgsrodztsslcgklollfvvfoeihwpeifrvbazpvmnmovlgfsntkqqhftxcmzhhqbsqbboxpdpqlsruvzclgbynhriqxxzhvcstegzidphcuzxyjbyfvqwloinlgsucyapqqecsylwdnxiutsnpphtfjpuuabzjxcljkheacyuwjaexkneciicqgdsejjmxzsyvdeobsiylkbvosfegdbkdefaxdwyxdnnjvqxskrheanfhbsirhiyqvduhubszveqtdpsnoxxjxukmnvzayxitnftqapxdzjqdfgkmsytejdfvslaehhnpwucsigzhanznjnovoozktpdgqagrszqidnsrptwxbzkmjrbshakmxstpopsfbmkomlodhnktotoplpgmljiacrzcippdggsqueqtpgxnwigazfdndqoyezmrnibbufjsxvoanecjrafllelrpvfbauzmirbnveaqybfmxqbrrakgnazgobefaaxxvowzmsqbpyjvrvvuczqgamovcysaaobhwyvcxzytanfapwqlglrlkldhxjulbhrxlcjflasdwoirxfuprdslnzpmsplkncqpaqhguojxcltqqbkoxnybnrrklmdqrpofgekrizmzkzbqwfhbccafogttbbxzhqxakbayamgwjqllqnlilzhcyqwimmazohquezqsjsacfkghbogxqbugxawdzwzhkiizlmjhlnlzmlmbhchndkqjmpbcaivttfaetamvriqeakwpuukqyqjmnnwsdaddtulbaowvhijpzongztemlfcvaduuslsuobtsivoqbplcltycnhgjornplvakpsqkraiigdfavzdsexiroghizggykcdmnjulmbxfcyatxzimgeiezzuwpdiwhpvxuhhubsyazqacvmtsabxtmimhgheiquqxtpmmrdozhgvddhbyksmjppyhdxpylewekfqpepaybwqohytyttkkqssgmxuvotkcszwhbxngnourlihmibhsbibtinjlymzwnenwjpkzrnghaqwchdwucksuwuecxiydtrcawplrjcnhkuswgpekdgabsplbkpmhpbmvffhfxlyjzbefakswkwmjhpzwuircvohhmocaksuxtxyojszmoqnhpbdjoudmovshqqlpasplqtlyaozbjccpozo\ngqysmpzxuxhbzqcjrcngssbbkftjjmwxzogekehoikvdmxcmcadywpgezlixixnvxbzrxcwdhgptwiqfmldkqocbeczkezylolqembpiflzsakcwxqxdnkpgqhlibtpkyghvjnkrvxgdjysmydqdtxqzxuieoqscxojatnbyutknxvuhkygvphnhadhffbbhwlhlrwdoherhsdunaspwlblyzfuvrveevljstoqelzxmjuqvjafggcgwaldepybnzahqbwcceaapahvsypohfwsiutcukynpugzkutternuxyxlscaclbazbaifrpyuknbtskdteirbmmcfdsznwjzvpuixwqtssjhuwmtrtujfchfiarmpeklhewcookdjabiithemrxvjymjqphgradfidxbfbvjfsywcheccssivkeozadqrygpsyaxqjjeqrvisueeutmbreyjntiqzumeilrvkxfmaplzfrkvadlylbibqtnbtfhxuijunzickwuszojhaaoinbhwvjrohzhsqwijgdkhzpztczgsewlcjddnalvxjffyuiywtervnmdipjrliqpwhdsezvanxpeeawlxxokslllkaepfmkurcfrayfevibkkxyivgxpdtiuwkzbklgvcfazmpgipkuzyjwxxpexrngfaimuvtmhdwqckcyvhnqsgzyndqwcprqznybzddzdvceqrljoajwlvkrgomnawfcgyvptxeyqcpiycsigpiizdywddotkqsojpesjtmlpttiufvwgnacrmhplyvqhzswgnsbvpxwjjozvgnzbpjlcqjefiwhxmabkreocnhvwkznpdovchzjjyumoabawehenjshozmdvfgoiqhpsvksvolkzahlrxdnuszjsvhrregegdnbjkvxrktthdkjkwuqkzhusokdfkychmuvenazlsslejpqwwwhjoqu\nronyqshwxwfkkujidzcvxkvqbofovqgubvtdgmlikgawyydqossqkochkautxvqvmwrltoqxggbjavnlihrbsoveqiezdtyngpaowmsiahkuochszclvgshytbyuqqdiwafdteqxljrivvdaxbqvmtmcfwehcovuxaesfctojvcjspgdjhvhxzdcjnnvrrtixtdljvxqpfmenzqpkgfliletaqbynuvznsxnjrieznzfmhhbhpqswhdsnpwjrvnggmgpboaiaxngqibncnskbebwjhnchgyyvbmrqqifxqluoididecilzmqyakavhebihebpxwrekwchjfhekshwnobkhufdatbxkoqvbmkscsccqjvdzsomxqywijikyqncyjunyphzdpkrlcnozlqxzmcvqfwuyghfbbuniqdsfwvifrqsmrgqcovjrfgtqtqgnenlqfxisdtmqolmmgjqavqlnrdfdjxgdzqwmoenqwjubtsdatnu\nzpuooqrpuvefaerynkuxnmqafcnqqjqwlkyweokcmnbnzwuywnmnbttfgcbaowudnmuuxnpsoufznneededavdwcqxnqxnpktafgoqunjvdzajckmblzrzjhuckcvbyxgozfdapdzyjjofmipvrwlsjfcgdwxrmdwzuxgwpgekdlqbbjcrxnnwpzmkocnywqmxdptltnvytrzgrjfkpiemndlpexjdafelhbbshcspiapolbkxpdcyxqfilraqigizvwhqohvobmajypjmuojuogsjqtbklwvqkajbdwjqrguvoancyjmbhpjhmygpscrpespqaticithnqadlkncepjrrhsjlvpotnothwysokzftfyqqfqpfpuwwwvsruizlatofazijpiobpiyfkplqlnafeunakhwrktlsuxgxwlvzznzhbtv\nraflrexsrrfcnribfrqivgdkybcvomvleeglkvbmhklxesljqjibfapjivfvtcdslmfjmqhssqbfgdoalyulrznvmhuyoxzgaakchhppretonbsfiqpqnadpwzgwxnwemgizzivhrxnqyuhssjaiepqlxxzmdfppswxrzjctbuxjpjdgijyohwlvkpmqvlgcyyuxuwnezqttnyvrxuxmrozulsldildwlsluntcrxlshlftcovnvfvlmenesezchmysfqkbxiffttqgojegdegmacumgvxqyzdwrisgsrhmawdsxcqnkeqfjjcrgexpzxfzdkpufenlqfcpvoyhwjuzslrruibfwmsmzsotiqxdzwtklokgfdwnmwtfzordsdmrwvojzofaqicfnwkwwrxlzvwejzvwuthmxnxpvmjicixrormrgazfsmmxhnkykazsflxephdalafclmigyadrbutpriajuponbkngaernvfqyltdtmmocrwufotwulevfqamdhracfrmipabydxkgcjhojxpvtustzlmugtofvrjiowikgbchzlphymnyfugiccgjloryiyvfdczueeyszsddbzypawseskqsxlrlvkcpthgqkbcoxelqjlftllipiuivqpmorwiwkiuskrchehxs\nactlgkzbbmrbasrtoafnlsrjlatalhjbcodtzjwopavpzpkojogfoyxfiavygpsvqtbclkvaiswmszhbecpbynghmuzzyqqhpwfijjfwzuteqsionyuomrgzfkhapwdoipgwnzelthpuqhmkbmglfbwikmbyuspfmcmakigpdzzmlkeazishhvxdidmsoamvrrjkskbjznkdzfhnfeexufxqnlthglbdjvsjapajlsjkaivcceobarchkmicwrsvnaeytnzxvayvonminrignjgfuifeklvywjlztcmonxlyxibwmbfitzcqjzslzphrcjjevqftxmtjvlnaypgrzryrumyiyukfaqdgnhiokscajlnvnslmgustkimwagnvhilraqaubleaqeutqmqgpyvblpagpweujhrwntwpresbzeprwrpradmcsswplcxvzzbuxmhgyzzqwpnthicyqzhfbzqgambaqwcgafdlbsxfzxxynskvbayzbuecaabuiihrusylazgefmyxbxmtlmxnxjnxpolaiuaamxbrugmypcoankmoofrxtsuqolexzefczgyyqdnciljazxwzljzgyrfvsqpcnwezgibboqqmuvvjneptwbwdoxkqenngacqgvjlqxzaagptqwdbjhrltakcykrectmljlzkohfvdthvbdokqvgklltdazsfblenmpztvvijvfnzpkpdepxrwgblgaeuitufsrqmecshfldchtyiwtwkdvshojxztjlaiprljoznczrrecuglmdvkaufngbdhaxcqcfnxelvbzxubkrhoxzxkrpqfougxlpdelimhtaqrkzlupincexzludifmxmyqiuvauqvxgixmqvgjstcongurtfroajfcqrpegicnalmrgokbujfdyidbpelloeldjyryqkmocwwhvixarrgo\nnwfqtrqosxqzrobhskwitkpjptebwaqtorwaixbydvfyfxdexidcttwmomzrdlhzavqigwtajuvznhstslyeoazuwwcioiksyurgdlfibulcnvtyjqyosqyvpbzedkyyomyjnnluljrrzelgkecysmrlxkwquqbkkzofvucxpuwizgllpubgatfeknralnlgcwghvlddwszbmcpgqwteycdvbtzclksdgisxcbwgspbausadblyxbedckmjcpgkysskchxhsftanjkldqjxzqbgvxybanexnwreifqdfqvqialsoiytgdulyfobddpnatjqjyardbfojkyzsqzkegycfrhjhptufsckxfkacwixjfjbynprxrigeftmrylegxxeqfivcorpczcdszrfnypyxzomwpazmwemoghibmtnxvwkptcmsoroxsnpeejnhyicpkhjnavyhfdyvlquxizmkmsgnvjeqfgxscfhtqwsklqtxhtaignvgnqsvcqzfntstqepvxpesdarfkuejqwjhtebqzbjptwkqqwjhfcfaccwforkesmupnpflduzajmtdxuungcdadhqpjtulnygyiorzvmpstkucoaxrydftiwfldtnggxwcukseptpwmaffihwkfmcxzalkhuhnvacjfynzvyuoolkqcdmbstknqlijkbtioatdjireouphqgnznxwqqgvtcklasuovptqrjrsjuuceiintaqwceraznbdohojtrgqxoigyrtuvmagsqdyzcfiznmpfhjeuynllrmgekzcrvhkicfrxbqusbenlxzrqgtbtbghzbrwtdywrqdwaovswqcfcubipokptbziwfgxyxtzdmdkmgbwammmgcojpzrinqeztgradnnhksemtvyinfyfszxqghvjxvzglyvbahmxczyqitybdwrxcjtlumoiyvhvkctxskihgbzcvfbeojzivisgkvduagaokccbbmqazkyvrptmcetyopuloesqvuxpvobjnnnfrfeixxhattmlntunrrsurwygjjrtwobstnuxtiewtbvvzmmvpslewcgnlaqcwxkctunvxmbysdrgxwrgjeitikiuxprznklwlmzboiaevdvkkiaualcupfkucuozfeuphohvxcaegxyrzgtjwfaqfrzoofhyor\nindrcginynqyxgkgspllpypyuzomouvnszxgyjfnnlambvtkrqdvohfrnifiuyyfgngdriurstnxbnuaidikrxazewrnhavpagbdrdlniykctqtweqynbuqpwakxmegqagflsivpgeseomfyvnryommwcal\nwkfgtjtpnyvgxxcuhkrhrwjcnrfirdoejokxzkurspsmygxrfxifyncnwgtbrydwzbjeqhdkuncuwvfsrzgispssszhjhumlcoothbznfqpfwzpgopvcdmlpvtewbcvcqdatrivlbxzmfcdlqvgagfhhfcebrbcsjdvjitlzjczkbudavwxfekjmqwvbtijpqwncsulqfuoxvtnyjfcbpswrfxkvdqkywwipubtjzcktqfmkswijjbuirzrwhhmfklhwhyflwuxtwddlwhmpxsgvuwspliodqlnoojgqgqhtczgabuilsdfptquhwpmgiaylaixnqzlqyrbqdtwjfhcfxpfdjuihpseszzmilumjdhejklrwpuvfmecppzdheygfpyffnvepgzkcdukmyffdxfhuaeflncuvfanbrztbhlnrzaqeewkusbkaijkwdqgparodcefxrdvenjiqcykukzuhkufwbubvqqyupqhorrzcjhyfphwqmthfxlsqvarxauytanxojdcsfqoidjiluhlosuwhgmgidjkuxjxotkuykewmbqiuxknlnercvolyxnlivzawzchkfhbgcwnoaljjgxpxslrqbdvizbkvhsapbbkdycjuzqbpzptougkzuwugysowppnfwfzwkiidkggbownxopgkwqxyoyvvntqllholmxjbojikdqxmoxnegaandeavfudctzaxtlgzqhijibscqyreqexqhgnmtjzvovjkuxqmpyojvrvzlufdtivfwwqtzqfpwdrefdpbkqgxqzaymluagemgoplixezleruabjhthffmorxbsaubfgaoroqglvdcvrprfuxvgxxtgxmaabrnjwonbbnaiubkhgvbjefuyxfadzxfinjdknesmnibvbsmauyodgfpqxpyprhsgsnivtvyfkmiywcyksurhempacbycnjmlvwxzpdopculalzbpcbojhpgdfevbpdywairjawvzrozchmpcxcknpsnggyupjdflnvhrovxrnkaegqesekmjcnrlpbsdwxnxabrllattoljjbdhfthlzsavtfiovuuhnbdulnkhgexmppdsdpbitjlsfrbkdcfgzhqkvqfiffcotcdksgeodapdnpenpnuzhchijxnwsirwkcfhtolybbzzuoetpvjhwmcsqadumhwzutbickyaltpwbaxitkcwranuldzxgzvagvxfhuhromtzcvgznjjfvcqkzvrnvxhjpeympornrthnzttdlxdmrgjrsosvxmalfuzdxssadoijngszjerahqfxyonpibdlrusctaztcrrmvamaohvttlswmlfwncayhcdqbtahiayxsljonybsenwchkiurghxscmbmfhckatrgwklxxqqzqtiwjcmnuvhpieiqhlajtyqrffhmmiihfmhnujpxsefyutxrzmcdqyvltqfyrxheyiecgvyshqkuydnrkxgfuvgalcpwkovmfjcrjfisjyjtkhuxuifulnuqltlxrrljqjbabbamuziypseapzcirxvvhlvyzffxxenxwpfnckwariaqxjseamitcveheovaebjoqhzjcvicrjgdnqgtmsmqhjagbccvdevhgcppmsjccgrftczjwfjcangxfavfxpmkrcgbrrcyenznqaoxbgwxygekoiyrihjqnthkcqqyjablfzrixjntlnbxaaplonnyjytdzsownnjzaejmfsbnvgasepxsjnjjrsjwjbkuazzgbwdkzhumknuvjymaljsfjdogxhlprljpuwmgbtlw\ncwqpllhocvhdlqeckciutruvrrubsvkbhlwvmovakqvnvayvvaeljggzmpgbgdxfguoxhdvvtkbvlcxqvanebhjzsrrqdodlzpvdkpfytepvrwqibhijcqirvopkdujdvdzxgbhfzjqevzdjuspwummurbmgdsfsvfwvgtapqmuwcqcdrwihpdbqgspdimcroynpklrpwqplkzwkfchkarchxqjdnezqafdsogorpmuxkecmbmtlakergwkeupgzxnsuyksrpqosfofjsbuvhurkbhfwdigriffqfakqxbxucbwbascajsoklsbnboszyyhvmvihnvlpoclupomzbaoydukieaivcdfjsankjcpykaavmgxxlzxcjkhkmkeumoreiuhoozpmlkaqxbfyfymbtknjksjaqazuplllglltwjmdaalohndiazugwoyrgcwdeogzaifaswwswpcomilxiegxthkfirrssfekpagruepffdeqhrzyxyayxhuksmloudgyewpyvjmiwoxvcmpccsxviuoqgnepyoobniyvokxdnusvnqqqrpimtwwxyfrmyffqinsfhvlzmauzeeoymudaktnyqaphldqbjhqyolvdyjgvukmpeumncuqzsvcivdqtkqcnmwfpldhbfbndtypijzbzyomzwsxvdupvnqlyyurttptcagfivhrfomidtwrxmtleztkkpvagrgbahjqrdppvtizcoskrxixldixdwmdweewrucgnfijbkdpryswbiyqpvtvzsyhwcrbniouqnjwinshmfgxbsuebuualnqyhlciiliyuuzzbmfoqdjlekuiswdlfbvlnxvjdjhvjcngceffhfyeypdpyxfnsoixgrhxoluujhqgcvqsnvfcefybqedqrhgiwqzxqxnhvg\nobnwpsxaakgeqancpsjmppfjlannlzdkcriwbyacnjlqvgabsfqgbtbfgoazhnpscolnpordldkenoqqyaavwgnrjomaanayfyfwuuzwlcjhfabtwlxxlhunwuipargjstswchvjihjxecbzkiqxripuomxpvjmagvcbwhqacgxjwevqgfwhohdzmtytoduqbjztwbneiapjhitzbxnnkmyisjldkkwqfdikvjpqywbiqnknderdytsqcaiueghgaozpempipyljotmfcumelcfxtuzoaiyhktcgziniglvsxpjsilnwaxynurbaetscdsqftmplnggnssomwneqgvweshbuwbmyfdisegrflujnwwtmaavfpmjqayylwqboqrkavlctzckqjjdyxwbbjtxkewauerqrexiltfhulidrwysbertmbzccapsnhjaexlncerxfgdhradwvqkthiwvfvsqlwqawlmbtfirnbngftfstxdlfichespakshitqomflnozocgcwkwidmvochzffthrnkoinvktopngdwmzfhyvmvdskrcqhzpgmdgcpbeohyxufrsvrybfgsdetplblyekheniwazjrnhevtabdpkwztluwvtuhzaynpmpwcbvagnjcgztlgillcxlppxasmopnilijzsbvtbussxawbtvksrclrycrkzgxtawwkkfaewcnndlorflkpdkvxoakzhdaljalfguwtiepmzfguggwiouippnfcmdmixxiuqbggpdbpxrjrgdrffaapjjbrkycncnipmhufmhjgqeibwvilqfvddexfohbjmrqqrflgtvztqlxibpzofxyzcscmzyfeqmcpawlxjdtkkigoyaetpmyaczprmavobnpchbnlqhemigmlkmeswtpwdikkcckunraduhwossuusdkpbguycxqahlnugkwrqsfwclowsfritqxbzfhvefuvhkrnppcnkvcalnehakdnjtrzqafcuqlpmvfyortbywyffcvtgtzvgejzfiejqgmixbdpktzdlyqdwztchbuslzkftquixrehfxgulpmdyzvkxnteixlgotaxszxffwbabuxbtcvnaucyrpcemvmdvyblyrfynfysazmqdljxjkrzgtokqenbzmurqdzcbjypdauqxhrjrcgcuoecvhvqwlspibwcxvdmodwwthtdkjmrfyiegfhfzkehivvwccltyvwcknqyqpqxeavkqdfqkoobakmdsbrooketekhwqhaheesskxgvnyiqfrozxiixvjrngcsonhtlbntkwzzynnimmksmwopfyvusmfqveikndgtsgusfstmrxtyqatqawlaiyornhyrtuyczcgmiuicpwlydukjbrkmzpya\nwrzbigdzsvqrfmombztmgolgsmdfkzzxdkhyoxelyutnrgwfrzw\nqzwsmgezqrnxprftxrgmaonfjcolnqnbubjkbydbhzdsjtoqrhpksmkfoqveqf\nmovddpikzmajddnnikodvhojygtojnmztnyujrpfvvbuonquprpgmktuibsiqxthqjupousdbnczvsunpylzysvcpqmxjppopwggcbqrzdkhgyavkpqbrmlazuepmqlxiwmfshsltjughvnlchqkmwezrtexzlichqzgahckyhzgecagsqmojatalnhciqkqlfuykcubndwgzroywkswmxxhklsjolkqcteacndkudzxwjztxcdbjfleqtsrzzbynegbsxpkyrpwoaancrzgmcwoyzgeosubsubdkhnhxpavlyiihnioztumowrgioclmqeeurwudlsuvuccccjzookcoekmjwxacqtjhftccxixkuarpqrlsmuzflxdtckqyibpjaxzyjdakuexklgzrniwkyrvmjzufdtslnokbaorllqawgymwdlplcggolhkzvwribnrwlqotfuxagsiwdqsduijqoeaapvzoucfhcxtngrdsjumhxcuidmgorzfrutyzgzrbjlqfvthfrnzjbmqlgvt\nojggnnlbpdllvaazsbxffqtruknaolafrejlwbdolbgrmjifgnaqpwzghwytomijzbfudqoxmevjkajjvbcklcwkrsvifvetmqrhkplcejoithntpoftelgufhkcpucoicbtkryfrygjcsabtlhgyotgoqijwgjkilszqzgudbyiehhptczrqlospcutopwkwqfxdsufvxkqtdfzxffvabqqjwdxqjdwfugghbkiqcdjtiwculjnufeohuxphovvjgdcfzztlnnncbferoctfinwbamlzsmlchpnpdao\nxvuvvrjjftrxpvdfhmniudunshnrpjbtpsmnowvvbavohmnxnvjkjhgiwgcgkopfuufsipamdqhjzlxwvxrymavczvwotxqrgmfctdafwyqgszwvytxyxpnlecefduvqoiadhifvtqtvgkslbisqzrgtmtuhnzbuoffrbnilhegxydjdrjcdzwjvkpznmqcdcqwrhvptmhysabtmlwjgsgqhlzywlzcrrdvewqkbnszlsgsvqydjnmjbojbamaowghcskuhxngvgxtddsfqsazyqqeobajcocznvyiwkdqgfyxjjyvkuoapdvfbugonbgdiwglpzgiqxxkarhohnpcazkospbjlzwihhcgsihcsavajnmllfydjagcmujzxaydrohgzzxvshmcooworgvzowcvreqvlpdesajfwehyjyvdnuqbzllzkjhkprmlbtpkirzrcyopgncmqbxbutdqbniomprafxrujavvbtijxtwqdwjjnehyycivwjcjohiybzowavcrgmwpjhvtkwneogwszvpskdremehyutztbgvpshjcdrkpennuzplqiwtncsnawigmoqwrfwinhocdftjnqahpbfeqrllxvaktmevkxcgwrhmxpghfsfmgrxjdxzqfplwsoqpeiwfihyvkjcwkhulcekidvztcbxpswhcgwmtbgemsibthcrrlogbhbqwhzgtolucjhqnsiymmeahmbhrwvpxiwvqimojwxbetpdvazkqkiapfombqfbhgpextahkgoefpvezzhsbnavcvdwkzqasvltfgsrzrqfhmxgnuyniwizknclsqjobmvubunsfsbeqemokrqfjdkrghqqvlufoyjvmxdmhasgvrcvihsydthtkbwbsfvttiexccdckfjigeswdvsgrsrfmoayibevvapmheffghveeysuvipusxftfbnrnnzycxuuoygvkyhmjwsiryyklhzosxdwncojjicljyucicjnrptultnwrtmvutwijyrelvnexaynbnnfxzhcybyuzxaqszuclahbhejvduzenfriishkscnyjjdbkxnpelizughiaqyzlefhotytwymlueailqttiejnaelihggfyukjftkplpeuqxkiqvjmfzlwyvcyrmpcemlzcqkmsrpskxxehhpvzgwisjckrouqyzqdzvnouqkpguujsqqiqvapmiyivcqgwakjrfalitzzkrxsgkjdfqvjlistarpoprzjbgqcpvfbkdeqqzertppsolwnegmtnbltsxbebeayrgrgktpiubpekjcotchrpgwljpqyrzzlvaqzyorpthpbkiueadusckaphyfysvmaagbehwbwygxrimpcotqvtrqfrcuopyurkfcnzbnbpwnawnupdntifmythcvdhjhwcubwtjajuor\nayurpobjscdadtwdztlozwhcankfuqvwsfttebijkzsgajcjcrrilpenumkghdwvocvkwxvktrbnlfomyolxnhcmgdzpsxucczizvcjaqtpegaptvyxdpziyfkmdnxyzkfcmxqgquhlonoenfrorzshzyyjvtfdnntxxgojprezlpmzvnonmugfkmzshtkjldxidfrjclqkodxavlrysixpjcualvsfeuycgzjcycxtkjrlyhlsafarrddkwlrizakefdbqdslortgcswpqymdqjbyipbnqruvgxnjolauxgaaxdbuwjtgjqkpzaasehxjir\nsnncxkaolceucvwaziqnonlpghaodwidxnkwzumkaekgnzsjhlkswswqvyjmbpemynbgcejvemwfyspejjfnrfcgzwpjzyhleijewkrrirmmzzdgcgkwrdpqckrhxspjbfebanfqhqhdzraloilawtpxnwlbcokistmzdtsxlnsfcgjptamqfqbzyxhxvrccyjiqixpjzxtsdzmuuaemkwlfuaopcmrzdsicdaeoqaqqhtomirxmdaxbkqpzgiqrwzyzkhhhyhmfgzncdwubcqlfeigtgbklwahhsxlyzkdcjqrnfkdaavqjpazukscfbqlygwbbsunlyxdxlywlrvkvahnydhqwvehfprwweiatsfdlmbutjvnpnngicziynxnopmsgavjoswwdnutoogjvhdiehwhqegdfgrlrzyvrhrwvxxigziifbhjfmgjsd\nogiuqczfjdvxztrlmtmlywrdhl\nnlzdqolicduhwenawzbbmggiaadjprpsoxwhvqgiptporxqwqfkdikhupazskypphqlheqdhtfnddvgkvbmivtdzsaxkgygvuzjxhrmtqqmscxiahhaheleikytagzeicxlgiokdriwsrhvmwuukkmbpiaaxijmomdsvnxufefueolcplgxcxnihoalpekoxqgtchiewelkmnaosiifkstlftixosfbgdwtfkruvhvnbesazayscxazvdxfjondoxrrkprbzerbixrzfyqqhbaxzasltoblmcnvcrcrcrzkbykbnalrzmvfogfcjybyggfyfmwbcagliphlrivylkhnrjwiyvtlovflfwoanrrbrjrngcpeqjykpnqmcjozlpvdsfzvleygdewazqvgmxqyvexwrxxmmixxfrxrwylggtqccvdckmzaxulliivjusvjkhyphbjykrmucmchxgbfbklkemuapmotriuyroiqggclenyelqawoszvffiajwfecyxmfdihvaupwjzcgijqzjbfahpvmgbimyjqddnqjgtxkujgdsvyocwmvwfcpmksgsarbmscaherrwxsrcepykqzrroclmqdnassquyeldmcozybjmouaokatakpvkgwbedwdqhbktrgammnmkgtumaitrxwcmgmsyzivmxsvzhsyzbduwslfzyaiwfncvgspflhjnstylqzglmfrqqmgmvhlpphevtgphucbxjnaxkdouxwyzsaxxlidkqofghfdjkbxtrvyhsanpyxyhlcmxgcixvvgblbtcbfgtfkixefkieevcapsovguwandtbbzegqtzedcassnfxnaapjgofwennprnfdtxtyubbxqemufzdjaxujdxfzphpqqqegdxmecjzblefwdbrynrpvjgpurgfsysidvcathmvxxzrjpxkjmknztljuxdeklplwythfwiqmgfsmzesbyh\nigthygbwygoignxhrmkeozmwsiwhflhqpaldvgwxbphjlrgttpihixabshhramidtkpmooartszokctzkyvysejgbrjudxppxwaadjigdutklrymkitfpkscxlazdhedxfpnbjuwqcxunkdmsumeqskofjubdlzwdmhdvdddomfclouhfuvuxktuonngfpadqvvdiitjaoisgcdyimabdoaojarwmauqyspynopwshegniojkjubcgrnzpkznwnnuioatnxlzpiouzqjholpbpqbptokfeapndiptwrlzkcsqphmsfyiyxhqiwmkftwaypdrgqjhjazobjiizndyqtoldcxreprsegxilmqxmkvzmusoizypwuclqzarfziqfhmjgcudgpugzsdccddnchrgmxdquwmqepaleekurdhwjcvkaeysqegfrcmlsmoedqzgyofxeukzfbdglzcvvugnljzffyjxlsdgfvpxfgmetpcxycjllunjvhndyttwojxqkdgoempxgfuajulevmdlmzobfrdpflpcacw\nrxbnmymmxhxyffizjhogamyamnmwvlcwawkjfrrpqnhdfhwqmlscdesqervoseaqmdwfjhwybyrwefcfmduaafspefssxoojrerhqxfvxlyvpjamstnmsnoflbizbgiwupbdxwirjeitxjgolrpniwgjzidkzdchfipsgsadzdqhujboatrvzyicgehzmlmxivbfkzvnzpgdresofzvhxvkpzwnulgeffezgxfmxuwsszykttsqwpkhesuzglysbiitumadlisqtrnowetaktmnvbibsdbkkyynkeunzuxmyxgktuhyaaowggtrzonskxwysnjydfsmudziotsevwquzyrwbmmpcfgjbgxufvfsqfbmnlbxpiizmfdgvyjbpybmazgjzqujqrpnjhwpwznnjmbcqplzitjwzrrxfeijxwolkqbluqlsahxgqozsjnivoadjllugwucyabrbvispldcxqwnaerdnmzvxhggerebyycmpnrbathsgkucxzwowslptbbwzmcfjwychuscrpsrcddwscipqrldrchnluemmfqlfaoqhuveuihjivbvrzikcjwhykdoasvgyxanxyrjmldwlxeobvojffuwofkxztqarghjehbavadvepbtxuonrgqeirfysnntkiixzefsnyjinixidsoylgxcwaqkrjybgakzacildkqbeixteylqhoxtmechgmgcjgodtutqjhvxjlitjghztnwxkpltnorrxrfavkbnkmgtuqnkxdhtwnhegpmjcdowylnbgklinntbhsmobqawsrmwusovraqzwzpxhagmmavfciqubxmyziaaqeenvkafcucizgjluoevkhlvktgjjyqxvhvqmknloynutcskxkpmrpndfguluobtmqmulwktxartoqmtqfwayuhyajfzpruybwabbqpntsvloukepvbvupwgwljsxrqqxwxwysjyjbwvgalgnqiytnvddctbktwiiikdkkuaxintzhtfdybyrohaflsivqcciwclsmadppmpzumdirhtlbsgstvbkwzyvnasrkkboxmlvcmbzxvlsywnimfbvfftegngpchjfprmzbrzuxnlkyspqpgtygsltckmxmccsbzszravwcwtusesmxlejsljnrmitvqisjpvyvxittmxqoxddsgoggdjzliznslxpigxywjieqbswxypcxablgqxnkvhrmrdrqwaqzfcrmgsockidkrxbsoapgjynrurgjyjewyahxodwwcwkey\nsgtkeyhzfmzlvrpkeklxjxqtaqcfrsyyqxddguqatgasjmxzhcaslwxbhxrhppetjorpvzlesqsyxcgahyehbkkuldwxvjczhxpiyivuwcnjhdusvtwnrsykzmoulyvpsittnftlbmfkchqkisvlrwhumkonsprxbczpjsswouidcercsxkaakamqhqppcnoamotidhuuwjdtlhvftzmrqvtfgariyqjncsacelkyjfwgwuzxsymvktysfpahzousnxjybuwwprjztxefdkiwylsdfwcoihqifvjmmwbwghnpehvkacfcaxgmxrokzcdmszdwgsiuwilurjrerknpfyaydhylsyqkuaslxeycbgeqqugxavdvlmvtnxdlluvinfgrgasmjkfqnqydjcyagszmxdbvgzjbzuwkwejoihueyhwtmrimopmjdwhyilttolfnjyunsncfjgefrtmnvzheajykpocywlmdpanozktrrejpjbgnffxeyostgrjhqdmaemltytfawfzuilrpuujlqckkgvuzsdcuowgcxaljemctatjmbkydofulxqinsmpaysjmptqsdcqqdebhfqubzifwnpsvmnaoapevjgnjh\nmopc`uxwcsujzayyajpavyqywajksqjhvifbqhtrucjlnwswuhxzagrcbadfpcawsxyhmvywcgfcl\nvngumvpbpicqrjpshtqfvzwdqdmgwskejmrodandusjdxydrrcynswlnnckjoyozffkewtngxrkrxgthkkwwpkqbbwwxvdaknjxetvvicanxeakqxuscgslrariyzwnbymewwmbjxckeywpecthuzflrsmxhsuucycdcmvehimtcpzgxxmwybdfpvjaouznvyaluozlqjazsulpnjhndjhtbczonjkfrqzikwvnywplmmdprilrhjckwcvnrhhxcqxxuwwqjnnyafgvhzzafllaudsgnddbvlwbqgufcwfcctvfykibnodsrhnbcuwtsprfdxevdvtlivvkppptyiftosggtvbmajmxfdmwqewsatkjidrqyfyvfpergilbvxuziquzpodabtnkbqddpibhikzvnjrhjhgbivpwssltjrnemtpjhjrondmoovqrquvnzjuxpmtetglidssksfqwtjnuyrcrxugljohdgktqmgbwrronewbtqkfkfsqdqbopouaiwvmkwvhvlzhthahfcpfjpicqskgppyuurxauvyfonsiisuxzqlvdgvpraeorkqozfuzehinlekibfmidcpzdyxluomrmroqiqucpkdumiycvusxtqpomwqtoesfxxwryaocatpemfclcdpniqxyohgqewuqpvjugvzwojjyubohmezypgdifbjsgkuoummsalpfvmxantzcmfedadlpgtzcjbkdwlfaaokvibjokrpcjuvqtqrketseccfocmmyveeeagamniniadloplnakxjhbndsntdamqkobzyaaupnrtyxrdygnphfffowbzpjfmkkdyphambwguqvgindpxpzuaqaveqpvqmclbmgqigmlhpsbomoyevwfuofkruxnyniirjmacibadjpirnbzaxrrzkggfisdiqwqwvbzjvrlpuyxnrvrcwloteoazcpgmhtmpygssipgaawjwypnjntfutsvyddjyunrrkyrbgjluuyxfuatzflyfkpryujalitswcwkxdoieriuecfpnccmyfgjgsowrftjqaruunxyjgwmwwpsmismaorogrgjilcwjeximkjyjjrrqmthrlbackxudvuokepstjfhlydrpukhkdpzdbmvajdtzyugvfhcnfxwbyrdzurwmtsisewycfmqxguvxxbpfawpsjekxaksszdbryrtltxmobcwmaszmnmkczwffsmvkrxjunvtohzoyvizcsfhgpqyvgmpoypljznqprrhhdtnqhrvpxwpuwfkfrihsuqgjoummbxdbcgraucbmoaimsodnsnjygufgepqpwwegkhsgagalxufgwqrxjexqvajkhfjgrtsojihzlxqyapavipshvuljkzrxmzufgzkriyvxwcrzgiozicgtcqqbtlvblhmkhfffmsgijsuyiwftstnnesaootfgywxwbitmdpbeyosbuegonkxyehhdllokwxbjdjvaxaftczmsuxqyvittjmjdfafdcxtrsaxuyaeydwccbwziowkacajmueprmdycmkgobuzfjajlrlkxxkfsatvnukspswmabzjdqesbflixwlcqziwvchdsynkhdncjvbkkzbeihibigdvyynmpnehzlfbjruwlgbarhcclceiemkydadrqikskfztdmepvmuskmqqkwoqvlhmgmlpuikjxypqlklcrvvsxvkxrpbsbzellwbaxtoimjkdyihdxhjrgvvavyujwmkicglzdxrspuqlhjnfemuuajmvoxsjyavbgzmozeq\nctheljrrotpjgiloqyknirrllybglcownluvodgafrnhswwusdyuvrnntmwsqxlulmibtxntqfakygbgtuwzdrrfuvyaozqlw\nkqnrsvvhurmmpnzwrmaurkrkztjoihsgyeuujyrxzhjhyihgiwgcceiwympvgspajdigpodspgvbypiohashjmobnzlyayhuldzbtdiwxvgqeemslvgkinrlpuujushfjzwjeagxasaqetoloffimzplnudeffgachzrhizmaqewwsuqnizzdfivitaqyxubxqbtxtvacgqjtvxhe\nqbrosfwiociaemvxdffmcbjzjvdfnwygcrbyzcuinsoretzalydelnedsknhpbtxrtmwhkczzykvaecqrwyrhmueewkohdkzhnapvvzoqlbpcimqaiqcsaydwjbafbqxeuxfpavpwplgyuoireiqbizvcujplzsmoskldgftigpqwaabeouhodvzfotkyrtuffmrjdifognrjkocalwjhdfzblxyydvuigfatjninyyqpfnlzpspawmspzoriyvchiyfvjlquljujtskdljgtfdxzegwlandwhoizlwnnhizwuzawjtlzgzamjwgpdbebvuwjnvposaqadmqwxhsmbhfutadmaepyyrnztguzutobuozvgapjnyjmhzaaqvvumbwqwrwyqwvvadszoucnqjxuommdhxvmqaqmqrlmelamtqxqnnymunsplzjclbrsvxrhfpvhaxentcgbdbdlcyyllfaqnrlzlomfonmihlfgtaoansfrfrnvvkobplodacoyclrzcgxutpecqfuvljzdadjsxhmivkbxpqfvvznnrcokmpdcgvmnmkitjgnaqtgzjokkkfnmicvsvjyeemqrvmjwcaxhfuoqhwtzabdnoakunjrenpbziemvvnjndozrxkxifhxjrotzvuuiyjfkvxjwhdrukwhursiqpikuynrzuzukqemxuwfchcslbmntordzqbmlqrztoneofxbuwpupclxikxumgykwtbesxkvpbflmhtzyljicvmkmhudtxfyxprholdjupdjyhtlfgeiclwumlabksmownwvhqrmefuogveddrtztzumuiioltyszgtrtsazhvinubdrmowtxhrkiwlobhtxituoonplzrddvmjckkqzqfubfqekciuybpuqefeijckopmtjqbickmaameizjiqrmvzadvlhnxydircnwlmcytsdrwfbtcizcibpnyddwssrgamwlptedbnjtbqnoafjbixtdntmktzuvykekrl\nnupxutjmiscrndidhauxoenlnzjdhvbxxurrsrcmqjklgobmlxnietgfmtitcubuhdzpnngsnxliqchkntgsqknilggmzxwvntladditzqivtueznxpydxqnsiekwcdrnyidcqojzhefxgayrytaeyqrjuvvwnlpjuzrywvojlwicivspfkordsuhrlzuivxacemoalnbipohqwqlnlxtchegbbxcfjhsnxiqolnfssdsuiuevjtwwqgkcscvscdabvvzehlrrwaoggqkifycgbxzbfhjnwipekpklayndfdkepqtpoqvydycitqaahatbhknzpoyikmaffuviouteypjhfhmbwlektykwvhmerjyiaampmdwlxamxelzwammxfdiftkirgnnltsoaqzupoxqkbfluizxbkdoirybhkomamsxsludysqtgdedgjxruvasvylremmpcyuihzgmvqxroikdevlqmrszvsscpwjdtanmjjtheaygxhnqmgnzeylxofywzowcvfapzucltlzgjjlvppucelwyxwpnmvcsfewwafidzbywajyshmdnhrmozsyqivspjxdbsfwkqzfjssibwonwdpznhruouvmhrjvkdofhdtyplznfqgopquyfzdbncbmyaatfqnvygwflobrdirgqnzsicxpeqbvtcbwbfjuqfrxroienvawrknvpjtjrtagcgijuklyipddljrnglnvztfkwrwwolpnkksmfrmukgjblzhlgwbscropurmvxgmdusodptpvjwtgddndbyqffxmhizzrqzrfwpvawrxwduuvmtixnmkahbezycgukatnsviqpjblwhaambvlkfipibbdeyekhsuqexnqtrwccykksubcexruojkkncdoyjjhgfnjbbuaqkytxchdpaxfibcxabpdmttanbpckwkuewpudnqhjoytbunwvinnbrhkciadgbxhdneyrsuwnflhbngfzlnrjfaoxgcosgqjy\nufauigzslutcdfmcoqozjajvzxkxysnkqezxbflakczrpbqnjayedsgmrimuywfxiupjgjltjylgoctmjqgayfidicexbbztlxawowxrwupmnxljtbsvpahaxawvnhsqsqxosczpfdtyvswwatzavmmoyislvexrmliobtxvykzmlnqllahexcnncokxrimbovvhvrkrbtveezoustfvambekskxjboutpcdtxyqjjasktswcnftvgqfpxhkqspyaprgwqxggairilxccxvkzbxaentapizroimfrprcfrszuuoblouiqeguqarxcmufkyzuhygadjradlrjsqgtlxpvovcupgsfqkcjzlykgujpzkiccfmhihbuflktvitmpdwvajrxqjwhbckjgeiynxhxigprilnoeetellbnpbrckwolworuxdvqhnkwxgybwflmfgqsfajuqksbhpnbnzqavgyawnhayiamghphzhmmcntezkmqkwkdnurgnjsrjjcfnkaplznowgndloliztbveuaoodtmeyjhtdctuuwqdzevxlffctpsdgxwzpeelhjejtglaobyjempykkxfnwlapuhjodnpttkmdfhfasfnqfipebrsncnwmvjvlqiffhhzdgjqbzgectwwbsbkldmticaiadpukpmdbdjwsksblepefqlmcdqwdjhcmhazwawyedervtmvrlxzzjwnfwstjzsegrkdaerzulkhpflksezeunamhdypbqspejzhcjxtbblrvakdsqdjtkjtsomlaxcetwsewrhzbmlnrbirdurdppcqqxtpyfxadctjqtlgjwxmkpwfncufcupspcfmsyhdxfwkvhfjabpjcqyvkmhykbnbhvsejmvyebsmjfabgmfpucsnyjqnydeyirvgbfyfwvzikwanvngdfyfttelcxyayvdbyhlkhwvvfhilgbxzebzvxrjhwbeokrnevwdlqsecivzoihqejunuiyzcmhjujjocggvihjhlsidewflxulphmmsgxalsqtunyrvxxacpijcvlfetcvtlcwevvwqvyuhniywwiphcafvtqavadjjskbjsmykbhylzfqygftcwtcdqcjgudwfzipnoouqkcniewgtaejdxnksieqzpfspnlnwlzjqfmlgenbtjsloimapihpfqulpvmkyfimqtapxldnhbxqhahjszzrriuelznggchjwypfgptqvuynlzxitrzsn\npudqgagldjueehlfuphqimupmqeqqaufakomyarcahqxkmuubjcbclcayfrjdvogxwgztravclcjlrtebmsqvntlivrapolplsbqaofzcmauewohbznlqztiavapzkdlfwlvqlahthsufcpfjtpeoyujbqdjmlwkosookzappezzjqijguqlnrmlifxynqhmniusrpetyeznuemiebhlgqtvqiwctaelvmnvahcmxvwgstsdpxtimvwryjfgafcuzmehodzwyykbfzclyycmsjhznenbjkgxnwznhyrdekhlkjxneplolryccrvndtikihitkbafwhqmlebyelsdqdfatmyklfewbijosrclfgqccwujzyrlegydxgygchcdryccelrayrtgvmihhaewfbdrkwojppwozbhbbxnwahmujcnymwplikgfnbskfskzsromsdypqvvuyvwymlcmukgvwregiwketlppeirrwzghmktbanhfyvdzlecvdklcpsgyyxgxpwrhpihslnpcnymvgdetnntvpkgydkbykxmgihxgqwowqupnehwldfwmbipqbaonompbznnrkzgwuzjsphcnqdyrijjifwrzutycdmptbqlseyyfuoyndqvifrmgimordocaoghsbhdotqfjiazezgpyvfowbdtokoxlvthdzmkonvownvvyluihtcxqpihrdrunnlumjnwjldumlialavlbwqrvhxpfvzsjjmifuceikmhklicgatgnvadcunluubxbqubfhwvrtbuscdfeahswapjhyrucrihffwknxmnotufkeqnbnlwjmvfwczihoatsvhxhbrjbpxizpeunuqoxkkbnxbzmehakcxxzzbfwatptaxlouxshfpjfmejckkczvrvoucvwynszdxusyinaobbxopsdkfoeduhuklbqmfmpzbpkxscribpjszfllgqwfwylofoiadcjrcjbpkzpgyvbdgiidtyrqecdgtkyngkyshobtwfqrqvrncojfrwhtqslfnwdlyvcrjigswgqcxkcbfallxawdpooyftnmldhewfnzhkxzimqxnkagjcyiygyobdoedacegkqjmjunamhucmmnrglzjwxkrcjkbwwbwtzvsdxjpbwqqmdlnvhanqvszsycxzthdilosykcomielefjcfmgbodvjhoxsrphzaahakivmypdhdnpcsctzkdernnonxihhbubcjuxflntfweodqjaixbmbavbtvkxipeixkafbkvtqrwzqxwylzspbtzskawlyevvohgpfbpdhbnbmtidiifdjepeijjowgtxpmhgbtlwomajlspqbwgirxpoxoxqfqsrzbfnjkfigknulrxvtvlukauandgwrhgofcijfhswtpsrrzndttaqntaisuokfbrvfpxpmfkjpdgjtohimetgccpdgpcdmnirgycywsnwojtjtjrviwidvxejnfhssjkmxsthifjcbprtjoihdanmgczjtqpchvlvcnddfwefqmvkcjgqzyceymtetuyswxvflhivmsjqbhwwhwpxztbolfapagyiejprzdbznvxzxgufspgkxeshtaatbqitmojupraiqedezplqnhxkptdmlckyamanwuzbqjlhzezwdcjseqfzvoyoezirdeoxiqwflxljkqpuyrvdchmswmutwxfqhxrpadwtqcotvxqzxrrblbwweaqwornertvgxbvwxisjwvoigfrtzsmunmjxmjmvgufzljkyzyowhhfrxrunzasvnhxglcjgulmgqesunoaoetewlcsqvbecrhgeggqkrydoarphpdegiinjlceneftcgwdodgtnlrovyvjkgqlkumzrwrexbvrbtueehizwaejaioisfxmvtqgapjyredy\nklpxfwzlalqfclqqwexmpcmcycfyguxcvnlzwsibchljwomfayogwpoffgntisnmpzftaekcffsrbvxzkhfezrocjubinuinrbnpjdpdilrgoghjcioavjlltihsdecopkhokjzrlaljcrurgvnvevppzwfaaspwkxjdurirfkdxhkrnzdcthsmickcrpnbhrinwjyxmqhtpffiocgibhkpptkoohzsmkhkyouuddbfdninncesjkvqbiczoxdejgubzejzjhaagimlguwvgvrhdwweqnltdwjqspyucguadovclqmjvvubekzdezufugrzfcoatrsnpurodwhtmodgbyqkvnwufludnklpryowhxugerdpajmehzdwblprfuhefbqdtwppudmvxwntptsoeohzbtorwzygcvfjumagvdjhjjfawipkxjosbxwgzcyqnrmmbwxeeubcrtzwtayngocvzlvisefktsnsnvclwkncgfnfpwblzyzstnumkypqfxodoupgegnxrzxbvjswdghawchyhfjfzrpuvnehhrrovacloqgdhzbbqzhcuifvwaczwfemexiycwrqpwpwjffwxviigtqdbcbgvzfkuakxjwaogdifnmuboupxxtttdgotxzxfyzpdmyyparlxgitenwpktqovtzentrwhzvpbfzjxhhtbelogjyshxakugpnprqyzmntpjklrcgmicvfdnrjivoasbjfprrjwpdlpfkqgxqsdvycjjqsdqtruiqcrqbpphjfmjtsdvuhlgylfhdazxswkmgspqxukfrccbsmjlvppqdrnomztpzhwliocolsvahwzezgrzjtgyavbabfnjkbjxtrdhpbcnlnkshjskzybxejcqaqjowsvlfprwygvdvbfepnxsfsehegzbpeprwsyethbybfltncwlzrfsketvyeyaqjalzdbdrfwqeauzhzquejgolkmutjbyxjgectexsxrjqnusrvomxxcryeizvdcikrprlgvyxllaqidizimyokgaocwvwajro\ncjoibxgrjvmagpdnofgrswgyqnmxbqknavupkbopptfiswwqdvkykoqhiqygtnrvhoajbcdinksweulbznkovektaloovhtbhpfpkweckyjjhdeyohdhfdqfpqagbsctupptdaiqosuxqnepdtpnvxmqzorsqidpshwtdfmvtrsoczavcwtwdcfkyrwawprdpvajshgzuxuiaxucflgafxqvnvxudbtztqploegyrlbfvafnrwaxatgvbvxcgtxquijschwordgvtvpyehwlyfkiesvdegfgwfzfpighsxjvkvdakryfbmghysduojhhdwuabkwawymrdrcvewvhwisbpgvbmotvwcluoahtgpsiwgizugagtxaaiysjmozqmxavybqfmncpbzonnnbxaevlglngwajtlwgjdumcwnkglyfoplnowlaownjmidvtjbdaexxvvjtdcgbokchbmjgrxtzdsyvuvxlqmtfoxnghnjzwjlpiyjlwfkvhwvahrgqtrsxskizjkhhmurslieptsxbruufqjvtvjryjhavljnikwmxjebrtqfmfikjppjorpmveugmwhwjevdkqsekihgxgovicykdzhamxalpeaycmjkweimidajubwqkfzqrfpqnllsvzfngundffgigjwwsewmmewmhzyzgujemfaebaxtefyjlourunbsxprkbrcmdmjdjifbsyjfgambsuklgwqjgjknonxhilrkjwllctadxkgqppexhlzydiycxnafrvatyhsqcbitsttwizluczuhwhmkyeevemedkzwsgungbdgjelrpxoypndwcvrgsdmbshttbuuoizpvuimaoznrugmkfvoropigfefidsfpevjgmlqtdmqbqpocwuiydfqphpcsnmfjpivcprsyddeekcydweruviomrejbsewqyuvrmtcqmblfhvjtlzjacyqowogzcpzqujzbjdwfhqrnaulyukmzxwyekpbmgweowktcwasvhtvwoudtqjqjuqqncahrqemyxkbjxdirukjsturtoloikeszrsmtknfdlkyfkqrvmoczhphwtpummcqqsjbkagsvnmomokrqwwoignlmokxsjxjwaqoaqregnvgabvfuurehxkjtqmwxgxfdqeabzcvxrecdugyjtxqqerbfkndvqqttvidczjmyirdwoswgkaakxltcpdoeudiaiurxizrbfuqcrnrdziqpqlcavofgppbqowwmoumvuknjvmpssdekqnczngyofcvzbjdkakuovqbbioomnpfsplljkmcifvuvyyygradizacyyfmjqjrxyllcrzjelwtkgaowaxboctwoeuftwwtblxqtnstxtebampfymxkyxiwewugrxnrsftibytfqicosvvcmrbyjjamnxxrtysgefuzevnbjvqvrwepkzwwlzhwtppqejfokqpwagyekwfqnwqgmxitoelimsrdeyvthfzqwqhdgmmvyhbkqrjdtnkizngybuzotxwxovlsdleurspckcspafiduxdzecwpkn\nqwyqczozsajykynwnoifbhiuivcfxafzpnqfbgbrlvkixyfitpbizfijemiemcmicruqkbdruyaoprzpzvyqfooulgxxxqxevivctjvcrswdsuxlzhbkydauqwdrkydaizlqwedyloygutuecpxg\nwbzkrnfnfffiilcrqcuoaojbimfqhtevbudjketcguzfjqropezaqxaheifmunfxdaxvszwhvtjyzhmrigtywtmiryhswdqzqqcbynafgfgalprihovvjrygpzblduetmfqwbvogclbndzvagrklevgevybxellwakbokoxlhbqxdclpmyyhejbajphynuftbpkeletwvivotbjnqkrzuvonplfjfdwoovmyakhuwjvwmrvoooszfjkaskxnsoshtwiwvnefpxdwooccadansktcyleyeyfmsilcvahrzdaczvrfjcszovhyiyvxokdrjixgxygvuxgpexfxzjtxinzeagzmihujwpokpwjtwuenijouanppummpewspnvshibfuzzzilcxfjcaxazovizjilfqgvtyhvmbdtybaeoljbtxkqunoxvifpyehmjrkhhfvusfqogqpezterllmvjkrczfajhyiqanfktwmmhnqgxyeidwcewvkvxofwwptxmfuhszsdwpwdocculvvlucknmmcbvczsiviooogaogarovmoznbyucbzvtkfqqynnvheasuyijwgavtjcicruzqykrxybaotufmtvkpcezzczmocmvrlxcjnktjqbdsdeuelwkxnvibjqsjcrbplndvruqccwtgpofnaolxzrnqiwhvdkyqbvwhxmmuidmhjkrcezfnsalqczwejipfpgtvumabxxwaozmxdgxexpopleocrygyredgazjfbzbdqhnmfowakldkhpaterkxkcelrzfvecrkvoudmeovxdptppatrvyiiczjptmjjnimmigqcruqjmgwncyoqnkxbxqttuxkoleabheppuqdumhaflhjjobkgrirmlrkiyfssaoshozzyhytzbkokmbwdnmsizfenfalcalwcdgngneqctlglxtpdkqevnutfcoffgjjbyqhlhmkdafwesqocnozhucxtjmqpcnqnppovzwxymdafaleghvjlzdfbnaubnuavrrxohpuxijubngdgzyefiidbdwtiayvfoudwhfxarkanzfngeuolaivunrheaqrdnarbsvxeutczzwibowhgcxskfuuburuqlrbwkykgnwvlbngbcsnsxsevcgjznjcekyimqqkssilcumowzgzawyxiezqxofmxhkenaevgfqbefemjgbzyunxjilgjhoisqyqrfhxegixjjeqcesxcwsmtjioftwwteesjopergyakjxtlgdjjampeyqkctncrvirnwfuhdbexbznjxhzinjboqv\nuccwocbetqsqkkobkgexybtzbkuwuozkclgcwaqrmrgajlksqgveovdpzsolsjcoirgwmeateiwmugljdabecyuapglazrszcvdkelwocnoqepabkqfmfzrryvrprdedpydsfdchahnoiwarvlbyhtcssajiidrkjdajrvkygtkejittmirjehjgsckxlhqezybxqznqtqjevmwmwsxncwxzgkhtwwnthwruhbsudvvkyrhjhyjmlfrxqiwsxzudremwsmrruxoeifbxcgjintkthxrnnuagunrpnnnyvnlhavvtvzprsssbdiasqzqaqqdbqkwpyyvxryxbqoxyenmuuuaqspnzzoaqwtfvjhqeotzmwsbytnpwyorhmmdsimabarvwxahmhlukpzqltppmsxlbqrdpsgawmvofcgjhxirbjhtepodutwsftvyddtqvmvlknoqxopbtbehdcjjqrxrqbtelliscxaheqfjsecpkdykaopsaqtssqoaooyizpcvsvejjambepkbtzshebohmfvcdmsryyzvytfokqzvhkgiquheiiawgcbgogblfptdharvvkskfwhxnpofglgqkminclmpwerotjkakkqvkacqsyqxpntkupfdjroebvzfrkpmtfqxhcwuqrnkpwvzcvwiwihlfzkgfrwsyknaeyyxddjmwkoncviuxoouibqoafcadlpknhzzhjwjywvycpxcxwdfksmqrekjkujnopcxwzdojwmbuhbzkaumdbjqpudhwjxtrrssovoxhomddslzvainljgdpicntdpsbpbytrgzebuqryzwosqegzqafqvqepwnprqibemruutpapwqqcilugglcuvqsfxjfctkvbuwwrmtaykqlnhsglbtatswhjgdsckjwxokcqumvdmwqchdkcpshporvjtzobqqobjzemerppgsdkjlmrntojqrfsfvniydqcudargpkscpotjbuolhoidzeiworxcbahdcqvhebcwolfcmmapkcvfoanxbkqhxcxaweqplmyizipdcwqpztwiesaizaydxadytqnapckvispldiytibqdvclfdfzhqnvhzlkfannhaadjiciouesyaupffqydrpryglnlqcrtnkshgoezyzmcagznttxsopykfbqogisfnxwihnjjnuarcaircwgnygyafthubdfgofogcpnmdlfnnugdnlmczadtfwjwwigqlsgacnazeojbdchqikpqugyjpmveflxrhiaonqzvifwiaxjcobhledlnjgetigjvojvdgnrtxqvetzfimihwngwdqsy\nvoipnkjeojkmjfyzrgcrckgrcgkiaftcuzexphktfwqxbdtuasbsuyupgdomjhyapbaqixlzgtvdcyltfpggpkrvpmkcqnblcoedptwseyzwvmvrnnmzxlbofdgrqrqcfapkyfhxzkspapplaifcijgltssndpseowvzglpwnlydttjqjfrtasfbghfvnjjnvtgoclrwfildfithhfvpakdfbszjylkeunzbizfkoerulcnjugvokywhpjymvefjhbyjzahnhnofibrbyhvjhcccwklkbnksvlsdvddchujtwftdemdjcznvatjmrwee\nfntzirjivhnaxwcxbslybqbsxmtfetenrrogmxxyrmbvrhfwklaftsddipaohlekzpailbsqaowxdblelmudhdaptrclnzxhkntetanhfgorlanfnpoelznjbzouqgzkijndwbcjzsfjnacvackktmscubzlwesiqwqlwhgfuusvbarcpwkbfxuauythhdhviudffgwokfiihvtqjuhyszhwymlfkpniplksqnwcojtkgqqsmagykhxffnytnctwzsmibefqougxqydsawngvyntfahwjxwvqdyknhfmbbzldwihbagastqvndltrnikttwirdjpbgjhtnpbpzgfhbylpgfizsbgzasvjilwncssckjnbhlpothajkigrusxeuyqxiyxxptpcwdoziqxfugnnfccfthuziavuhdbnhhyrhtasdfohobaxvgmfavjuczvlkpxmjvrhfevcyoykxrqftwtweddvlqjcujdgfgvewqwcqagwjuzoqyeynsxudffunvboeyrdxykmqccqxgymgvtxldvfaxnpnkbgykfeeuamlideasekbivuuimahqkxsgjzhmuvdpzdxeikwnwxrpsllyyzkwrsvrdtsgtadinpgbpcbdifkmummrwsjxvibuzoznunfcivuxrczwwwyilfxijgdnzjikzaaeywxqzhelvcttlcrtahrjkjapzjiknjduoljovgtulozwarcufqrzldsrzgdjjwtsklapusmdenxqyuqecmblegaqoxzzvzjafcyozxphbpaodtskcsfttsqfxslulxzqzgropbnpuct\nkcarqudwedtaefqtokxfpbdvkkkqbqmuqjbgcgtwhdzzicaerhinszbjtduwrddbhadszuvyvzakovninocvekgcjqiyhlxzzxouaopozvzxcicsgzfssuqkotelkcianklorfzhmwurfjxrqnsymlnscvckioszozsllcbuwgatefumgmflzbjesamgxqvkpyhhtxpiouxdxcarvlweqhhznffupscwojysdxmaufloiyzvxacdazzjoxgnuvmijncnbibqifzcmpuhrcqrfvtaqmbjikjdaakfkkuhedfjgptkivdzlpcfljsxjrncrcekzzlnjrpvjkuqirduxfntnanvzampczwfjprznbgucuaviusjmbukhcbfcqnvdviktiermaqhlvzvdgkpjrfqyxfuwccbeffrrzkwxgrscppwjudnccrkwsttbqzedcftroobxvqcclnzxrwuyauqagbazjtxtcmdsmsjejjicpzlajdwunohdylbtvtxzuwizcmzxoxweclugbseondmljcrisvroynpcqlvtzsctxgritrgeaagljomfmtiuekgsuvegdqomvvaaxpapgomrdnpqdflteuxssrbusyavjstunttulvzkjacfbxyuuebsklvytcdndlmohzesvhsdnzznxxcaicctprrbedmrecwhebzhwgrcxpzvxximropjvqschlfrxtxhczoxbrnyzrpbqvzhpnjjwuncionru\ntemivanowucinlrgsurwvejkpesbbxahllkosszzbgqxojwbgdtufwibjseqtcdhdkvmxmvmczzwvbxxqkljvdpxorhrqyfgyjakayxqyxkhynppukzaptgdemngxwlwcxywssclnfomhefsdmzvqjyweuvgmqletxiabmjivuwkcrqhqksjckfgcjmzflcerifhsttfknrobkfzfhxgamqngnpfqicsitlbmphyuyfkimptmyfwxmdztdubwnfpcmdwdouqfrxanfheytnahrhbcetnjdehzlghllblthtalubxcpzasfnyvvueuiossrruelaehtipowktefttyvegrshxajvnnlnaqagpdpkyzihipdodlidjaelxfzpwjcbbxcjsswynnuhgtwioykntguscmmpxngetxefklvvquwlosemtdippjejekrdpvryzzobhoknxyyuwestajtrzrqylyniavjqlhyettihveenidfaxqxsfmxhzfuzhpycwdcswhohqvscrxhcfpoceiyfyffpsromoplfnzkayvbsjsdrckhjedcbqhpdncohrpsstlhkclsrpnzyuknomcrvabgwformsvzxgeeqslortukrqzfiizldhdsnqdiqtvkdoqllftbrllzymsufepuwhjkmrlxwtodooxvudtdwgeqwbrwnbtiksjdemuwwikfkitawchzikfqinbfrrbfsffselcisqaenywubtjwhowynkuotnjfhkvyhdpscclcvzqxqyurigpmmrsawpoqmlnpwgdfrmdgbbzkbeugdgbpvmrxxvpqqbwxoegoiaejoyxtlnkqrfnogolctamiessjkktxuqhjdbrispxabxjjqzegtkcvnypwwyicstjtgrlazjfasucithgxophghqzebkcismwbuwdorzwhnciwebctxqxbxiaqnhekqnheaancrpsbrufgmtqbqsusujcjxudobcqhxjlvmexsnbpxalgwecicddhzdhihhtjienpemuqnjjymvketujzadeibycjdfxcgxnljenegysjbjqkltsezljldbvnbqpnofwaxdqltquoijfsosiddamzwqqhwfnooyuyyyuimbaoctysmkcplpowdeyxevnvfbzxlgbxcybuklfmoylfifpjyfuwghlwumndvurkaavuiaxhflfvumlqoumgjgayfoxoupwvefmorpibuuybqlhyqnofcgibfsukdoasvneywdwzrhqbmdfpuvvubsffqsodvmnimtmgjfiayvajolxmadtzwzgqzbrhkrtbbbwhzpawlnacvephkrgdogxytpjqeaxmfginnvvdkaeaxyuvvfhokgfhczxplycauhnblyrelxefiqrqlujfkqvnhfueuudtvtsjpwylxxgjuaqeuajqxzkvkqfvvtabnrjeesjfrjpmgbhplyvbozqpejrcwoqqgu\nsfumqunaadnvmzfmxixhfdjlgfgjoljlfbblpkvvhszrajjtvyixsvxevirglbbbsoupcfknlyzlqmifdkpyggtedvqdltvmalszgzmtumdlplituhjqiirfhcecjjjmleffjrpdrsonatllzbywahhfgjbljkxhlnrvgsnxhqscqedxdjylafalxrolsrlmprnfzsdkykqqbzecvqifccptswmhiiemlbyufeltczfbawgfgwfkimwngsptxxpvgwawcaoglvpqfwcsdyxrjnectujfjhgbrwghjnmdbqqfyiyzmldwjfneqnwzzsqedagyzeqoxwnngrepipldrtxmfvkglydijjeeczohmqfqofygmknmpmyqhucgrzvqpngtbngoluyurkoivldwzwogrlthpiclyqefmthvwqromhmygbhgmszbpndumprdajutwpuuscckxrymivbcldbxgbbrabcweduxhsbbexvbeprwutheyxjrimvtjpsvuzyzytnojiwfkvvprecmrhpdwcvopotcxreriaqaokbshwcfctwzppozgdrkfmejipfemnmyjbadydvaxmgfwwruzykittjngzxrzhlybtfgoccbpctyllqwoauwyhgegbyqghfiadwtaxfvvxdphqdpxcwnakyaivkjsqufcgsxptsqesgmdolcoiatummetzhwxhuviufibtomtuvmkwnriepwpuixirqyyivcrobuhdhlphnmpqhqnwndaldocjycevmbyfysvkcsfnupngicykkewspcgqhkunxygxgcvttzvtflovcwkmmamziwjpcwhdhxfrxvutbgywmankdimmpdljxjsdrsqtdznanfrwnaxnloxunutqivfmryokkmkowybyjytctxrhkvhksugmbztftuaqffjpvhzkxtlrvmtuvziskmypqviditwskiuimambsyvlcymsqoruzpqmalrmwvvfdlggmlxdokhkmmlqfxbnuwectnvpncmituemctosyjmdgqvzsdzatvrhsqzqkzcsyunmsmlbovepimqiouwlvsbjatosdnynppmmvqlpxvcbxotttuahhykxdqoqeijlvvehjyqhdrfvvtawzwylpzywcjeetwejateuehgvtfgxgqlnowtjrjlnjqmngbkq\nsrhcijoobfabrjmeioaoqfuqjmtsvafwactoaaqfokjkpthxhcnxmyfnbuvaondareharhbksegsibavetqysgotmlezuscoburychnfbmxvvkgonizfjtqiopevzlgxuuoaghtvrwtflqjcfahcuepujgrlenmmizqyzeklobfzcqdklnktryjjxozhdxlljzrahxljabhlfkuimqoetyayfgbmzfpdpxoobwosdjnbtnhbmfutzzppxykudumyeerugupyoksbckrelqovbsjwlfoajaamlchqvuwnktkngmebhizijdqletncekwbxcchajjvahnpagigwendbxeunvqvruypogexncogujkhronbwbsprctveqvjirrirwifsyhmmixtcruqpinulpiiqfythcnuxjymlgwvnivfnflgpzuaboooffkdyrcvmdqpesbyasycwfapyqwxpoykmbp\navqdykmereivbezrsdyqfimzgmprbtxnsazcbelbxfpuxyqvplyudwjrerqckvzhixvpgruarfxgiuyslurohxyrtkbfowoqpwoyoboqemhzqriibagvnyvauvavzaqdfelabcwwovosmzjbcgvdymkozfixdruaqtxpzwfbvonzcinmpmhlzrzewlsipxrdddnynuayamgjqsldhmtzairmihavusvskezyfucjztpeujgflolyhlnlmptmccjidkjibgftgltrxnobskoiqegcscshdrerppajakyjejvrgiyadpzaetgnivbxukymknrhcozmxvsnjjrxfagvyqznnojcflzfnpttjwblgowmaihtozykyheyfgkfekczwvobiglxexxaxtcvwhiqkcqksfvdrjmjpoylrunbukrcigjbpkgqunmuubbjpoiytdhwhtkimtiyezlqoeatnxmeyakovhxbkcrrejapwkeuymxzdhpfzwcyvqtyvurcklyhanoeyzdvsnclqfgbskgodljyzhykhzwvqezyvojkeyqnqyqihlyvsfcopopvpxnviadaqrwwxcpqqnznefmhkdybwwhgatltzjbtstygcbgtkmrlsyixwxnvznefsgtanewqbetcyviuq\nuxwmwuhndzvjmjsdjhqionbuexjzojeqjzzrsrzomzznurpsbhnihejeidlkdpqampgkstcxdhovscucdhjhlveoimolrblcbirmdidpuyknxkmdqfqngaknblghqjytsdfdgiddvofmeiskfbetalauoqmcuzbemnltzzekhmamemcdyjobbeosakadddiixxygqlkrxedsbnmzgegepveunlpivgnokxzlozbguyrbotmgdwqzannvikxchcqqodbispmuogefedaecaarpszkltnvitppcwbwsmnctyqtpdqsmdpxbukkwvfqjxuhggunzrqpccsncjsndpyqjvjgbawawgnqwudqmxeeswiwznhlcvlpfnoyxpdorkavwbmmxdmashhcpfskwymfpwbfwyhnhzvhicluhjumorbyxbdnfxraqutgyoyhnfhpqipzjfgnargvxxkuirnlzpfoybwdganqyvdovppossfyhsoqqgnfswhknhmhoxlumqwaukpbypmuuejyjpbnybzlvkmumihpmrkjhuclsxuatphximvmscqixotqlduihpbukpcjuwzxpfxmsxjtcjgfownqjqmhuatjxhwisjpfzqrzroxpxsndwzofcrxdqfgwpgrbibppzkzldjmkgdbqrtxzzebhjzaaxgryponibrsyhivdfcjikbotvfjfjwhsiagiinllypozcpgarghkgzafqtarhxkwyumjmabrbrwujuzxjfnzqjxasiaiciuihfmqfrqvwfwosatplyhjvfvifvbkulzxnihbfgtkeacqjvklmbrafrfmfopoctzxcxyfjxorklpjswotgtktkrrlhqvnhublggmnqrlgtknunkmfiohefitquomrvivinlgqgacchhzlghaqnrpmxkmeiaqyrntvrkvtqnshgzbttbpmbukizisxpnluqlwdseyapzwzlrtrsxrivceljprqrbfdanghlmmiqoaxbhoclumjbpsgxbibviqqirlgdubpfqeszikthipqacuergdtlrdqfqigbbrpeziyjwhzxmeuxlaujzfofahhfibobptfkhzylbqxaqrgicrzdxybgzuyqcpfmkpskpbimhjigcjdgnztugofpsavtsaqekttbcwzrysvjwqagkpjthqmyvugfeegvlajnovhzakakmolqgjhvuidtdctzfoqtcokvcevhwhmcyqzjwlhupzslkgrsjyhfvpusakuvswyejpaumexwurkejjkaziwflmjekjwpvxvazlqvvgpenonqejlhxzijlastetzwmkgdnswezxkhkxwrmvoeuuvcltbmbfihlycwwqrwaygifcgczxisixirpzgevzfuylgjifdgqugwwfyshzaxvsumdkffdwzcrgrdtwprdftbuvfzakpoxvqgdovetsrmwptwzmzwvbhnbgltdeuymopieymcitsymydumj\nvriklbwxycjindincdpxomahwoizadxgivshceudzuwsaaqfqyrwgdrppmvvmynjcwijiksockyufymhkciwefopxnheerxvorlwejnudicdvbmkslvmboaoshhzuxpbcytgdzditkarreogubypejkyeapgbmcfxxiixxyxbgqovpdwqstgikqsigpiqqfjawsqaprnjqarmuytcmfclmwdowezppjoxpmzpoapgnwhbhjsgcqyshogjyaargrabljclqungwteapqazmtybicmchmjhfwcgsnwkqxgczhwxkhpshmxtdryqzmnlojdjimuggjipbesovrmpejcrvgvhdwvaofinwqgehxsdqoitzqzfhdmtwzazrjrqnlcogqtthdbroildsshryycqzomerbkozhtjkcdmrxmezemtemevnirwqjpyswmdwzcdaokyjiigrmogvbyyygiwupinjjufihfihtdxsexaalqvthrvgwovldosgzopootghkkccjqjdifubkpcwyyvolikoojcxmodunzypwnbyfqfytdyoluluxzcbigwhfrwdiidvvvlmwzegmoqhtjcqljihzglzybzihgwuzsfkmxmutyktpuazrdripuqbcvujwjmlklmwlooqgfwwpckrahhojrsdbkochqdxarxwlenwgezgrmdxxsnbywexrkofatyosugfagluawqlgerzkcevsfxxfysfbtklydqsbnoedooaejjdbigedbtddlaxklpmlgcfhfhpwtpbijzpbrqaltazdkvvpqbzxgclmsvzivntuhyvykyszsxmfkkcbphmodcmofyxuzyxqvztiwnaelbggsukpg\nhxcxalwxitsevbcejgfgwotiftzqffwlmcgqtwmvqsjphjrangkdabxdzmqqdvfkadwmhisjtbeppibxnvcfatnpcvkuogsynhneydnfrurclrhsedstebymksvncsfwowzqgpitqkuykczmiuzlaoojjqiwsdvcugdqemucxftcjnwlttuivhfhemqowwxpxgntuzmpfnbjybkkxgqszxquvgypnvbnpegezuotwtkcyyloetmskrmblibnmegwfpqlwfpofmptfbmryphhsmhyaggafyynwdulddoxcaktnowsnvvxvjjqpomewxgoiudtycucvcheqvnuyrbphldachddtwktqjzxxlsuwlpegvdfjrgmgqbgdowbanfoculokqtgdkhxmencexdowgerzhfiqesekypxsdcujpnuohutlblrirkjcsimpimaubaothqtavxzvuolmczhgsttrykivfijodyvluqldgeigvgrrfoulqayhlkjynzpexirqtmzfwqizvzlwylagnaiovsumpqigzdjemdgkimeiyqatzxdhldkkbgbhidjwxmqffcaoelajkcqvaafgqlxrzpcnjtzpkujntmatgmliubaqgjmarvrxadcazvijyhqmqehlpmiqyrbhyfmdafvyydymbijkdkbwutvihcvyqplbephmlmgwzlejutpgovbiwwncwrocvjveimvpxrqmcvbslnajtvhebxqunbmtwagoakzxrviubneldnvpbodrgfaqkxcvxpquekqwhtbwarmysrrayhamszbywobauvmfxcrwfxbiosdtkoclqzhuoaqwplqwxprniryhcmewtnnwhxnuikskrhualzbzosjrtftdicjizzxckbtuonsgwzkwptawpvovmprdbslsdcgyangthwsbynmovguzigbpasztvkbmxlfytcwazyupzgafddsvcqvlnfpazfrxgfknrjkbubkxnhkncbcxqklxrtedyyrzljotqxlxxsblowpfhuzdvjwjdmroymppjwpsebuomseelkhserijrkyrdbanfsbuawikqxpzfiqscyeedhvnoabmelqcdyrqdiivvmuwzdwsrtrbwlphxgmeatclnvvdhmjhhzrcunaswwcexmpgjjwarzkxhurqcdmbyxypslixfsqkbpxhzvllcdzeborjqjbznfrnelhnnuohdzyslraynpuxgsspihfqwmkkwgctjqksvgkixlmksjxujbpgekzxndjarezpolvblhmhdbptsciksyfnkkluvomwfavpowkuvxdjbsiewwezhqawnucfgwvfmfnbpgupujpielcicqeuywqvqqjvxxmhhbhbqingbyxpdqnfgibfdkosez\nrmhhporcofxzrajomvilsccfvobbbjjevzftxelvncmlofhiitrnriovshaavbnagxuzbjicgqhqeeytdjooanogrmezseuaemidtvenqvxvtqrzejxpdqpaidopzazixzputxylnmiscbmchjrlotywdmdlrqxnzomtrpztlfzzwzgkcwfmiimyiradgilsgjvwyjseeyysbrbbrtownjzdhqqqsowmwrxksswheeanhyefysfkujkweixwmmoazwjvssjmojcodouuydsxopyzhcgnttcerswetzytqvcmkvzzlnwdzvianltohtjwbdxwbcrdlfzmuaitumzjdlfwyrabxqsjtkfxuxdhsblvqjzpbkdqcbdackcwxhuouyjwdduhpfxbmqbvfbxoofttbbuvtjkrnppsjopouqnxanezwywyykjwxygfzazbmzezckvlltcdsrtcqkcjjtozafrdjktpzcucfwqimcfywafjkfdzzoiakrhvbcfpfrxnempsrxvboalningkflgojblgjgssiretvxyqwghiititholnbxxwobfxlwnxlsopgfewmfrypzwljzjxxmywvxykvqvmcwxxxgpxxysztpqftaudrmqftldiatxliplwuxalnfocvckuttowuonwplixkcsvfufgryytqjmaorqdvfkyiqoeboswtbbhbxpkctqwgnkrealqfbbbqnszjlpsdahggyabmxrahqpgbvsizfjmmjclgaadwhiituggpskijkmasplfsviodckdjtjczzpakcxrngxijovdsyuuqibnhtymwztyzzlpegnkyyfxbsjgxoqiqkamumudimrpqrtfpsszmmewicioeugrgzqiylgulcidjjqpwtfqntktzlzjxigehrwnxrzdlajfcrldjjthpjafapynghrixdxionbzocbghbbaqiezravjhcodfpneuomwzfdrsqvxcighsufpfltvbagsogkolegtzhlajplxpvzcgsemuioohathfxswczqdqvdrkziggwcfaejwmmtlbjqdowkrmterjfumflbuazkvhgcwwnmkorlydoisxhrwcibvnxfezzxurwjqwticsitqpxhnqgstydqxlxtxialmcktsrxylbcossdxpfrylruvdhmizeqinuxyanphmtoqjuhjlozkiazfztctzpersheezdruugbqtvxcplllylkwqtgugzmgyjwvntywbskfntvjgksoapgtxpqgiihdjwrsucmkgnqsumkrhovhteutqugbqytipwtivwfxtbeoeyslgprdxjuxzfhfbesgouxabtcbpjzhvizqcgeabpgwnkjprodsayfzedhjdjehekkkhxajgzeeumckkzepkbrjjyfajlazjaduofreukueyfpqbzxuvcekhvgrcbvvawvkscqwmkfmhzul\nvbmtrlvgqxptaotnbqicefnxmhsiyutufdqddxjhyqmxpuesyphqjdawgkwpelapgcajxahltcodnvkonxquusrjxecuzwyfzysgfxczkaqqjnbqikncwoolgqcanhfztdyvazaifcinlrjutigamsyssktzcfwizouxqyeluwcbazxzfipelqighzl\nsciqbuuqwlkavkmncespnjeeexidmfkjsghbdlfaozyfbomrstllfpijkwpcnieuhimgkhdkhhlsfmgnksuumobyibfoafzedthqbynaakwdrmbwisvgahyxrazsdqsffeubekqptqwsprpmkzzudxmllucahqyycattplfpldfnzclhkxdhbutlpfdmngjrkhdcavhygowmpvegxbmzavysgbzblzgygtudnmrncajujhlefezeobynmpbrcltfgvtmlywolfyczxxfnnhgoicprwbbkxhnvqzbcheltauxitjrmuvdslrdymslaimgteoptmkdeagtsiofurqifwcoegwrsgtqlssfaerrcvifhtkbsqpgueurdkdutcneafnxmkqfgdblfcajrngrteruidqoqakhtxfphmcxyvxvixvvuomfwauntaenmfclzxvdpcedeqbakzacatqtjzfaoxrziucmikyhhjvxwvlinncwvejlyggkzdxhixojdusjzyekilyfbicfufmturwcufjqdcromkudwfanashftgpphjtgvnwbvtxotgcvjpcrhhzagulnvfamejjafikuckcldocmezehexmpkqxqzblttawdcdgettwippkcdsxxgmivjrvqtqjzuspuqjlqdkzdawtggdqqucsidgsdtogrxroqxcfdwktkrhqabhlzjxnwntmldtexuicthfpiyzqgqcgmupzguakwegmhlbgjroshwaxbponlugxyxdudzoaqupswkurqxlfmoelmlsxxficprhctlavtzapevnbyeyeruqegintxjhiqapsiowmdkvqfmphjwmnaadntkitghjwewjjouhpmwhzdapdihzfzxfynovguzghmlvqcvuafjbvmvvoljqqfi\nwwmdbcwhuicsokffihitaivsumpsgpostyzzszsxtopsaeddaekqfpmdoypbtpyalsedinwekhewnwvpxtkcghzgdzkxqgbcvwthaxekatkzwgzmcroysaznkiswldlvrlvindsiliwpweozvoveqwwccvxrrjxitsdoctymiqjimhceexhasefrwypnposjotitgvprppyezudloxpzrrkopesqevfgzpzyqerjupvylugkfszpsrioisfsnvvephmnyolomazydumwwrceajxokbgnhaqtjnakfvafsutshglayemjmshyrrsgjlbhbkdsnmmewrxbrkkzgiskleacweuphexxrqartsxhqiamegfyhwodgewfycmwoaincanmdzsfpeshlwuyieoxrnifkpagesdqchbzonczxgnuupfuabkwlfrezhizfsieaxdojvngvqjuomkfaqyldflvycosynztbhjmqxerpakfvfzqcjuagenmeoghqoburxetslrftpdrmemzrjaxdihjrhmmbzovcyoclfedmsqgrfnmxlpxttzpkolybyjjhnmtaqpslnitzpngulvqfsfzeabbzjugydeybtafadidtwidlvgkwivnigwyvyaukgxkvahcvjokzijrrmcghetvfwafgrxqmugpjfdldzkskglnmxxciqctwgjmbafagpilbwqgaemfchefpzvmgvqdkjzejnucklynzqbstlsoiramexadssuqawynlcaxciyrctfcxgrnydocnfwmbbjpxmrtmjinitrzwhofvefwxgtztlmdshpgbduxvkimlzfuyfwqwsdwoknsygesmcydrpquwhbjhxgjzofuvshmgfddsdaygizzyyozgndgfbjqsgpwvkuyuubipkojyihwdmacnvnevlrrebtzmbiqhsnggiexlauixzsfnabnzahgyawgpeahampphmigditypxtwlmrlarmrvfsrxkuxxjtvfeilmogoqwyhqtmvxtuvmokwrxhqfvjlktrldtnwwkvfsqibcmjxnzoqccncrwwdttdpbegvsydstignhzkjpjqfvcbwijmwlzdmcwpcnpysofkctlxfmyexfhtljpqylqnbmtovuugvpqlbqqiastpragvapcxdkuqfghxuirtctitfpnjuahzvpzbuhxvgcuexmdmjcktlzfyvxcsflpjuonzglxqhermqnauwhewaouishlhcvnnstkpdquonotmyggnuicawxslbwzukowaxldjqivrwbettmatqebbcbbyzlscujloarpqmzjwkrqxcwpowbnoqngwhnabasrrxkwcbsidopednzvwcqlxansnjcjxosxzsdzrfmmyaiopooljxyyijodydjucmyniuajznduwivwlojghpcivvrbpvdcksrbxmnrysbrjzzxbhdghmnjwqdfeojszwgbmlarchpubugchoskdjmmbllcllykvkiuesitpsxomuxfutkrawekmsqdqchqqislbwispzszfpfknmkrufzfshpfodtpuuwxgefzhoovmjnwogduynmdjlvspkvsghzkzhiyhfdnlswiuzpzchesryjomiyvgsqgjkrmkygezgtbvyohddkidwvosrcdseuqwjyizjcuktpmxzfjfjvoruohdrudmlmhfgiyqghqyjjveeuxdfwdtbbnfflrustsejhfbxhrdiggmwmzltgpbtbpkmqqajcxchkydxrvnmiahbhreaoskknymoyxkcjehxgpbprnhdeqsfzpkbxmuqqwetbipubpiaettoegchjblgghdkroictybbpojjmiqfffsqfmwmotntglbptqoqoazytbavhnqhmxsxvuwx\nsrnedurycdcudtexwgaycxjuzfsvhwxsolaxvrcfjsvomjfimrbdwpybkpjrxugxlfodrdsnmtxbjrzvxnriipdkjykgcamxttddjwupvedolhkdkagmkxyqvwocnkmvutmrdpcmemeqzpqdpkqdsjhyzuiyzykjkiwxsocsitjizwjsndbxjxrxlwiukkqfjypgjljsjcuztktobkefbzqevbvjbbusgttrccwvjpakjszwqxndgnmamqgwxhtrccccydlomzidsdgumcwcjvozhbmkdqkyglxmgaoafowzgjjbjpozfdusoedgjsnzawgfsixwrqsxhacxzoqsnjplatocpbknufvdbjchivvoykbtydivlankqypvvfbuzffxpsiascfzltdqskcldqmeaccyxyhngkhonimkbfiplagmqwbwlplcgpkepdhcskxfczghmlrftgksnlxhbbifjshsebmljkdhwpianpxjrtsyahodrsxqbvxbtytyjwpkmxhysbcgmokvpggrjifninvonjdpuifyvajoijsxtvrtqckurvpiqsnmqst\nxisomhvlfkgupqmehxjqxcblklkbpbhiurvylfghcplbgczzqqmzahnzhlygvgwmbqiazgnyvtdgwijgwbgcxafvraxnwqytenwgpfjecmfwqukqatifcekjucbzybohrlrxxjjimmfdxyodgnuchwfuylcvqojzzbsbzgkcmdqrpjcxppywapbazjeraoneltsmlwnasrsvzeqchflefvlcmfavydiqxicrpkafzoiwvylbnqbqamodvjgnutnfylzkknyftdfqbtqvtbbmzbjsndtmanefqwghatmnudynjxyyfuabndvlbapegyshnjupqflhwxuhzpeixcbfkfjtjzjfgthyplhdvscnrfsmfkghroneznjtpmgogdflsdachbimftbqvnryduxntzqdagpqgwrrdqmugkwemszhmpdfbviuopbdxktzcwcvgailqpcpdlvdmcaikgmretnygadflgukyvnthvtgasgoskzsctufuhrkywwazpfxifekcpzcskrkxkhntyljzyevvdegarwdkyafcejluofodlhyxoijhfdglgerevheqyzmfinlibbtabsscgahzfieosgdbmtgybunkktgepklzjsqmtofbsoniikeoqfisldmdnrwkuyedvjmfkpvlzuzvgiwuuiomazcarmqctonqiswrxyqlifqcicpbphqyacnlagbhbtanjfyqasnndosddhwaxlpxhmzyzvbznmjuszkvmnyzmekhmiafkblxdhifjfquzsgvahgwaufoywnnxglyzbyctkebfxvakwowkistkizkzjnbrrxzzqpgulosjsyfgzepdvhktamgxiqvzirgrxlvugdzpxvpvggmjuclmjupfheitolnjvefmjebnjxajmevkqvtbksrwfgbooxhchqcjhfgtwqydrwtddcthcoysdjervyevabnvicmhqynrafcvwkjrxoouuwcaqwrozdsvouypikezikpabrazmxhxrixnojtschirzjbfgffawytdzfcbekytiihfbekfisycszlhbeujfiehjjjciblwgtgrszogjssjnnlugelskrigptvhtwnjbwuyczwkarowbtnfgawaeucpcnengjemmcvpqslvtsoawirvilpqrkvrscigakjnpzzihopntdwuhozmaqqwqitkayflsiymllcvogbjhwxyrzjehyclrevpyoepfwykxvadoajrrsjfdkvuddnhkovcvqpajyrpmzqxptfxwfyhcfxhjjjhcxzmswjftkuevjifuhtfyoybdkyqlosqebbgitjmqbzkgaguxixakpjudwqtmjaerinyoxhulhlmcisrfnlvuilameyythhymjjdgapavsmydcmgyupcpkkejtphnwxrtstjhdqmrpoaeifitzbhulcszobqvkuljvqzzntvcknktqmqpoistfbdjqsdjhqsrbqcbvyrkpfetdhyimizkvuwuwzsoiayhvadxiwbkdaunbnbhkweijhmrrttpvkolrdeizjgxrsjtksrkgvjpjjblwugzccasdcbfhbqwtsacdalwuymukbnibziioeudzuykpuouvggkepijtqjmqksloyiicescwjvwiabkhclmjxycnhiiahccndrhskhrepsxsplbvcoqtisqqivzkkzybwbzkkjdjqyijqxoggpjjzeozgogeawbfnqfrdkginenzliqvapkfmxnixsozoidaylflpijlodhrlgpqsxulma\nbeysebafvactijuabwbncooebuarxguhucoxwydsyfayldbddekgkruxhjwlpchnfvdgambefhdcetjnzqkuxncqerzemelhsaagobafvllaejogcrlddwezdzzvbfydaikdzlzxbyaezowgoioxfanbyhmyfocwajjnirkzeqwwydccpsjfllrkkhargxwzxgicgdmcxgxzkianvnorcwkpcidrbqgcqnxeopkoapdvmakjlqhcycwcplkrkelfnjeoaoevgrlkzuyofjokyvvhgrfyawsdprjrksqalkzdcwsjnjvpzqrvtirglfduqheotydnpnqisnjqnxiiewcafporcnxclmbnphrqnfoxxqvvphdfmblfsspjarmngcrcrzveipwzonrpugkbdiiknqcebazmgescqlrtaoyzvcxiyiwkenibwotjycsquvlzzgczbephmsiduafwxvkzakvcrqtzfcxjvvyxgbrvsycqzfdcyjsysfobvuszgvovmstvvsrdsvbtpbyawbmehddqethmbkchtljpbstrmizpgngc\necfmdzrupzxuaevnswxokdauiftjobiolfpmytfsfxipknujpqzqtfslczaykckmxmfnvylnguuspakjbiacwewsmocxgicrodaadvklxguibsqsydklnggnkgmqtfnvzrrgczuqdisrmsbhrcwfcmfydplzvulaukavvebqlavwrmaabuuotoyforrzgyewadnpxqlwvpddrviqxbcicvkjzfqihfzkyrnnsqxknvixykxzjofxbehmqbdbrvkmpiuqhwphwzpoxujtyfiuabsyopgfkdfbxocgrzzgdiombalkdwvptbhtiopypxtsyoaaeuaxyffccdboumqrkuqxzuuqfukokwqcgkjyqrjpryjhlsrsmpeqciousrxspjpcysogogwttzuvzqcrugtwbncyvbqshuhebilaizkjqtuuhogkvuhnwxsvzfvhnkmeyvawjnqltewcxtwgtceuouktwkpkskjekxqxhjlajakqcjwxcjvtuhizijunxniivrozxqtuwwswtzmibwdqqmpjmmjpwijzbpzmufokghryugtnfhcbvmrfdwsosarvnmyeuritazfqwndtapuocwefashadrnnkpplgjxllehswvgonobbdurirfzyrmiuunuzhgfhanlecjzuvkkytksepsusmiksghtkxokfjgduxgezoogezoiypumphwbbfhsjqofqkcadwupprrbizcyzngebyjxfpyskophadumnzefstqriwtxzgeofxqamftactunciljezuruagkbalhngrybbkvfqfribwdrdyxacafexvqzsziiehlbxwsyarlwqswicebxdhxwxdeqhbcpdrydpwfjiseoofekvkyrjcfnktpkzzffddvjkjooabvvbrxfaimcwrbcifhuhurayrkqvhmvnlvarjasazxyjeawuuakrzgphzhnkmtowjrpujzbmdpqwkzqjdxzkidqsiqybnhhnjndsdwetajwwhismzieprhzdudkbrqspqtiyujvnbupsqvubthpftkyehithcspmvvkbxrgfzwgmezdhzpvakazemsbsjozlpfzokbtbarhjemrtuevabqarjwuxsdmdjppbnhwzwtksdshpvrscdalcrximqckmohkcbbvhirujkkyejwzvtmuanzbtbzjpbuoisjukonwlqyiqcpeuupsolsijwghrkzoyhkisrjglhobiedaxdzrworjhegieeocghkbjiuzvibcsrwfftipmwbdnhjitrxxpzjfmklncbyyhtgnxklwsathkztelixseqramiuokixhujegrrgkokzpplhwgxuljpqavlxuskgejchsldqdctthuxtgrwqmdxtrsodxbgndnaknyfnhmojwkyuqyjeadbdlofmntqoybkpxdwxtyixrufkkatsyjffdxxspzosjemembpnhksngybteugmwowhtfgthzhkcysfbinzsnxvyjhiqmohfjqhrlieeipenzqcckxuumatbkifqdvhnuxifqadvxdyhuvkkhrmqqdxzdtkuxkrepzybvpkgiutayhdcrcbofhzyitkpxgpgfqjbtlojozbpptrxiwwhxbvgmsmxiutvhjqxkuyuetujszeuinvbzqhdqntlwlaxqaprynkruxfsmkxvjacnerstrjvuedkuzdkzsakztymyvxgppsdntldqhpafhyyvk\nocmpqameiakvklvvtzmidpktpusktluavozgyqjmwmacwxbrtkgmyibclkgyyhvyhscvviemqjitxqkywjnxecdbgeejfxyxhklewodgffekpgojzwnnilkrznuyrqfnsbtgkjydrieklctbhkjjfsqzdcatdiuizduvmdjgxtsshzzkogsqukntupnfubjqlexywzkpussgqvczhnwcgbbzvwrjpuklpdpazptrrtxtvqetjnbiahyomjlhwlohgeatcxrmfyjdduuqlwfbuwlddvpuoglgsbiiskuxoqtnruitmwwfhfcwzpqomiixmlikeqzhjmwmfqjohxfhbimgyxwubafzqphnwxmmyaomeyaqfuzeivwaizvnmehlgklckwmpukxeuxxcddkspnyqlxrhiokzrtrxjltnprrrbjumoydvhxyrsignwrthmpjnfuugyxypehpjwryksrpwdqtkmtkcnhbrnixvqgtnynqoollsqvglbrusvsmlistnwsxxizakjtmrdasqewjxgowjkybsibxapquuzwlipajpoipvoafljlheiowidudxtgxzbpgtny\nqjpyhmhzsrklqstgskwbmudevyajnasfcbnyvgsswwjassyqrzqutwmfvtxbmzsxsywibcwqodraufbpgotfbnwxgvgddywsvylolhilqpdqunzzjfspdbiewsgeebubdikmqtpbcxwfszxwelafyolubfygjulcqoyqswiokejfldewfoyraniknlsaonqzassgpbtqmpnkxekxogcxpqasonhpoelfnlhcpzcpszjrfosbrqdzvullmxeqlqqpcbceqypxivmbafdipzmrgpiqyfofwkwafsxihaefgoscoeoirponzdkakpkksgjytfcmhaiibgspvhmdzgossvezldhjuuuhpyioqqjpxtsljixuccrjwjdpykyavzmplftdremcybyksasaytwbvhgshclzbjgalfseoeliqvhlbljwdouoqkcqazfflsnopeeihtiztoczebnafqmedylflfvrkbwtrtylqqoxrmlimluyrxsstdohitusyswlxbbpnfagdzjylqxtzzhdwarwsisekpnirrcbjaylbtieucfeoqkqdcyontjoavkhodpwqhwyczxnlj\njsnismaovnpqybgoxiznquosuglrldcwygfiuitvddxakxcgrvnvrpxcybcjoflbltcvsqsbfcjsolesfbyfzuuzoctcrkbmcfewlwixxulniprqydeudvbzikovvxnvlbmydcydijzmzzcawzmtbijadavpxehvxfgrcskldytrnijpuxqzsnxxlojtkpoltfmzbezqizfhtextdjggnwdgxwiarmvtemqxcortdckbdcmcwuiwfdwrbrdaqrkmydsyqnuxdwatcmemmfcyzzpltvzniqvjyecnvegfaniozsrobywxrzbdxemyvxqctvsnrkpbrllgibjkwnkiwbfbbrlajihmaywizxbzyrlkevpnrsjjwhnviedtjjjyshdowkvcxektnrfyhybptsgmsbpsmsmwinjiilpfcosfefemqwbxmaaisjywpgwkpzbnlggmrfjhrhlnvckfablhsrqtngijlfmpcxvurganvgcppumwaijduxatwomxzjhxddigzbxmhwbwochcxhidzvkuuemcyvhwdfvckmarqbssdiwpvyejwnwefdimxoeulupnaldahaftalkamwjopzofobdwrfjosfxkqreuhppleszbzzzjkswznsrcpqtlbjbplypovwnobpaykicxahwsuiotypkzpeotkmootstkiedvoddwtuowjufymenwniyjcgtdgfwmgcchaeaaspqsqfmpgokhlxjjzzqeramrorldjwdvihbbobrhclvzgmhjixozrdvejbeigpizemjwfoifnxavrjuajodxzkdxujdibfpitgdxgkjpfjuvbgqfxhbesoguirrdnrcicaaogyfkzexifidpyqwpbtzkrgkgcibjemqzitrnaqsrquzupjejgwcaikrijjpzlwruvdxoyxkmxkfnbnvgmpagcnvxwxwrgzkpykyeqcdwywzzfujxdiwjgcqaojggviijucmyezttabpqqspbhgosbdmweuvxshlrqifexeaifzxlkufahhenwotlkzhuemeomolejpamqilsmmtyangnsojkjxyloljgxcczprvtlgzgjtueisezvrjcngclgacmjvuoqpdtugjruzfvtbthwnwlnejhggnmirkxhzhjxtqujylyixmcevqvpvayveysnzklznnhnvegivxabazlycapswvwlkdmhprdsrvpoirnrsdbrwraxginzsrbjcjvmrikpgbduwciafthgiqniroltntdobytcoboskliaudmoxoluoqtctgzxvtybjtiwqatbrdqcqsarkcajgjjokkizevexgdzwsdjtazyforcoakuzhfermvawtitpjmtfmwuxhrzaxfmtebszzdfzxbkeyfhyecamekubxcanceradalscbgvinhipguglzrohbebxclbrsennazjbgtmscssvqxivbrkbajiqxokeqtkkbtsnhntakvlczzyppwjcxecoznlagzkpesyuizjuzkkznrertbwbnjmvcwirazssmqaiphxbryvvczjnkibfacopadqroz\nulaozinkdoqgjzmmecgylharbajrozzhxfxzsspchhbodboocsuhbbnuconcrqszhnypapavgaelpphetpfidlgrnnegmkxxxgcygymxcqbxdqvcxayvjhbfdcpkbccdcbzgynkgcwczoqcrphwtakmegddgnfalcfbzfurchcjfpylfathtatpclvhtqkkwkndqoohrhtjoaxnxumpvmybkinebuppkpinhucymwphhigxmeqqwhgvbepvunsjbmnvrjadgjyemycdanbykvbmhgshkgjotpqyfxwexwhmtiqzvrpejdxbzoajbmtqceosownzkrbtcjbcqtpdnoebntaqfrwfrmicrkzcfywobetnyqaricctluiugkopxsfnwvlgyimbrxxcdsiczniabsvhocvocvkoaqkxhssyxdhrayeccxutflognzohpjzracvheauwnjainsmukpnavlebmgntgjdhcczrxefcutqbkbutqbqfazmazldajpkvbwqmzgheyfxbxisjsznxowaiidgokyvfrjbgqbuwhidpifuagoekosxnbnzohdajsnefrriwrzrlnnnomvjkdabgkvbukisahycshituglvruopoaquantnjmspgqssaiivxulwvxpzfovnmzjkqobhgcbmnxjvhggeqshowajtyrrcsfhbcsruqkupvkqyuhsgoaompabuuwzgvlmspbcdvlnpykwbimisbbygsaqnbarjuvkhyciozxpwxxbbmhvlzdwpcqjbmzbqtcrzntqohu\nekjigdajafkppnhydrfvjwwmwdhaxsoogvbfcgqswzzsfhkulbqfqcfdlwzduprfewoixberujgppduysaxgttgvwhenkqmrnkxoufyiokqitmkeahzxgcfjdkoopmshqdpiyxpfghflpygaegeotdijbysuwwunagkwtgcsnwuzqfrevzuspfgxmawohnkhyqppfnmryicscmivhbfwfbexsojqgoaahynhehjschrqgnnfkqriumabuqmiqwmeglvqnxvpqfodofrezbyoijkgybnarisdhpfaitfojsidcfkmcxsmexsahjnocqarabjtzoyaggcynknhjphmgbkojjbjljucdbsljvylcaimvprjbwtlaxhlscnmmhmtlcxtutuuuggqmdqsapvrfkwzblyhyfynmwbvppbgsvbwpnctifyzpshcofqdphjugeegzqpaougrxroksudhaiasjtsixsozcfkfnhdtgtjgdkkbklmsmmirvqlkddskxzvunyulpijxrskezjtkylawaarrbozlhgvvbaqzcvbmdralhdltheyjuebzjyzaoxgjbkwmdebgpojysshwbtjhijkdatflnoobuzfyigqwbifzddujyxekjiskqnyokcdrxsfshcrsujvoqtjhikgljuvmgrrilofexgqitauzaxgfrbwykndseofkcxtdmzxmsibunthpnptzzflheedftloikliowwknhjfhabdcbtsgrchmygnxwtcwnbkaqqfnkolhjopivklazyfvneoszrpsxkofsomaxdthxsstpjchnvlkuanlshvccydxqntmjhnvjdtdjbfhlaeldmacyzssjorceppbotfyuwkoabailcoronbszestvegujbfvwutanzzklydgwtyeyhavvrziyzlymkvxxxrtmvxkujiirotzflbvxclbqkscvjsxgfrvdzvmtarysjjmlyanupxjpcnvexbwsxvoqxdypqrqdhpiannumpiaxokrhvndtxxfgzoaqzrcyoudvhgmbknctfyvwwqgrudpabviyrouurnvfbfcyvchuiqjuqsflylkufiijwiagrszgananopisdadqgkvpdvjaweomefwmdrbkdfjazrljhjuwkzyxsysmvudiqiwgotqzsavydxzgvwkwuujkqldlqgnjhwsyafugkqenvnmdudyfttgebyuwmisvyphtstatzforpofsbtvhkpazxwzyzxlitmdhksqyhekdppqebyvuzyjufwmsxskxfgkqgbueuqwloyhvltsfoxrhjygzgyhtznyfjwausigkkygjnjegobowkfxqksguamnhyeuasubwogjxwexunwbkfhioqeysjafwyqhslclblehaytxdgrawxjdymwfhlzcsaatximeaglktxdurrwasvinwdjiatknywttrvispekstmovnegiqwwrqauzhlcuyevvgbglyutmhimwzbeahderwjrrsurfinlcgpstklesgzwvzskhridyjmrxettrqrosaigyrfuqrdduiitgwotyiyppprzehhctbrabztqcrdoreayqkrrstejfohgecokqpxzynqvpmdqcfmduwzdwqoykhsrvcqqrivihihbhuwhpsvdcazeufwfcodbykbzfihqeobnqpojcwxtfqmlspjueitejzuwokctxbdwlknxcxqtbokogxfpirnytofmjfnr\ndqiqwyajvfjoopyootrjavmwerhcevzxegqrhqciktcgjwogrqxljqbhmhnbytqkycymdpiwcoljklusxhasyttvadsaoifdvyltqhtvelhbafqfblhqwzpzqhqnpjatrexirxxtjuvcxeyzcaaqrfiardhhmsjgkfpvujfnlzpgvcgxbtpshiqexlmckgigcggdroolitvyjzuqwstfbraawwehhxbbuumshfishwmenzynrnlwmqkytwoynbsntuuah\nesuqthzzctgnbnuotlreoavjxxzytnntuupxwyqwacgnsehyizksudnaiyemgplxfyrqwcsafriybrjhbhfaffdjjgvavqsammjdyowycbaroggwprztknmltugvsiaihywxkiiwecmayslgpgxoknsknctqghfebifipnwevhuviejmzmbfcktwcudmqwnymdfhuynrssnxccexluuceqoreygwmxxrbnnhhtzidvaglnaabikugaisfmcqdhewlxyjurcbvhmjbnxrrtbltofpqciympmafotkqcbdtwobxkwrdtgsysfuoyoffpdkhsigekhqhtbpymdztyjoftsxutfzzdnqhpbwdfoseaywmjogfqkkzqwvkvdtlyjjokwmdoaskgaqghdfplopeboyodywpjjsjegprprruhemenkgrotszfdheuhxmwjslfdfshxazrmqbnwwtdrwjitaowartswyiudfsnvwdyywuccfjjbbmfogstzvmxzxvbhscbsvzwurxtnoesnejcdgcodirrkoviujgdohqgfkzezxbzgidkifwmygdqlwmhybztltebaqfnsfbuuexgdogzoonqggswbgstptlvpcntzpiplxlqfovwmxqnquathxftxmwtgoevauybyqfposuvnqfmihjslfinmxrpfktlxrwunasnnmcibeaxtygbwpwikrwfppeezetjkobrsbnhiqdfqahorkruzxlxnhuyymxcyjczjidkynbnrusmxlvvdzlnkvlxfplmglaavqlhzdxlehxlpnozhkehjeghmqgjyxyrqquxnzvjnqyzzfbmrstitlkezrupooudqbbsqdqvkxhahkfuveluzjhsvnkgqhtdusyzejvnapekhwmjemlsseohwbvcwjafgurnbagyuqxqqmezlhhprrfakntoplvkcmsczzbinhutjlvtqafrkezvsojocwtcjunebtvcvywhaehhpnxktrfbkeynpuqyrzqvezcesguxtgwzwplzenxbgeazegfivmojiripxihriemtnehbqvezpiprfnxnlaexxtnlhkhvtjjhufgwcsbdelyrjkucburgkdelxxgdptntvktzetyrxmahnithuixwdcfxjvvtltotimheywqlyampfecpefveaipmvenzbdsufogrmpeotczwvdeosbgmgrxupfhivvbqslgmltamsctstxgzwhegrdcupuqqkgekqksdcqrxrlgiwjjoihlahrsqzrwasnmokbngilefshlbuzlcrekmbjvnxcnjfuovsrepuzjkexrfxmoinvgfhibiioixsxufuygkznsmwnquiucfydrbsmimpjmonfobdbnumykrtclciqratbyfwgssoozmpqxhhmhdmighvbbrfltlozsyrjmubnlvoxweeitmmycmvmqmlbrjhoywmsbtdjxcckeynqwqyanvjmvgdpwidoypdckxwhjzibfwwquemqqkjxchzbbegpcjcwpwkulfyflabigbsjktwsgyhaasfctscprqinveuzqylfjpduhwknibxglvecovvtijklqxtvmiurnbowxfnhuyqkfefuqudhbrspdyhfdahpyejivk\nwcukprgtdlgarthkraoshisjifzoqkxqjeqaxpbrrrpuwyaojeltsupgqdowvfollgcdkhctzfhljpkiymeamvmrtewrtmgfadsqgvbvbrbicyrouhlbhjodupitwgkwulsiibrievbedpitidpbpskimqvgerpqchawzaigfxnnxbonwrhgylptefdpzhpoyvxdrukaihtmcedrirfkhapomvebspboelqwojzbxdsagsciojkcjiccyqloqjjxxpevgtmjqmgzpvmbpvfxawapibnatjyhwxttugsraaehmpatefbfesfcrzwothdztdtvzkstripjsactpngonqbiyqngmxawcndqbvqehxzqvucksxyxuzmvtvpxvekpdbodsjgmplxidxnejywopcsygnkanzivyyqpqwtqwsunkzkcfalemrvbntveakormcmvbdohscwijhgdzqjvozkrfifsegogmqjewonffpyhsrtkpnxbyyegzqkhptvucvkncgnlnwhnjjdqftaiycubkudqstukehncpyrfodjjvdecpiqmmzohvapxrsymcqokngnigsncxnqxvpuoclwzbkwxsccintmefoymfbvlzflvmtbvwodmlmeeezcasumjttvgdusmbzsrlwnlcnsimgqkvucgfgnuhdabuhxqhwqqybdbgqimjedeelrzuhlxcvegcuedowkbzyxpkqrygemppzqgvszfedckihioxxomxxgxeoxgdsxbacfmxdpgrecyxgtflzrlawvpmqubqzpsafzpascjcskfjiabhifoudaxdgisypddlbdyojhocnrtynmfvuxjkggqgobgoljgyjpyivywtzmzhlbkrfejwdfexmtwwugqjtquhoycnneyykmfzdawlpsaifesgaqkmgdplpbbsbztjyambyabduuhsmeygtwxgskiytoixyhfxptuedulaeypzfwhbycqbckopgwvqlchqfiebizpfleqtbvjcclkjwrbuopfjcqwihezpzeckjshbumxmfawbjquvlgelnjagfxikijjfyqlvkbqkahguneiyrkwouhimuaimbxblecuxxslnttfijraqqxivdsiriloykbsisoesqsdycnwnrufjacfogkdvqlfbhfbmjxmadoksxeypcvclwcjrrlruppaexsaqnysahflomcqqcnkcahkzjdurndppkxeixodkalssxxdjgxvionbasqeyhkjwympjdfmevqpcvcsbohcogvsrarmffgdzhvyoxvenmafcwysiomrdkcekpbejuukwnjwqbxabddltfnmgwnnkcjxhjcqamvbbidzvpcqumzmcxomrqkuzofxfwteekdbscguiaxvlzwrrielulifiuazwijfolzlmtkeqeopppasimriboiborkyigcddnkxshtmnmrsgqdxdhqqereetlukckdgvuseaztqxfgvkswdttasrzrxdgtvuxgakniuorvelxudxcoedljnysyehgtscwikikfyjwtthuztraepgvkwqitmixdpdpeanydyxdrafkbizjczbmanorgxszitdeajpnlkafubofkciyijtwxhrviyceydbojtmyyqznegzkhjonhshmztzgcmjfoujyutolydgvuwtymghfigwqjeoqlmsakddsvmxcpjxmbjyjdn\njprmgsmnhtguqdgheavumrxkzpuyottypcciphphubugpjntjvrnrsnexxeoovaoqvfvoqyocevbyutxyktjagioqhepeaqsevpdbqauiabyqxquytpsggtxznuternypqfooviojdoilpoitlghplscdqonczbdjwdwtliarknabcswbaugezlioqhbdajqdsvleqqrexqorpkmailawwkwxdmhkflcrqxqbewlkexdyuqbzndwtngrhbtjmenqbwgmigfvffvttngbljxjeflfjiucdzksuslebdconeaulujbkigwwatlxescrwyupapwajhgqzbxwjdavukadllyhbldpnlnydzljdkkikezueuzzljilmodivxtmsodhsboxfrsrilucpyzmpxovpwabzojfmnjvlnedtfdebnonvvwbhvxsspnqvvzsvbwzpisolwnwdmgaeorgjvqnxjawujxyakdiktyqtofqutwhlckodnajsgnehwduukhzuqzhpyummqlipuhmbbcqlqgaockwnkyuxtbauntabbcpqezobbxezhwhhpmvzohhpbekcvdzhvgquufzfuqkeblcjyyxmzstiqnxgeoigcwrczsqrrkneedpsrieslezfwpwlpbkqmlzpdrtwfvxdajbduffymfyyajcvqsgwqatzmqemscflacpoqquktwcockpqvkemthyzxtgnmhuwletkmqbsakdccwozgryvczclwlnrjugcxqttwioptrzmppqfokpwffybsinwwqkeeuwbgnwtfzmsvibwcywuoeohdfysyanhrvpixcmwbbaylrwxsrdszlvdzdjttwjncdpohjgawzvmrbxkogegkpuhlkknjryjjptmefdqsmndphzxsxcdebzrhscwultlsuhymtacplmjyupudtrulmphegsphxlvekfxeilspjhiknffluzrtrsakepcrdnlohugrvbxohjkdcseufwlsupsvzrvwoizukhvxjsljchzsmpbzltcbsjpoikcutsqmrkmcfvslpddwrsmzlvqakqlbelznxbiubchirnmbnxuzehmwuesllfsgyvsnjgwtjskikgtgkayhlqncosurybeszxrjlancyowkufwervncrlywahvvgynrwtjkmxxljqjmjdibbsuuvmggikznghmvkusuqaailbwjmyxnbufcvxyozflhunrxxtwzdyafnubfesihmuzjsqbcfypobicfgazykbvdeyfphcpozdzfwhfrnwpmcopgfjnlekyewewovdcodfnumfzuaelheieomzygzsduoghhfwrjsoloapmlicxikthdwfgyppfovogyvskarfcubesiwogbxqmagqnvlnwnupgdmhtnetlxoeahsntyeunlmgkbrfpvcstsslialfwbeigvvpkicroqmhnbccgiqcwbvnybhdqcqeucbqcxqniqrhleixzqntxwtibhbazkkpssbkjvmdvwbrvublhnapqtugddtqvqpkjyucrphclzlydzesmjtkzmtmgvziicllbzjlwyemmugbpboqbgjqqjbbcxqdqqfzjbnzsxqiwetdif\nhyaodtzpvbllrxzpes\nefilwbfonkbrbtgpokarpxtekvyhwrcvtaablrbffmqvzxvjsioiyefbgljjnhpuymvdsqhcevsaxhbtrkxejawbeehgrinfaycvrzrdgmzomqbizmvxnkunsnbbnjwulctrtgtscnlgdoksrvcgpskaiupohjxoebcitbvxrssaxeyjrpmdjrgvdyfrqoteeepomilrmoaurleswdjusgknawmefymmnvomfcnxgczzqlmtigjqefszfefbtudqofjbffldofbtjehcygeuehnbzpaategslyosvmvlfhnrwnrhpsloamxtqaixqgfrjpovukznoxjvubztygaelzlsadpdrwwvqntpgmugobuhyrwfynueqlywcgpfdfdytgnjgwuyjmnobsgrluiissmjvkaljtmnvnefukuhydwasiarkjkhinmirqolblenvxapccbkgsprcpmtepwssbbtppxiqkfsqcbudygosqhqwsdymllvximffazqphcestdmqaetjofpsclhbxmuqhkajhkrdewugxnkjuntlwrmzpocuklyazvggclmvdfieerwteksriekdaoxmwpjwqayoowxqpdkfjusiurgljgpjgnmmcgpbblmrkguhryirszbjfjjqabynjvobbsvyvcczskwwuoxjmqbeskhsubxosuvznvfkarphzkfuiyyaenqkybugsiodrlvfxnloqkdjgaiyoovisrkeddaxygwqhqlsyqcmuhsyrpfvdioijzenzefignlupjavizezdwhetnemhyrmkflatxhgdwsjrkszxqaywjumxjkecqhjjonfeeenknpiqbbzlaognhqnzvlinkgnyyujmkhwft\nkaptdjkisjvrvkxpxxsrmjoisgncfpsmdaufeelrersprhpynuuwnyzfkuldamtoqzlubackisizykxkfkxffgpuwmzhngsjuofoqltwohniyofhyxqfoqdruxbykeiyfdwbddbouxpxneepqtplqxgkhoedtwdnbfquamxtbyjpftgbpftkjkklptiexreoesoeeyvwdsqpxruyjieruhqvlspheelnsxjzwgherqasrfboeazyjyxhklqfdbvbukhlahkkuhhvqcwhebaxtgikccabuicmbmqmnkkkadajxwozfmcmlgaxrtmviinqrufdflkqlnjucalesjomxumbjqrdpshipolqewmovmfqrcoejqzdhbxvibndlxdxvnwngootokheeyaxincismjmbaqpjoalpgzloybwjuoozvybnzievxrhwxvvjteufecoahcteovophecifuecxrsoywpomydnnpztzverrvdymughdkwmylnvpwrigogttucsaknksdzwkgucbzohhuzadkzschnsdmfngebzhzwnyavgzokltpujjjvykvwwmlntdtcobqhrblfhucowymkgvmiajbmgsgorresjhlhuqleqmaactzqmebpvawobsnzmceamrvwgzrjyrluzlpwzffiovymvlvqpgyhbdfglknatmwqjeiswoavlhwgsjhxgdxpmlkzzwpxrcnwrirtjetphfccenonejcawwrtxsnkxpzdznkunfiwebbxjuvutuautuqptwzmwzguixphuuqygzzlauxwjuvnhnwmctoswbccdgsywacwnwhkcmbysqungolqxqxqotepievzdrkojfkttfpbsjumkdmvopbakvtjpxhpnqrwcpnjmfmqjnocevluzrwekrpvvnhitybnsvlujeclfelxdngnxfjjqjqpxsguzfvzlloswlzuesgntdrykpnwatxpbkmsuvptnjrezbmbdccoxqnovgvlgukgmbuikdixxwyknzqiuagyxpavypseeaebgqhtambthvsiqqpwawxuprgasicbceringonspxuhexatybpybvlxklptpuzvkdrroeoynjifeovblbzxqxqpeiqzveenncqkivndghjxusumkjmozafygvaivnaahuruycihyyqjyfdnaurzfnkwjytzsjoszqvtxvabqgahzmilfvqlsjyyuhhsortjihtqgllwdygawnvpyttvrcxknpbspcfzgojpbwvetmfmfvpmmnxddjnlyytuzjayopvpffvalxwxsoaermbegcbnvnrympqfuhovlxhxeukxkpeshjzmduhckoigairsnf\ngigqsrysvkarmawwarmoozqyfrymowlcttbfhtkinjjgihwtsqyyfcuclsbtioicoplknsmifwrovqieeyfhjwewuacnctpyfzdytjlmsgnfpxozzmgfshpslrmczcqfnrjpbnpujupebtizcohruopvhyzegyppmtchwilnveczpbwnwdnchqpphwbpvfcwfkkyzjixwtbcibwzbmfabjmckksgjjhdxuhhztgavmemvtxxsxmtbeelcgaxobstvpbnclnzhldoylvlutbzwoxiauhooaucelqwkvlbbrpmhaviarudxfvjktlucghqklrsvhggunlepwmhuravecuttmmwvowoctyvnyfybbrponuykucjuophbbhywpaycyabpvtjzamxzuzdyrcmqvytnfiaqnimnncrgbmlydiqhnzakshrncgtqjnmtbtkraecuituteladpiqbhxycvxfahyozapfrslekfksfnfusvfjjvopbpoioktslclkqcylwylhzjcljlsjpjuljpdwadqmjwkrmcaowfqhqlefdiqfjatsmjrnbqjugruarjqjgafifgtkljbzdvqsfmygxkxkllihakmikyzjbwgeddsangvnmmfhhwykfwerbndkrrifsvfyamxzbjlyuaqtoejjrhayzjdzpnrspzxkacilojfgmpccvfeyxbiklmsexxdeqsrovmgehzddxfxgptwpkvbschspokggsapfajpwvbfbmlhwlbrcazxzjrpoamewhjpomgwhycborqmugykukfbdzidunmrugfmzfvrqffhxhqqlcqvjezqunpknvdvlmohwtsdcfguopghpwibpjfqhvuvzwltfbxesrhsuzbcpmrvevgmrcldgmqafrhiqovelhkecwxqzjhlbqrnrvjdvmmisyyk\ntfyrvlagphsynjrkltjyypojrcqgshkkzfrlcjdmbmirdizgsquxncvcasucyzidkaftrmjhhatxnmzndbbqbbimzyvtpcbazncryuetowoqyvjdyrdnaxvosxygelptntdhfokoyrvngdmpshjudupacgupnvbbiaexyfqbbepcvranirjdpbqvjynevvkzolvqanzcllorwzaakrwjtyzprspfzizlrlugxgftghwsciuwmysaluyoyhikojttzhemfzycuoklksovpavxdajgtwkfapjtauonnimlhgoydptrqioxbjrnqofqrvklyrypsowfpoacxantyetinkaootlccvvglnsmisrxszsvugurbeekfzfbugrtounhtecaknnhfddytbnuthpaprsnhwqsphimzppzlmcutxuuntybqqxxdfnzpovuyzgmidjulkwsxjjrsrliqzljtovtkxgxknajpvkkzosdzeofvfbffszbifgxsqmxtqevacrhtgirhgwrdkmubozvbpmztkdzedywbdtislkgoqnwudnhczdpxhqzptxmcwjvzluxvnvmjhxcuvmvusanaeiugsxqtaxwzrwmcafglcbuqnpbfsflspmfahdkggtyikqbgivslupcskjdruelgonehsdoddxhmcktxjprtjbcupykibzjxchckylahmtsdsakekhibywoqupuxdqdqkjtukcexqurfvylicyjuxvutccznlqyjhdfmenwvmyiowvtomyozixwgknnwbhqcirowqqkanwjeeswkiufaoqahfdafyphfcgksdzyqacoagvzutckruogieoqnozboiueldktazswtpijsimstnddhyggkybihjjsujovzjtzidzbgodtiirnwgayxjacijmhxcntyzpvrtteemfsunnxuwevoyjlbbswxlnwzokhxwiustkfjsfwkpaagkfiebbnxvigorkrpteiucrbcdfsrhbnkzehkzrejdexxvomdhmksrxsorpruqmsyueimccfeokwijjxffpknharlaastvrwbvlpdlombcfqdzrqgmfeunaycitxyryogkcijmuigqyhjquwfxokxyrywxidddxmdwuhsyzcqarqzmshohdgfpnrjinoluadxiwifjjeixepktoqaosgjvlwcjsphujjuyolrtgnoxcgwwzfqvzotlgjxtmgmzcidezmnxtjomtdfwxaxfyicosetsdzclkmtrzsfhcafwhqkrmzvpshatbdvrlkhjopijuvfpvqccvfozwayeenkgzmrrvogphjlhldtzjtmeteapyrzhssfansyfqxcxdoklkonoeoombiozwmdpawxmgonumeatqcwlnqvoebqyydzyionwqhfzdwijxmeadscoehlyqlyfxiilpbpltyyitjrvjtkitonpgrxajtnkkubtybohfqmlbbnyeaaibqrichtvopggtuzxfywnqtscwqvrsgskpcidwvoektdagjmymsmmjqrsvkywfawzlmejquvuatnwknmrktvbxxpfjzdbvdqwlonocefqvxbsjokyzzvlewwaahccipyovwdtvsmfstbrnsmyjirpmblgaevfkdaagbbfcjswinnrvykpklpdgubssxjvqxnnnpadrtszlsoxxiwrbkwksdrzqwtnxziujblgibfxfceuwmptmcbmstrqopzwbvuffxserzsvovjxocgsjkspcotjxceycbtfjipazpxwdpxd\nhrkbndkybcqvrkvkndurtgmfaehzytppddmklfczlgmcmphwqiqfzmnxebkpakvxdixgbtguukvbmxhwkbyatgwwcqzqzrlcbtbfpgitspopdsahsbtmxdtgrezgbpuqfnrpnxzmuazoyrhkopxxevbnfpnuwjnfdnmioziiwdkkkryvinvzipztotxltezivqmym\n",
"100\nhq\nh\nmeayl\nlfdxfi\ncvscxggb\nkfnqdux\nfnf\nzvsrt\njprep\ngxrpn\nvy\ntmwcysy\ncqpev\nk\nffmznim\nkasvwsr\nnzkycxf\ntlsg\np\nfaopode\nxzbcoejuvp\naboygp\neylfp\nnpljvrvi\nya\nyehwqnq\nqpmxuj\nloovao\nu\nwh\nsncbxcoks\nzkvatxdk\nlyjyhfix\nswnkkufnux\nzrzbmn\ngqooketly\nnkoaugzqrc\ndi\nteiojwa\nyzp\nscmpsajlfv\nubfaaov\nzylntrkdcp\nsrtesjwhd\nzcobzcn\nwl\ni\ntvdw\nxhrcbldv\nylwgbus\nmb\nrxtlhcs\npxo\ngm\nnke\nfdx\nt\ngbgxpey\nn\netcukepzsh\nlju\nggekj\nqzje\npevqgxie\njsrd\njazujl\nchhb\nqm\nimw\nobiwybxd\nu\nfsksrsrt\nkmqdcyz\nee\nhmsrq\nozijipf\noneeddpsz\nnavymmta\nbdzqsoem\nvnpppsu\ncbazu\nmhecthlegr\nunkd\nbppweqtgj\np\nrmowz\nqyoxyt\nbbhawdyd\nprjbxph\nohp\nwqy\nrhq\nhnbn\nuvqnqqlr\njpxiog\nliexdz\nzosrk\nusvojb\nzmwzpo\nkjilefraa\n",
"100\nhqghumeaylnlfdxfircvscxggbwkfnqduxwfnfozvs\nuctefnayepxgbgotoxdfuekngmghoxpmschltxrobmbsubgwlygvdlbcrhxvwdvtjiqlwfnczboczidhwjsetrswpcdkrtnlyzlvoaafbugvfljaspmcsvpzyyawjoietuiddcrqzguaoknhyltekooqgmnmbzrzxxunfukknwsjxifhyjylnkdxtavkzfskocxbcnsmhwxuwoavooljjuxmpqrqnqwheymaypivrvjlpnbpflyeopgyobavpvujeocbzxfeoopdafspygsltxfxcykznerswvsakkminzmffekivepqcyysycwmtsyvrnprxggperpjkt\nepzshkljugggekjdqzjenpevqgxiepjsrdzjazujllchhbfqmkimwzobiwybxduunfsksrsrtekmqdcyzjeeuhmsrqcozijipfioneeddpszrnavymmtatbdzqsoemuvnpppsuacbazuxmhecthlegrpunkdmbppweqtgjopa\nmowzdqyoxytjbbhawdydcprjbxphoohpkwqyuhrqzhnbnfuvqnqqlrzjpxiogvliexdzuzosrkrusvojbrzmwzpowkjilefraamdigpnpuuhgxpqnjwjmwaxxmnsnhhlqqrzudltfzotcjtnzxuglsdsmzcnockvfajfrmxothowkbjzwucwljfrimpmyhchzriwkbarxbgfcbceyhjugixwtbvtrehbbcpxifbxvfbcgkcfqckcotzgkubmjrmbsztsshfroefwsjrxjhguzyupzwweiqurpixiqflduuveoowqcudhnefnjhaimuczfskuiduburiswtbr\ncuykabfcvkdzeztoidukuhjzefczz\nbfkq\npqzikfobucdhthxdjgkjelrlpaxamceroswitdptpcclifkeljytihrcqaybnefxnxvgzedyyhngycdrudmphmeckotrwospofghfozqvlqfxwwkmfxdyygmdcaszsgovsodkjghcwmbmxrmhuyfyqgajqkcklznayxqkqoyzwmyubzazcpkhktkyd\nivcuypurfmbisgekyrgzvxdhpoamvafyrarxsvkhtqdihersigbhzjzujxmmyspnaraewkegjccvhhrjvbjtsqdjootgpknfpfycgfieowqrwwwpzsqmetogepspxnvjiupalyynmkmnuvklhsecdwracgfmzkgipdfodkjmjqwiqpuoqhimvfvuzwyvijgfullkjduhsjafbtlkmfqrmyjfjnhhssqctydteamdcjbprhtnegyiwxgcjwlgrsmeaearwtvjsjbaoiojlwhypnvruihoswkifygtydhacwyhsgewzmtgonzltjhgauhnihreqgjfwkjsmtpjhaefqzaauldrchjccdyrfvvrivuyeegfivdrcygurqdredakubnfguproqylobcwqxkzmausjgmhcmhgdnmphnqkam\nurktrffaclvgrzkkldacllteojomonxrqyjzginrnnzwacxxaedrwudxzrfusewjtboxvynfhkstcena\nmnddxfdmvzcautdcckxaaydzsxttobbgqngvvpjgojoglmkxgbfcpypckqchbddzwrxbzmqrlxvobtwhxginfgfrcclmznmjugwwbsqfcihubsjollmsqsghmcphelsotflbgsfnpcuzsrupchynvzhcpqugriwniqxdfjpwpxfblkpnpeelfjmtkuqpzomwnlmbupmktlptndmpdsydsgvfpenemwborifsuqhceskmkhssmvnonwafxwhgbibabvqopqfoviussqfqwehtxdzujtlntxmrjxxwtlggkytbiolydnilqadojskkvfxahhjmbocljarintdwcldvdxropbyjzwyyojuothwmlvrglfzdzdbtubxuoffvncr\nwsaznmoijoivvgobqpnckwvnhkebmtdhvygkjisuxhatmuudqbhmknhfxaxqxkjlzzqtsjfaeedfuujkolxjoqkdvfepvlhvhrwtfdukxffjpsswyxlijjhevryxozbafpfmowgrgonuatdqlahyggyljddjhmltedzlodsrkeutgtnkntarjkpxinovgzdthunwooxvjjmpsvknhkwjopmmlebksucvzqlyqnwcmbvbhrmlowpjbwyvwtgtoqnmicxapzarknnxtuufarzrosdqwsmtcjghecqudosrtjxyaaykqrxycrxuwjxnpqjnbkcpdmokalxapemvbqlzsvxzkutappwgzpdpyzkzcvbntcvfxsxpjaoxtfhvxxy\ngokrcxaetauqgndmphwzyiayabjrqgeppxyjsttyzuvldvybsuxkbmfzvrtnovidznpghozvafmsnsnqivmvubcwtfsrqtmknepbhowejazhkwcmmtpixxxlzqysxtwwtaidyaxyqleprxibexxyfvsddygthcuyyfwpjsfybglgzmbintattnhodtonpyzwotkgnguphpkxeatowzabsdnvqhkfcmofisfrfqgvpmvorpjfzslzmpjjnehrykxjzubuacclfkcyzobghtuoxrajvprecwgxxpswcgmmvedewdmfnqwcuqdsciliqecihluilgmfcswtwkkxlcbhqkvcswjebkrjlpgfgratzbsguvzifnhyxwjsjavwauxpannamxjdvzuhnaczyhepwzolhuslrkvwpnvgzmiizwudwdfzlktbqdxgyyiudsjvezkmesbjlkyertahnexhuqmjicbmusqd\nlasolwjxptxxeumzfwyucpabqseffunqpkfnnbecbbcjpdyjlibitllplxelrdkexdtquvptteyhtlqlbbbvoqozkynayyrbaqmyjhzxndsiyfsexwbioewqvqrtcdlpqmvjifvgymkgotzjmnzqtmrpndevnmthjitss\naqnjrdoyjwpyatmleyqsvkpamsvbmvxrllivfedkjigavyxjveqvrbacuigaipyhbbxipbzncwhrblirizxoqptqqweaafjeqiozpyfauuqmvhxkmnxmsyamptlzanotlslwuhtfqjrrwbwhmqhzkhdkcrfvbeiyipvfvpzhyujabtqwwtbkdogkemhibyxrnxsxrzletbqexkrqoiernaplqyjpqoubvjsebalwnksvloidzfpirwycztwzzvewxotakudkpedupkczlhwuskdnevdcplbklpjmpfdcyqtrcvvvtrffvpekkqmcupryjauteuvczvicthrxsxclprgdlwxfaigayrueicufdiamhtkbxotdirxxgvzqmeyrovfichqnivfjzauqfdftgmopsrgpugxtuhlcvspihazrssfszwxbqm\nrwmxcdbhumrgjqmvnkyrtnsjvwzxssqxnjomuyjnjuwrsyxwqyyxcszpoklwjdrltbsciedpiwlaqigesjsqhsjlrglmwanrxrfnwakztgjhxaunfqjvxiohnjq\nzjttwywkmhaaciixusjivgiissvbhwmqfccbftqsjnzetxnksxttdlhdnmqxwxjdazwaxrkytvocuxnsciklaamkcsmtaqhaviupcqysmkwunrlkglkfituhgzwxnoteotwqntimtopothtxzbqjpuigaghysmomqxazrppogmghyoyslhwchblyibtmlgxarlypdgxxmwywnfzhbzfsmeijdlbfzkteqrqoirzgmhizrslqhpxxzdcjvorgiwlvrqpawzecgszsiejpesbkcusluxgwksrpczywkuxlmdghyrmocdsvefmqyhajoqmwrsyouorhkfwgklpestbcfzripcswnulmqgvryizbsxzsbpwdythqovsjrjhuhkzyayyhafusxxacvjmxtrchrqsbbagmhulzoeywwgjfeoyshtusjbhzpwekxwkgjvtzkjqpoyuybxompdjljoizithvsejhfegwvodmyhsj\npkwlbmjahtputiebpbbmuegyrhlthxwgjprwvhshzyavqyecztozoabnanhrrbddndodxeuiozioiuozxqtihwauroqrdqwcvlxzipodiispqnzomcwvaptgrgdfnyytkwwqqtmiuuyvgaihfs\nccxhuuyyhtgdglfciebdutoeunfhdaxphbsywztpwjngjncpxrjvbvccefkbemgsdymzmmkwdehfkruqbyvecmpesromdxllubryyeshqlzmrewqnkqitxgiigquskwtcznlterxbltzydyzvahnkixjwzztdjpqsuowkvfccockvrjbfrjpcgdjdrwdnposrjgd\nqrvqtvppazhltjqvcclpeztsjpynzfrotqpoxmwhhwewnvcbvdkuzififrtwqqeojueqbnskwzeewzkaojursqgsczvhhujzumigofhwbkkfluwzkctkagxksmfauwinsjlsojtrxhwmhlvbypecjeiwwstneuiqubpgugwgnmikdwickdilsnpdqsvmterdfblhwbafbgarcsfijylbiimofgxeirpb\nywqzapkkcafcomvntmdhzxlefppyebeoeqznbhycwmfyaqqiannyhqouizveavgzjwoblsgwnkvjlnivqcwvzxtcthynmuxqkwwmtfisgglgcoxpipytdbamrykbokmwgsddpqkrzyjchztmiepagwhroqkhwudbcihpqwaqzxugkvakvlavkswfzsdbvqidhtbcdeytmpphkuhsxorpufwhjrutksslhlrxlydxvkosaggmpbgzvbafazjohqsswtorckqaxsrehnrlyjiwtmhglkozfkmmxtyvoxhfkxop\nybjzoxhzubdntoamzottcjtuegmpqkcdbbgckjqtebichznpprqiswbdhoyncsaetlgbfviocfwxwdrnlffbfhvyxzukjwocyhzqjzdhtbrrrllktchfnctpirnawonydwwvuabuqcimcnlhqodemakmunmaxiomkeywcofqbkdmzoizgqipzayixrydwsovhztkgzskwptkqcexrnnxskywndqizlzklnissamqazhlndnviltkoiafmeicgguzxhrdjzzheruswavnvslonoasrudrnldkldkfztagienatjzwxclkkulncaqptoneqlnbtoddbmivazxzmcojdhiswkaxiagtutafrsvpphuraaaixztwdyruumqadjepvvcvoidwmtpbnmquiopiwpuwczdapdzghavviyirojnolsowrmvvjiqswricmzsxavdqamnfhwfgeohskkefutxxibhpulnlwxqwwzdgdjgeqw\npbhlpudoemnntpouahgxjhzjbeplttriabwucrjmbvbozvmxobatkhqsqchlh\nbofuikwafkcowuuntfhpkdeyhokquwqvwtthhhugjzmfeuinipbncizockaadalljreqtkhudblprzlsrwxoccslutwqzsqtijvcwnpflrlukdiaohqjhraglgriykldkdfrdrxjstcwrsxgywfnhcbkpmesupmtrvipfbktbwzfahoe\nnhxbrhhfobgywcvhktdoxqtekiwwurzblmldlfibdvemunnlxubykvvrgktrerptisizxhrevnxquezxkugroohrhudidgvhtjhyezky\npfxwgprpseaccxkwvixvfhqfawkfdjpyeevdggatfiekixeyrfcpxscjkcfgqmyhjmjtimdspizhwzizcyuceglmmbgygfvtqvzqatxlgibyzzkiajxmbhmkqlwhqnghlvlzgppxooeoqxppbpmblxnkeofmniumjcafcuyvdcueterqpjjwaknkxtlzqfljnwkxgkfylnukbiysplkhjucfuwohzvphjbjyovdlnbfrkvbemwytfjynqmgzagbkwekkouxdcynkhtosfytlucentoilfuldvrxlonvkxzecxepkmzzgxluahmjyecsldjesdcpjikvpaudvkxgllisaambovjkdqrkdorjfnyghhhptzifawftzqgemnhpqyictmoyfpcvkcaodakjacqauzyowdzsfqhkplfbyzmnimdlxmjydaxyjnecxsj\nbhiqnvocdenqmwilxxzoqfotpikpqudmomikppzhdhfqsgbxiisyzwnhxyfvydfmpdwomciudcnyndgcnfjitp\nmymxiisnebpywsgqsxdjplwzfmjoopyyifvkmwwpgpljeawpvapihoxuuffbrwhpevcoqrgrqwzhibnorkhzmlbzfhxunrklibvpszznopfgaxzgfltlsxbtumilocltgcozgtziufuzimxeekwnysbicrfxdiogcseozpscrhjotyczcwmbaaolsvubpylonmwajgxzgyzaovenfvocikqjtxgvenksppwwplhxtgybvmajeyfaxegseijikcmduclaaioissisiyppnzdubptsaveszsippqmotjhkudnvqzbkatnefulgexktrmhddapswptfvovujiuwbmibructtmrvznjrchjwzwmozecrznjkfrvkrmrdwroaocqpktlmwxwtnuamqelrwbgbijilnhiiulltovbeflwlpbhyffhbavhfuahl\nndjdfpekxglixlaxxtolhglvwxkyvulcyjeflloqzhltmgtujdcuugnrotlotcpbnyfhejegcmfptqmveghmfbmvklsqfubvxctepvmljohzxxoolnvlayguokqdauptyvjafzzkqtaxjlrbrukkkigjmxqrbazlpdevpezpbwshvpckldqgivlqpirqvwqquyxpixqireuqamffsvvntguxesidrnwwtqkdozfpkduulifzdpohcgubkurehrqbbxajefbfhkzbpkapbszyspdaaoxraojotjufsturtjhudpetsgrzuigusnwlyrvfnkkmsdbuhvhfqtdvtnlewfquuht\ninkebbvzhtqbkdbmvhbsnjbtvjtqnbchiwfuqlzsmxvfjtvquitivyhzpxcdjwikfatcanchxssjluhlyoebcgnsqfzxxwgliuejobcfpvnyrrpkegeqpvlhxeeocmerjmziudtsqqozvejnrtibvnjepfqdsmvstmmwwwqkn\nrmqmjccpaowazfeurgpbfryedqjrltmymhysoicwuohferebeacazuvjoxyipmsgufjiwlcfywxteyyqdhxwjhiudghyxyoxbsceftdr\nelxfvcfbbjjyfsvkvsapdshakgdvhcfmceztgjcmhxlhasqkauqlnfhggtagrnffmnpinwlexrqxisbfnhjzqvoxkukylzcrupmibacpjzsnaclmnuqnbdifzlujqvnfjxxvkczfkzzjqnaqpohygjsjtakzrsosyqhquhkjcjyugtedogfurkxiyqufotiajmwhyilthmoevlwlrxpwpzhsvbfzvtvhwycfznmaomafsyvyrqpizteuoxgthfxsmxjrwpsursgwthhilgdhzfzaxadtklhyhqzfdimsrueecxkqkrudlmzgdtnhmivnnkclgarygydqdhltrsthidzyqazfnovktqcotchcolineiytymrjscyoeivdyhphljzhezohmiurcpblvwaajiqugtaoqmemjlhgo\nprurtymkktdbnoxwttgeeqimlhcztctyphmeqdsuyvkkjoplmzdcakpjvozimhxxqhduiqedlngwgoooupnedksdgpmhhdaqbsqrfpdrsykhbutsnuwjppgdeebjgsdyfoecqqnlemkimipecehlbtmbwnkdxymeclsshvkmywjxeshoihmlgvxiljvwllfpnjzywcpamevwtygfphifubttnwnphdbytwodclrjprseqwrdwsvyncgfrazzaodggxwwbtjqujrmcdpomjryledhufhwkhzktnkytgjpmmgvxjcnjgzuhwqqsldzcsfojswrqcnbqyxaagibpvtxdonpeashnrohuvogldxhsprngsoqdjfqtexyrwizzoeowaqezdlmwafcozvqci\nwgkekfgrcyvzsahpszobrixwxkpiclqljtkvnbimpdkyebcwlfkffrlzzmkvmhnlcivwhwztzrbxjcrtuvtxfkidxhoafyesyvizvozsqorqmqlesixrnerzoowrvwpmibhhyffuvkoukdwjcvxqglschjagquehpnhkycpmjtgludhrbefjjfytkxlbnvmdwsyxhgsczhyjgdfgnwfpdtlkhpekhjncylcqmssyghwdvaeqjkzmhiydlxdjohnscghbtuswzumsqoykiidfwfxyaaaymoivfhjlrwyaxawgeurbrnberazsxtkaquehjfcewctbfjtpqdljhehjobmarguqwsokldzscsfacxfzxfjqoverscjzbkmzdndosiyhtyavoxhtapyektuatprwskxzcznfdiuehuwymtxdrnklsmduskvutkfiubzyblwmparmjdspxywxerftzlkorie\nsupcpxcjwkuveerenlaitvycicyzalwuiuzteyctmuifefygaiaioiiedbywrgrtdxvdkocsaehfcilqjoevajnjttknrsprtkrlkjapymuzrphzlcepaytfaveopszrnkvnehrjstzflvyahorktkmgycouiertlpbjcsxqlgyglmvlyqxixipvwoqlnkaeqmarvxumkrnjcokvfktqjdcugbidvbxrnsaqwxtbftqsnpavytodpjdpvyqxksuvzwztjrwovttlnkznqdqiauapwkczxrxopeneuxflgbdwjmhjguzpeuddfeimozyfrqmfozissccrifwqbhxyehktusdgzxlaeykexqgqoevjtframuqgbdnrsmbxrvbtfglowffctujtzq\nzggtlbhropkwkbbwvnakwvvdycxczozqiworvpwkoqmqhcalyzvqnkcxekjqzvueswqknzpyvysdkhsoicmhczohefnaslxwxllxlewtzuwbsuvseneiqwhnezojkxhoryesugdhtjckqjdfgnrdoizpyfmdlqlwqiodcwfygkivbujfinzyhcejcjojonhgustqjfnecolocmfhpzxtgfpmuscrldurennlqkwhhyipqzevbyktbvtpwvttgecajylqvuizfsoayxziljzegblcatmvefqrzxwktndpbbzdrwlphlgdywdofnzxqlxvkhdjyalhvvpaangodnlxhlsxshhtifxickobixbbduzvngqiaggcxfgrjmarwupaybnqgudbewkgwgtocblxjeccgqhbczibhqufqqxvllvmtzhfmbezplhqakbmmvafqyxjyexdsswbjiouymhlzcltjud\nbfuoiwubgeidpmvkhozhkducomlgltlveinncaiknsugjqccasdxdazcrtvllkfvtezazzcsctlegenlltvkzdqowgoljpdsyqncsdjsdcxxyrghrwpqinxmridxpdpqunvkwxrykxtlxyppfmajfhqyudwtigbjtmqmdltcqzgcaiwswfyry\ncwwiaruhiibujopgrqnpiugkdqtesojacqhnwdagnvxesfrfiefaabradqeelkpkecvpsdwelpdjmmbpdupzvtvjxydkdncugghonucwegvfjzbdwkbevkgdwubtjvtoqothggtdrdolgjmfubzzpnhjaqwotzqblhmrfzfgykzmucwwpdyjvctvfamcgltmjtmrcjivhsytnwmqqjvmohfyesqxdvrjgfvgymhlwdxlozmcqmvhtcexameykvixdaqvssdwwoedklqenafbcfnhwrhdkjcsxohdvrbnlblseendubkxaortejlrcmcvovrsqrcopnnpkunkkcpoenvpkvygunpaboujvirelehlgectnazvqpsouubcpyfikgqtufvqqevcpcjpmj\npuacsiasptskqyhitauzfablpqlkukahmlivzaprotlqdiuoeeykiqzahfavzzrfrzzemi\nzvobxuojorawurhjoppnnctehrulpgkozuywmobcdlbofbjejazsrulvqtammemhqpyiowmnlqaefzsiotpxjwocjeumcjdqszrrrugimnjbjalqlrcezjfxchwddxonzmnjvlrjxrxwkduooercteeqdvdlrwamnky\njsxpfdlzehbgkvypxfsmqhib\ngjtgrkpferayxdznpgksdfpdjobicqfqmfstqhpfmcpmfdcdccmodlqjqgwjofnuqnpmhdvkze\nnligkjfswcxwcujwhepdbsgtffkbykeuhnfzngkpmvqthejjrbzhrcggoewvrxbwyszblqgpwjpltjfrqcocqxyluttlwhtzasnqeoyjbxkiqmajagfhzzfb\nvfuyurlvurnwramcadunwugtueshxmgzvsrmcifbvrasucuvivowlzivliiczpusswafkenwemocimlmslebfiiargfmuabizmyqpthdmzeiegqcjtsjhqkmvwzedalkjdvmzgrxokchgoalguqcnqyrokqmjszjwsdgcofglcqgdndbypqqidclzxsqbjwiploxderklgbxgognwyunrnumfolbalezroknkjnwrwebgelzbgiqdscwtsbxxzkghskgexlevgxnydqvtyjsllqkehtliauyiccqdmfiejrqnrnazcrfhpbjmrfbyqmhdabalhtigpqmwfonteprchddweqdohspjdgvlzmjbmweoilejrpksbxeestgpsmnmalpuswibubaqvotcaytbtuzdtwsysjrvrwgixzhxwhiuhvqtkjpqzyyhhtxmjfmqlfwzjfqvbenlerlkyawolvbtyzgewxc\nhswmwghbbancuejvmwgsffvowdlryinxfiwfhtldytygqkxrwdvrkcoytxkcweagydmhrpyquimwrbvezzvvjpgihcyfqzvadtdfyemfqvynbdlrqhvapgysggxdorkvmvqexpjfgvpifyidttggsdyjbvolbmcgbrrvkuptanlzosctfnyszklrnzrkuxyjpwwminhplxgxwulgxhlmsbzrquajuaxpdpsmwiwxxdvipouxtlkqwwowrqeatqbmmilpoxb\npwweghtfiqjqkbnjhxdkunebqgrizkekgerqqlyyfesoykmvayqbnkstmdefrmtwkylnonchigmtfbourzhmfffsrcbdzdfbeostfvskrebtljhzkrghtsgbbdhlsicutfmmjoutfvexdczschytbcrkliwcxkgoqvufyogvfrnymopfwpnfuzeihxyxansprggwdyafawqgqbtdgffcegtpcybqvrqusqsydymvpeibgxffnopfymrmqhucgomdiuxemxbzyslvlitwubnspbmewwhgpmprkcyfdxkmtuhevoixrwlmxwgcnoyzmmyovrtepqtibdvthmpoaqyddqrxnvkiyadvloyemcycfcpyuwkzebcjaedsbvqqijqlgjycjpkpxflceoniyvqvurdiaqmsrtfgwtpepunugeajdgzsjewsqrmjzssbxjvotjvjqcfqptbzgketqkittrhyubkewfe\nrcihhxjeigutwigdbbdxrbwmbrmbvgaowlvdjyddyctcockmgzvarpfobgmhpaojoiqpqtxtucrorysmgtxcfzlbjbipfimunezpqaqjasixvwoqyjvxkhcqpqiab\nbqqdofehhjtzyqktdmkapspbmykoylpnzoipzwdmkrbhdnt\nkvpdelorqcjkqzzpinoqluibjgnqqlfewioamgmrcemoaxvufyqypchhgfmizrcklyhbpjjzrrugofluioivovxmrawzswpfncnfytmcfvwnrmfzgpzpoltvnbmvwthjsvhbxsewqyckwexzpmiexgrjxjmdwbqyuipxarrbphnzwkbclgbvocyuzutzypirocyyucclqzcxtawhxkha\npukjrmgsxockdraauacxkpmrflspdlqkew\nqjftfwahgqohkqnkttiqfyrhdsgeueivkrnez\nmcirzfqxozfcuhcnscqkcjb\nhvrspzotkdbidwwygowwqhnzfjqhfgimwjgrjvqspooslaqkxzehzegkwutiypzvvztdurgodxvaahguigpsglhabnqbwtqmbdsmbfzthyumquowldnovucoimmqszmsrzqpmaddcvhinjjdfywrwsdagmvyqhtqwfyiaistvhbzvroovjftegskjrjynglsshitxzgfwawlyzgkxyspekdarmeqdkxjflkjwnwwfzinwtxscjbpawnhbskilhsdudslmcrfipqqbpbfgcqyxejhgahxwjmsk\naplcjjltqtrozamuinystpklzlivfhvsjtkzmnkabbaleiztjpzhztqhvnsjbjulu\njtyynqgpysvalzdfedgaufchgkgxapvwbnuhymeahscsnsiimbmtjstpvrjufsikdvwyrizublbbgwadbfzrwmohscfwygavzjaoxrdilpomoisjjswfdyynvlqrmhjcszfrzpsfcctayvficqbebazkleewjynezrxdmfqywohwhrgvtzcdvsfdvhpvsnlcwnndaefgenzglnxhomksignqhqgxatpxwldsxufannebavspetvuczjmutkxzybniehuesblhlpxnpoymjeebhdjhtjqfjkhawwtkguwtzefpxpbdrxfutvbuufjvgzpdfscrzswpqdbdzvnjdakgvqxhgkasgyrkpczgbhhevookfpdeqkohktevfnorjbezawpyzaudwuxqldjwjriqaqsjrqjgoa\niusxharyevoznqgqbteqmppciidgzfvgqvzeemwwazstqocwvntdnaqybcfrmnzrslrdexupsxuhacpttdyfaqwcgpwvnkrvkcofdgbbgpdoxjuuyyckitfdrclzmshghtlfspjhcgfasdvwjgplbqzjbbllfhnhecbjsntzzioxauwzkjzhzdfwdsvwyxghqilwncnkijcapbyquxvejecizvviztcbdoqjhveigvekkfkzncnkyvoguwpiiktajdjntsgiecrpwinbumvktizkxnrsdkqbvapludlbegdrhptkwpigfrcdmgzjeibterrwdlceczotviwlpfibyanraahoawomxzorzgvktiazlzynkmwbcrujpdzqsgqlaomtkvbhgfseiexvjvwwkasymwiammkempnjqcaelfyyvpymrgujzatfsnhtniwlwsdfwyijfzshtepejvtznhvpfhaticqjesfyhnid\nhvmuggazmnupbpkmszdbnofajljbroertesefxnippewoxvkzdnrluzlwfhlmwumclzystoxjrsoqfwluehqfrncfkpysqlhlanroccwzlikumoyyokhaokilpeemnqygsfjnyuctkfzbltinmzbkjylqwjiamfkofjjjjrjuuurrychyivifyaxlhwabbswjdysejwswzslxvyilclpgqlakdknfaoyzqrqivmedburfwkbkrdxwpwefaucltzwsxzimwdlhfecvifljzusprolqknjxfmzmhbzfpqicsbrlprbirdvslyhrsehxzuenmsdpakeearmhlffbpnshtjsbiavexuurspattalnfbqzronmfdwgpbepeuhgbjbvnaxrh\nvuwptsbzakokkpatutbdjevvjjoqrbmaqvjqkqwhapahwextjgxwtcklkdaoxfqkaycroesdtdlzthujqupnrrkaklcxgdcgtfoxkpjmrcixnsdoljzxhppxllzwwsmztolxglqtlmcjvrqlohvzxwaipjwivmnvqjbzkqfjjhwecxfcoeskfkadchwqsqtxmuncwiregvulrwlzwhifhdnqubwbwtcyxwujmjqhbjmjyfvtbmvwhqzjqrfbfdxd\ngmfkwmlplkprltgxgibtafvdirjmsszgabdvxilmgqaqlxfimfdzxxaywmvykpwxlzionemyrd\nvowpgwmooqrlntgrrtzhzlolmcgvruncmawflyqrtbbohdymiggavytlbrrbblygyehe\nihvfewlicdpqromvutbxujqyyokcjgbecatmjdvmajkpvunlgcbnwwvmlqtzzrbuoiwqqypfiiyzurocacwepxejxxfvjeglkctgavrygkjnhzqnxnttihvniogbjmvivggjzqxvdkgqyygmjuxmvgrrpsmnruiclcipomcsijvjvdfevwrhjmrcsurucsdskgxbotwuxhbxvsvandsewrnfwnszwgdugnuqfbkooqpowb\nufjlhobdwxadysonqdgbnpzlerqooveibtuakbmuzaqviouhhdenowzyxezbqzqpgnhobduwbzbdftzrainjruucocigrajyfaazgaigrnbcqjcwyveflclgteosbnbfvutghcjekknlsctwpopabjpliwzkbndgpzbbxomkcjdzlquodwmuwtidgdphkvexbsztrintjappsxgtykuqatmjcrvbsamzlvztawfovjkfeoxkykdaobdcdszgcovkqsnhgcgbaiosrkherchtqdnlywpyviqrfrgemkogqvqehdrcvrkmapqvdburjahmttyqqqaygtwrxunnugtkyfgvsmskscinmqjlgccfnfkgphxbab\nglouyqprlrnqwtoteigeokdfwfqcbylqkbyxvofglfmjxbmthzbooxobhxrbnb\nwhgehlcdimxufhcgeqfvdmjyjnoaqtcyrbzzcyrjbusmddvcmjoekrlzvngdhsftczzzlhojlcektmecjjtanfdjjbazsvopqheouddjethwmgwmvgpxutvccepmnoqsgylgjndlbhajwgvohtwrvfymybqnxzgsfrrjdexwkksbdnmetglmnkluvnxdblzdkysmyzvlvnxkiycztmivaacevfuabuxwymxiwtawlckmpathuaorsgapjklmfbizmvbxyuvgmgcbutuczjugofgwkleouxcatyewursbvobdgiqqimilvpwty\nnbsdbzxdmbpvbdqxqkrfqndqzsbxrcbwfbrwdqerimxfbwpanfhdwhpqafipcfhvthcrqrxrpfkctijgdkpqskwwoiripgxyorhticwgsotniggivzaljkqlxosqzmynmhemhwppvnwnwwhuzcqx\nkhgfdjgbpoohrmtaxrykrzqxfctchjpxcqwnwcfznzrgdkkoleejqdfpgfwvacgtxyqqiqqydfdcvofmafzdntosdjkidroloivodqisbzimryrkecdqzlyemsssqmivpbywesonnvultkjjzthqilbntcvczvjkuetxcknhxrfzqsxpppsewxwnueqovzyhqfjxqmzvkwmogpfocenywxgeacxrw\npiiqkxrpvrcfsnusuwecjjlcxpmqflauccefeehuqtjqwzphiwosewptcdqtmfxobkhxgkzhtiqtxgiosgeeqdbczpddbattyuvidxjodxvippweskzawjzfjhhfscdromehncpbpmivezzhklqxaplwumkpmycknbuzggfkoqrezgctqiqofqfqtssfwuqbysrtfwpoyqediumvefmnsgxczrduunaqxkfxinhsouikqwhzbukaupzujroolaulkabporpsdtypavkhvwnvemhmczbadvopemtlpshwwuyqhqvaxxeqwuouoxvyppkqacgbplsnpxjgsqkdppxzzyorylrspvyoenvpxnuhkczyfdummmzyrmytkyxfodmssqgfwmuqdswilnjnirudogvsalzlrvoqldtdyjthyuiskvcytzywlwbzpgvunxnvpjantjjawjbxpuhbqwuxd\nkfsuvrtgjtpphcswiilcjtmafrrourowzsysgcrwtswnnbntrfmbnwgscjxxfpmtboyuprarcjp\ncdplftiqrzmnuvesxxksegksefxmuopwrkve\nzeycqwxllnnbfnonushmvdmplykyisjhhvszhjpfswwbolzummwrhylyjlbuwxywxyqsjbc\nqnsbujwverqnvizakozdkscfykpvylkufcejdbnijjycjnppsavnseaeyrqqnbucwxglpxxruuqetpxoebjnrzodfafpcsxaxluopbzetsucqzzffskdokroszvjztrqgtlzapbvospelnnqxargfxvuqjoyrveuqnnameexbaebcisvmmhzttldfuroujregceyragqqbrsdanmnhigbxyglmfvgl\nolymflmknanrzpzuvejiewsbekbuzewnoszajzxxnevpuikxfvftcypgzyifwjenzsbdoybvqaurpweusehrpm\nzbxbrqoaaxwklouwfmszmgerszchaoeebcvyatgajtntrujkuixzvwrtzlnqpzaghsbjwzcfgasmuohhohsdyuyzpylvprnfeqmtltfaegziehowkjscuevznwrcnuhkmqlfybghl\nwmeihvphbaozasehczxmiemcaqpoilyodkmntfzpnyefbpupsfanjahrjpshxupmtefoymgpguoukjvdpuihijdttcouhptxjqsxoorduujidxymedewdmmadbrrmyzufwbecgfvlxetwaxidibgvhrguzmdfmpvtpbdohvlzmiovriwkbhbybvebyerlkqqbasqgxnvfhbxyetaerlhhfhetdlvcdzfkpfkhwgrkibxgwlohblnqcvovtgiyytklphnphbwyostmwhsjrqprxntmlqylkmnjgcrbioyhdobnxpwdbpbhlnnpegb\noiivalofwwtgajhrgpfdgqburvyykujnugjafdutwplpefbrkrzeeutlfbcvc\nwwdztvhzzaxwuyaqbrszrcyawwsxhgejmmunolbvbicioeheoxmiwvpilvovgslwopg\nvtvvpdudlfmumsdngistgjojubpmgymwjlcobgwxwtchyobsjnchogoarhvxtatcjfpngsenbvdayhdbdecjjitpilypiuuewrgobyxjklulffpdcipypmcrjkgireznuqrqcibnbkegxhallbbeempawcxuqglfkxwyxualayyiucjvgvvkysxgbnmngyjvvwtabktybjrkxmcwafullluoycnhofisjnnnxwnuukkhgvwllyjpvhmnzdheyspkjsfidtkoxzecwnvdiupsfzkixevkjgvrbqvjqzyh\nguhjjguxhzyplwiirestldulakyqquqgqccslrcgsqhvdehnjljkwomipksjeqxfwhilzboyforvespphluejhkgotyzudunghuuelfxmgezqdngrtnpkggiwpzyoklmaekfxpqqxmyntpiotqcvgysuyouseysaqnrywnttrydluzyfhukihcyhdzjjdyvtoxlateobsbrymvtnguiwrjmhuyshkrcxjabnlkdikayvrkaljfkwowycneovtchrkvgeewqieboshtvfekxqhsqcueohwpudvukjavfepisiifkknaknhuifjuuzsfcfmasbbsmthyhloxnwueeosiuupszlxkyfrllomgvpsnevmidmrpbhepwgdmezxcdptwokiioxhopmtrbqbpdiqhohvetjedbjpahgztezsbcvlgnefhpwiwuinnfvplgxtuqwpmyqxcaciic\nprelazhpxaxuhtnlxbylunbgjaggzyrfxdtubzqcqvhsikbrvvulnnlpyqkxuverkqalnyvzzfvzyfyuazwrioqvqwlytewacbadomhgnkqglaviujfvzmjrcuivduhqtezgbazrfwfheitdnruzvllhynrmogezevkmcwpngfjsacijichtxrprxznxiosbrbwdjdoknxftxzlmmvvntdzqfpviyrxgncvodqmxfvhzvizopv\nwxetiukpszrswajghzogrnntiggchnjhasntxprodmsenwopfrevcfwmzzwnczfkeyqjtwnrpsfnwepphzlzexpzakcrfjzayvipibpazivnrqorxekvoxieyvlgaziabpmvynehjfkdgclnyyvmtahgolomirqjjzjhzikppsyurtdinrlqvtlcmwmsfg\npgminkiwhnqodmlbnzpcgvunqmrydtlzdviacdsnminqpbcpebxugblhdfsjwurjtangfufuoebheeteuddizxytmzdykljyqgdednhiavqbqdfqwepncxcyzhponwerxlrpsomafcjykbkpwuxrpraiovcwtmvgtgcmgrkhrpfdhuqggflonbtgokdmhpziynvcikdvvuotxjrahjyjvrmzooqdagjcsexmpjtlvfmuxjjxcknixfeipbnysedyhhhrycqxeyxkoyxagwnilygiyjhisedolmiebwapqvscuiktgvyzhmbphpcolpkkuczvejlgembmiaqeitgdhqy\nyjonfhswfpnvtfzbvcalbcvasbikjtnnaciwpvfphqocgijfxdoatzyjzjeyfoyeudxzdpm\nfhkknqez\ntiorttfskwifwpwaafxmmqjhfmimakbssuondsadnftndfstbwdfwtbbaulffdbncumajcvpxvpocbvsuyegomjw\nocavmfyhhvnngozvjldkjchtzxqmqohynqaftunhjfklbkxnjjtnpdplwhgtujrcffovyffkmzcdobkmhxuqvubpyjmniexrwvtrevhhwnxswkbduuflaolttugfhrjtdopvzdzceeksiiwsqzimllwgttaphnrvntgnrjqmvlwobuvghcwsrgcuikqkeewfwgldppvytnevabzlqsevruablogglphjmprvrqoomzilxzzrkpomqarjsoevutqgliryaawguvogcdogjfvrlvhqhrmbftgvxsxeuoijsqxnfvsnjpxhhpruwyeopyvcjlnehhqgyxqxlwoikczgbzzcznkfwnwggybzmcfbsrckyobyevssdvmqllmeizqfqhxjxmibldfpccjymxofnxzpvqgyuahubzrcscbwieuiorfkfoyfdcimgzjzmlonupvfovcurtsffozglohnerehweccpto\npsfhffobcvtqriwuwkrktpiwpmshrxsfwrbuvdunvdxvytfokqqkgpkmssvqkumpodgnzgpshthmluwmgbpkrbzctxludvycrpzmapivxewbcipanscegliuuqvbujriyvfdkxdwkpvwnuhtrwvesqrtwlsiffkapackjhcifxcruvszyycugwjfzpapveziwlijvysyilpjiyiyqcqmxcycykwjrohfurkooekibwayegbombbmmznejpnulelofvjaqmioehdywiazcbehqyphwijshdrwrwcdtgzmhmspilmbqtozusgf\nidxtseolrxgdowmryrtqhfonlkzhflaxwolxcvmjj\ncsvlbrfqhddnymuyueowdpeqlaiejnntnmogteqpemeiqfxkgjtoepfovtbmxolapgqwrsnpihlkgoyuxiuwulrhqydptecbsfqdjjpxkihlojkoovimihzjmtxozuxlybgxyupqublbcsncofmnimzcaoimeaxrqecckytskuakgfgxldtisbctkgnth\nzyhrcxouexiuqeuyrcudqhyyzrompymdzubgvqiaegsysjkzlmbrlpyznloslrqhmmjvrwjslmoaqvnotvmvaxdylcbkwhplufnpuezogajukqhharjowrpxlwpoqtobq\npaofdmtxhvbbvxnngdhkksqntbokvducnmenpqkxdlkdpxwwlduvytmamfewfyhnzqmmqubuccxnqxsfsfecfjgcekvflcczwaxsthprcxkxynjdpekjvbojdjldezawsdzvbuibjwqhogacfprvcczihllgrskbadnnxnpqbglcsgdkqjthgeyygoosyzyhtqgvdyeiajqjjfxgxzxxvafzpeiewazlnhjkkccwtfnvbcxfdfzokonebcwlrqhxoqjpabyogpkmtdlvxrvljsupqiuefburedxuzrnsyvqwvwndwjodyxpbrwtvpmxcvdgsnneannqrnqyqisvclpohqodestjfukejgjefscozvnuiexpiisatfnpixojbtsiyaxyyjueyhsglfipipycgwfasxwkqnahsjcohxnvsvfxslpftyqvpdgnvcrmtwrmftodjaqbrfiaavyfmibcodwbt\natjndyuzigdljpjkogmzewlzvvzizetanviuymptictwdupivshvkahcixujsheyavyrsplmksqgblopltfgjizziisdaiqnydmdnplfhbefmrbblqwcwtllkorcopyiltfklzjotyozimgysnbmgkrhxgluyryej\njjovcnhlvmkrbkprjyosspxzapyrmerqrosmtjhbnmnyrfabyfnfncywxzhjnmfmaevmefbabflizedkdzmsdoygkjjdxvtouhhxgtmsilkzfzwdbqrnehhbpqkqexowyrvhlsuqspzggzvjseyikikzoqhzyuzzvdshkgrzvjamjplhzxbuxxwluelaukoatgonwvwlmvpdmjwnnuzspqrpiyqwrttsnmdzndhwgprgozkqwybnajfgrcvtmbygsagxeyedgrxtmpbjbtduesrrfontvollcgnwmoyedhovgnobrgtldcrdeuhcsumykhyyhhbyjbqw\nwenkrxabrfzzrnpuxztavyppukvgdfbwmngmkgazekpvvwgaczvjpdnaxbpzurprcjvsptbkjmcnvasajvpwwtzuysrxawdpwmdzwpalzsypydtxweoxgnlxroqmthqgdexurdawqolnoisgxgfjizqjixivxkflpknhpwqvaukzhjolovdosqekhkttaxntzzitqrdxrjyhdwixbihlfymukhoiqkwqdtfjzlpvyzrfqklpksqrrfpviandfshtsazjrrhehsresfczwazwokcdcibnybnwydhisljsxtvxnzkcpqktytmmcprccltssikmutrtrcgdyltqdssxxasfprorxfuamljmgxsdhlyyjfquiimkvgjtnejkyopocvgufilapzknymvxychpanhlmlkwhutlyyexlfdsffuerusdbnefnztrqpsoexsuexhgryfdpxcwavlxtodownixgwraxqbrlcxhvdttktmgnoujscpv\nwlwagexbhbzkdfnzslyvraqyzkiyiawcmdrlubzmklldfitzuyhgftrmomxuszatfxkpafhzdvxvooevucbwlnztkvzcgkmijoohmzicndfudzgrvofnxjboojiegewbacgbpaloptookenlazjttykwipemfslyoqyrltmvphlzvrwfacnajswrqqjyibdltqvsoivx\nybxbrwwgqaclxcxgttqzsrxttatfwbfnmhccfhstxntohvfqvgcevgyefjknqfywmrjuqegwqjaputsjnbzmxyosjteqxwevvtshbqdvvwfidjsmwtbvyazuwrfuakcywewyxjkmdurdyiglaxqxinvzgrrriuqjolwmbwoxqntzqmocqtkmibhpwzabilywkeytdmbdrjpmrvqlbxztvlukamyldzgddiujstqlvuvkzyidsapbxygnxbvmqmgb\neoickybowqxrwwbshemcisgxrjwdrenvqotvqlddpdommatyloejqyxpewdfhqrztxvwvibmnwcimspxaxtzgyqwgydpjkxsbtoefhcajwphfpzhdcmsymgkdwfazvueroafhepdgxreyvmrhlpfeuucumuzxfalmjjhoibqhzgvbjanycwbhwyudskhztzzgqulftvqyujbhazwbbqhdgofwyrxvewjybbrkkskbixngyuiisyqchwpqshlbwhxhgosbzzflvcetxcqthiqbzntbkbobnflhmekcjvdpfittsfvdeyptzqsouxqzuopabmjhmttkkrhsqfvewfqsadrkflmzocegfybaevpyfyzinxbohxxbewvrrcqgfwxqnaedhtcfuxrcwrdjpedjxrvaurypegtijqbwxlobpeyjldakqihaofg\nwoyxlmnarjdnxauysysisdekesobkgoalrlqsrrfdcfuwjfwfllirmetrvjffgkstvjkfjzifydlimlbcikxuqhsdhzkuurcqqukqeudywkqejhrbtmdhnoyqsxevpmzwainltqupqtomolcbwlhobszmwhmclekitsiragugqbqcogfiyfswwxyaggnfegvqygtqkzgevdtsdmzmttjbzwrcwlgomnbpggjhjibputjc\nerrabysbxjsalojjynozklznsibbiswpzhttudsvynieztyhlbdhlpwvlhusuzdyytomlsldyheqctuyreialugdacgklbrwwmeklxvdiqirhpdoazkdzqfwvaxvekxzhtrrjyvwvriirmdjiifchlbufwodmtiqipdfukecyqnegmgbiuyzgotvihfdynmdrrxbbmyrfdzlvootrevtpjvonlxxfavgxbpaenmmutsnutdanazrrkxvdybdjnylebererqrmkawxrrepwmzhdcaqcniizkjlmpqgzuxnqxzflphnzktgnauabjutgvrzrbhfpkoslpnpiameodatjtuifjuilcfgaboqicm\nkiyfuutgg\nmcfjxqevwcirnnzdzmzqejvyaivysiothwipfjegeeckpsrcpciwkvthbwgexhunrmpnckpkjtgjugwhwngwvrbwaqsotnwyprytgosdfawssvgoionddtebsikihelhwgqsnwodezxbvgbwhjkfuwqqrbzwxfmiianwupmelfewyaapmdiy\njpxfszrlyphhqaheeuoduvjsssjtdxeqfiikecjtydotairyqwzqvchfxvvi\n",
"100\nhqghumeaylnlfdxfircvscxggbwkfnqduxwfnfozvs\ntkjprepggxrpnrvystmwcysyycqpevikeffmznimkkasvwsrenzkycxfxtlsgypsfadpooefxzbcoejuvpvaboygpoeylfpbnpljvrvipyamyehwqnqrqpmxujjloovaowuxwhmsncbxcoksfzkvatxdknlyjyhfixjswnkkufnuxxzrzbmnmgqooketlyhnkoaugzqrcddiuteiojwayyzpvscmpsajlfvgubfaaovlzylntrkdcpwsrtesjwhdizcobzcnfwlqijtvdwvxhrcbldvgylwgbusbmborxtlhcsmpxohgmgnkeufdxotogbgxpeyanfetcu\nepzshkljugggekjdqzjenpevqgxiepjsrdzjazujllchhbfqmkimwzobiwybxduunfsksrsrtekmqdcyzjeeuhmsrqcozijipfioneeddpszrnavymmtatbdzqsoemuvnpppsuacbazuxmhecthlegrpunkdmbppweqtgjopa\nmowzdqyoxytjbbhawdydcprjbxphoohpkwqyuhrqzhnbnfuvqnqqlrzjpxiogvliexdzuzosrkrusvojbrzmwzpowkjilefraamdigpnpuuhgxpqnjwjmwaxxmnsnhhlqqrzudltfzotcjtnzxuglsdsmzcnockvfajfrmxothowkbjzwucwljfrimpmyhchzriwkbarxbgfcbceyhjugixwtbvtrehbbcpxifbxvfbcgkcfqckcotzgkubmjrmbsztsshfroefwsjrxjhguzyupzwweiqurpixiqflduuveoowqcudhnefnjhaimuczfskuiduburiswtbrecuykabfcvkdzeztoidukuhjzefczzzbfkqdpqzikfobucdhthxdjgkjelrlpaxamceroswitdptpcclifkeljytihrcqaybnefxnxvgzedyyhngycdrudmphmeckotrwospofghfozqvlqfxwwkmfxdyygmdcaszsgovsodkjghcwmbmxrmhuyfyqgajqkcklznayxqkqoyzwmyubzazcpkhktkydzivcuypurfmbisgekyrgzvxdhpoamvafyrarxsvkhtqdihersigbhzjzujxmmyspnaraewkegjccvhhrjvbjtsqdjootgpknfpfycgfieowqrwwwpzsqmetogepspxnvjiupalyynmkmnuvklhsecdwracgfmzkgipdfodkjmjqwiqpuoqhimvfvuzwyvijgfullkjduhsjafbtlkmfqrmyjfjnhhssqctydteamdcjbprhtnegyiwxgcjwlgrsmeaearwtvjsjbaoiojlwhyp\nvruihoswkifygtydhacwyhsgewzmtgonzltjhgauhnihreqgjfwkjsmtpjhaefqzaauldrchjccdyrfvvrivuyeegfivdrcygurqdredakubnfguproqylobcwqxkzmausjgmhcmhgdnmphnqkamhurktrffaclvgrzkkldacllteojomonxrqyjzginrnnzwacxxaedrwudxzrfusewjtboxvynfhkstcenaumnddxfdmvzcautdcckxaaydzsxttobbgqngvvpjgojoglmkxgbfcpypckqchbddzwrxbzmqrlxvobtwhxginfgfrcclmznmjugwwbsqfcihubsjollmsqsghmcphelsotflbgsfnpcuzsrupchynvzhcpqugriwniqxdfjpwpxfblkpnpeelfjmtkuqpzomwnlmbupmktlptndmpdsydsgvfpenemwborifsuqhceskmkhssmvnonwafxwhgbibabvqopqfoviussqfqwehtxdzujtlntxmrjxxwtlggkytbiolydnilqadojskkvfxahhjmbocljarintdwcldvdxropbyjzwyyojuothwmlvrglfzdzdbtubxuoffvncrswsaznmoijoivvgobqpnckwvnhkebmtdhvygkjisuxhatmuudqbhmknhfxaxqxkjlzzqtsjfaeedfuujkolxjoqkdvfepvlhvhrwtfdukxffjpsswyxlijjhevryxozbafpfmowgrgonuatdqlahyggyljddjhmltedzlodsrkeutgtnkntarjkpxinovgzdthunwooxvjjmpsvknhkwjopmmlebksucvzqlyqnwcmbvbhrmlowpjbwyvwtgtoqnmicxapzarknnxtuufarzrosdqwsmtcjghecqudosrtjxyaaykqrxycrxuwjxnpqjnbkcpdmokalxapemvbqlzsvxzkutappwgzpdpyzkzcvbntcvfxsxpjaoxtfhvxxytgokrcxaetauqgndmphwzyiayabjrqgeppxyjsttyzuvldvybsuxkbmfzvrtnovidznpghozvafmsnsnqivmvubcwtfsrqtmknepbhowejazhkwcmmtpixxxlzqysxtwwtaidyaxyqleprxibexxyfvsddygthcuyyfwpjsfybglgzmbintattnhodtonpyzwotkgnguphpkxeatowzabsdnvqhkfcmofisfrfqgvpmvorpjfzslzmpjjnehrykxjzubuacclfkcyzobghtuoxrajvprecwgxxpswcgmmvedewdmfnqwcuqdsciliqecihluilgmfcswtwkkxlcbhqkvcswjebkrjlpgfgratzbsguvzifnhyxwjsjavwauxpannamxjdvzuhnaczyhepwzolhuslrkvwpnvgzmiizwudwdfzlktbqd\ngyyiudsjvezkmesbjlkyertahnexhuqmjicbmusqdklaso\nwjxptxxeumzfwyucpabqseffunqpkfnnbecbbcjpdyjlibitllplxelrdkexdtquvptteyhtlqlbbbvoqozkynayyrbaqmyjhzxndsiyfsexwbioewqvqrtcdlpqmvjifvgymkgotzjmnzqtmrpndevnmthjitsspaqnjrdoyjwpyatmleyqsvkpamsvbmvxrllivfedkjigavyxjveqvrbacuigaipyhbbxipbzncwhrblirizxoqptqqweaafjeqiozpyfauuqmvhxkmnxmsyamptlzanotlslwuhtfqjrrwbwhmqhzkhdkcrfvbeiyipvfvpzhyujabtqwwtbkdogkemhibyxrnxsxrzletbqexkrqoiernaplqyjpqoubvjsebalwnksvloidzfpirwycztwzzvewxotakudkpedupkczlhwuskdnevdcplbklpjmpfdcyqtrcvvvtrffvpekkqmcupryjauteuvczvicthrxsxclprgdlwxfaigayrueicufdiamhtkbxotdirxxgvzqmeyrovfichqnivfjzauqfdftgmopsrgpugxtuhlcvspihazrssfszwxbqmurwmxcdbhumrgjqmvnkyrtnsjvwzxssqxnjomuyjnjuwrsyxwqyyxcszpoklwjdrltbsciedpiwlaqigesjsqhsjlrglmwanrxrfnwakztgjhxaunfqjvxiohnjqrjshymdovwgefhjesvhtiziojljdpmoxbyuyopqjkztvjgkwxkewpzhbjsuthsyoefjgwwyeozluhmgabbsqrhcrtxmjvcaxxsufahyyayzkhuhjrjsvoqhtydwpbszxsbziyrvgqmlunwscpirzfcbtseplkgwfkhrouoysrwmqojahyqmfevsdcomryhgdmlxukwyzcprskwgxulsuckbsepjeiszsgcezwapqrvlwigrovjcdzxxphqlsrzihmgzrioqrqetkzfbldjiemsfzbhzfnwywmxxgdpylraxglmtbiylbhcwhlsyoyhgmgopprzaxqmomsyhgagiupjqbzxthtopotmitnqwtoetonxwzghutifklgklrnuwkmsyqcpuivahqatmsckmaalkicsnxucovtykrxawzadjxwxqmndhldttxsknxteznjsqtfbccfqmwhbvssiigvijsuxiicaahmkwywttjzppkwlbmjahtputiebpbbmuegyrhlthxwgjprwvhshzyavqyecztozoabnanhrrbddndodxeuiozioiuozxqtihwauroqrdqwcvlxzipodiispqnzomcwvaptgrgdfnyytkwwqqtmiuuyvgaihfshccxhuuyyhtgdglfciebdutoeunfhdaxphbsywztpwjngjncpxrjvbvccefkbemgsdymzmmkwdehfkruqbyvecmpesromdxllubryyeshqlzmrewqnkqitxgiigquskwtcznlterxbltzydyzvahnkixjwzztdjpqsuowkvfccockvrjbfrjpcgdjdrwdnpos\njgdrqrvqtvppazhltjqvcclpeztsjpynzfrotqpoxmwhhwewnvcbvdkuzififrtwqqeojueqbnskwzeewzkaojursqgsczvhhujzumigofhwbkkfluwzkctkagxksmfauwinsjlsojtrxhwmhlvbypecjeiwwstneuiqubpgugwgnmikdwickdilsnpdqsvmterdfblhwbafbgarcsfijylbiimofgxeirpbtywqzapkkcafcomvntmdhzxlefppyebeoeqznbhycwmfyaqqiannyhqouizveavgzjwoblsgwnkvjlnivqcwvzxtcthynmuxqkwwmtfisgglgcoxpipytdbamrykbokmwgsddpqkrzyjchztmiepagwhroqkhwudbcihpqwaqzxugkvakvlavkswfzsdbvqidhtbcdeytmpphkuhsxorpufwhjrutksslhlrxlydxvkosaggmpbgzvbafazjohqsswtorckqaxsrehnrlyjiwtmhglkozfkmmxtyvoxhfkxopvybjzoxhzubdntoamzottcjtuegmpqkcdbbgckjqtebichznpprqiswbdhoyncsaetlgbfviocfwxwdrnlffbfhvyxzukjwocyhzqjzdhtbrrrllktchfnctpirnawonydwwvuabuqcimcnlhqodemakmunmaxiomkeywcofqbkdmzoizgqipzayixrydwsovhztkgzskwptkqcexrnnxskywndqizlzklnissamqazhlndnviltkoiafmeicgguzxhrdjzzheruswavnvslonoasrudrnldkldkfztagienatjzwxclkkulncaqptoneqlnbtoddbmivazxzmcojdhiswkaxiagtutafrsvpphuraaaixztwdyruumqadjepvvcvoidwmtpbnmquiopiwpuwczdapdzghavviyirojnolsowrmvvjiqswricmzsxavdqamnfhwfgeohskkefutxxibhpulnlwxqwwzdgdjgeqwapbhlpudoemnntpouahgxjhzjbeplttriabwucrjmbvbozvmxobatkhqsqchlhtbofuikwafkcowuuntfhpkdeyhokquwqvwtthhhugjzmfeuinipbncizockaadalljreqtkhudblprzlsrwxoccslutwqzsqtijvcwnpflrlukdiaohqjhraglgriykldkdfrdrxjstcwrsxgywfnhcbkpmesupmtrvipfbktbwzfahoevnhxbrhhfobgywcvhktdoxqtekiwwurzblmldlfibdvemunnlxubykvvrgktrerptisizxhrevnxquezxkugroohrhudidgvhtjhyezkyhpfxwgprpseaccxkwvixvfhqfawkfdjpyeevdggatfiekixeyrfcpxscjkcfgqmyhjmjtimdspizhwzizcyuceglmmbgygfvtqvzqatxlgibyzzkiajxmbhmkqlwhqnghlvlzgppxooeoqxppbpmblxnkeofmniumjcafcuyvdcueterqpjjwaknkxtlzqfljnwkxgkfylnukbiysplkhjucfuwohzvphjbjyovdlnbfrkvbemwytfjynqmgzagbkwekkouxdcynkhtosfytlucentoilfuldvrxlonvkxzecxepkmzzgxluahmjyecsldjesdcpjikvpaudvkxgllisaambovjkdqrkdorjfnyghhhptzifawftzqgemnhpqyictmoyfpcvkcaodakjacqauzyowdzsfqhkplfbyzmnimdlxmjydaxyjnecxsjjbhiqnvocdenqmwilxxzoqfotpikpqudmomikppzhdhfq\ngbxiisyzwnhxyfvydfmpdwomciudcnyndgcnfjitppmymxiisnebpywsgqsxdjplwzfmjoopyyifvkmwwpgpljeawpvapihoxuuffbrwhpevcoqrgrqwzhibnorkhzmlbzfhxunrklibvpszznopfgaxzgfltlsxbtumilocltgcozgtziufuzimxeekwnysbicrfxdiogcseozpscrhjotyczcwmbaaolsvubpylonmwajgxzgyzaovenfvocikqjtxgvenksppwwplhxtgybvmajeyfaxegseijikcmduclaaioissisiyppnzdubptsaveszsippqmotjhkudnvqzbkatnefulgexktrmhddapswptfvovujiuwbmibructtmrvznjrchjwzwmozecrznjkfrvkrmrdwroaocqpktlmwxwtnuamqelrwbgbijilnhiiulltovbeflwlpbhyffhbavhfuahlindjdfpekxglixlaxxtolhglvwxkyvulcyjeflloqzhltmgtujdcuugnrotlotcpbnyfhejegcmfptqmveghmfbmvklsqfubvxctepvmljohzxxoolnvlayguokqdauptyvjafzzkqtaxjlrbrukkkigjmxqrbazlpdevpezpbwshvpckldqgivlqpirqvwqquyxpixqireuqamffsvvntguxesidrnwwtqkdozfpkduulifzdpohcgubkurehrqbbxajefbfhkzbpkapbszyspdaaoxraojotjufsturtjhudpetsgrzuigusnwlyrvfnkkmsdbuhvhfqtdvtnlewfquuhtainkebbvzhtqbkdbmvhbsnjbtvjtqnbchiwfuqlzsmxvfjtvquitivyhzpxcdjwikfatcanchxssjluhlyoebcgnsqfzxxwgliuejobcfpvnyrrpkegeqpvlhxeeocmerjmziudtsqqozvejnrtibvnjepfqdsmvstmmwwwqknnrmqmjccpaowazfeurgpbfryedqjrltmymhysoicwuohferebeacazuvjoxyipmsgufjiwlcfywxteyyqdhxwjhiudghyxyoxbsceftdrqelxfvcfbbjjyfsvkvsapdshakgdvhcfmceztgjcmhxlhasqkauqlnfhggtagrnffmnpinwlexrqxisbfnhjzqvoxkukylzcrupmibacpjzsnaclmnuqnbdifzlujqvnfjxxvkczfkzzjqnaqpohygjsjtakzrsosyqhquhkjcjyugtedogfurkxiy\nufotiajmwhyilthmoevlwlrxpwpzhsvbfzvtvhwycfznmaomafsyvyrqpizteuoxgthfxsmxjrwpsursgwthhilgdhzfzaxadtklhyhqzfdimsrueecxkqkrudlmzgdtnhmivnnkclgarygydqdhltrsthidzyqazfnovktqcotchcolineiytymrjscyoeivdyhphljzhezo\nmiurcpblvwaajiqugtaoqmemjlhgoxprurtymkktdbnoxwttgeeqimlhcztctyphmeqdsuyvkkjoplmzdcakpjvozimhxxqhduiqedlngwgoooupnedksdgpmhhdaqbsqrfpdrsykhbutsnuwjppgdeebjgsdyfoecqqnlemkimipecehlbtmbwnkdxymeclsshvkmywjxeshoihmlgvxiljvwllfpnjzywcpamevwtygfphifubttnwnphdbytwodclrjprseqwrdwsvyncgfrazzaodggxwwbtjqujrmcdpomjryledhufhwkhzktnkytgjpmmgvxjcnjgzuhwqqsldzcsfojswrqcnbqyxaagibpvtxdonpeashnrohuvogldxhsprngsoqdjfqtexyrwizzoeowaqezdlmwafcozvqciewgkekfgrcyvzsahpszobrixwxkpiclqljtkvnbimpdkyebcwlfkffrlzzmkvmhnlcivwhwztzrbxjcrtuvtxfkidxhoafyesyvizvozsqorqmqlesixrnerzoowrvwpmibhhyffuvkoukdwjcvxqglschjagquehpnhkycpmjtgludhrbefjjfytkxlbnvmdwsyxhgsczhyjgdfgnwfpdtlkhpekhjncylcqmssyghwdvaeqjkzmhiydlxdjohnscghbtuswzumsqoykiidfwfxyaaaymoivfhjlrwyaxawgeurbrnberazsxtkaquehjfcewctbfjtpqdljhehjobmarguqwsokldzscsfacxfzxfjqoverscjzbkmzdndosiyhtyavoxhtapyektuatprwskxzcznfdiuehuwymtxdrnklsmduskvutkfiubzyblwmparmjdspxywxerftzlkoriebsupcpxcjwkuveerenlaitvycicyzalwuiuzteyctmuifefygaiaioiiedbywrgrtdxvdkocsaehfcilqjoevajnjttknrsprtkrlkjapymuzrphzlcepaytfaveopszrnkv\nehrjstzflvyahorktkmgycouiertlpbjcsxqlgyglmvlyqxixipvwoqlnkaeqmarvxumkrnjcokvfktqjdcugbidvbxrnsaqwxtbftqsnpavytodpjdpvyqxksuvzwztjrwovttlnkznqdqiauapwkczxrxopeneuxflgbdwjmhjguzpeuddfeimozyfrqmfozissccrifwqbhxyehktusdgzxlaeykexqgqoevjtframuqgbdnrsmbxrvbtfglowffctujtzqwzggtlbhropkwkbbwvnakwvvdycxczozqiworvpwkoqmqhcalyzvqnkcxekjqzvueswqknzpyvysdkhsoicmhczohefnaslxwxllxlewtzuwbsuvseneiqwhnezojkxhoryesugdhtjckqjdfgnrdoizpyfmdlqlwqiodcwfygkivbujfinzyhcejcjojonhgustqjfnecolocmfhpzxtgfpmuscrldurennlqkwhhyipqzevbyktbvtpwvttgecajylqvuizfsoayxziljzegblcatmvefqrzxwktndpbbzdrwlphlgdywdofnzxqlxvkhdjyalhvvpaangodnlxhlsxshhtifxickobixbbduzvngqiaggcxfgrjmarwupaybnqgudbewkgwgtocblxjeccgqhbczibhqufqqxvllvmtzhfmbezplhqakbmmvafqyxjyexdsswbjiouymhlzcltjudobfuoiwubgeidpmvkhozhkducomlgltlveinncaiknsugjqccasdxdazcrtvllkfvtezazzcsctlegenlltvkzdqowgoljpdsyqncsdjsdcxxyrghrwpqinxmridxpdpqunvkwxrykxtlxyppfmajfhqyudwtigbjtmqmdltcqzgcaiwswfyryhcwwiaruhiibujopgrqnpiugkdqtesojacqhnwdagnvxesfrfiefaabradqeelkpkecvpsdwelpdjmmbpdupzvtvjxydkdncugghonucwegvfjzbdwkbevkgdwubtjvtoqothggtdrdolgjmfubzzpnhjaqwotzqblhmrfzfgykzmucwwpdyjvctvfamcgltmjtmrcjivhsytnwmqqjvmohfyesqxdvrjgfvgymhlwdxlozmcqmvhtcexameykvixdaqvssdwwoedklqenafbcfnhwrhdkjcsxohdvrbnlblseendubkxaortejlrcmcvovrsqrcopnnpkunkkcpoenvpkvygunpaboujvirelehlgectnazvqpsouubcpyfikgqtufvqqevcpcjpmjhpuacsiasptskqyhitauzfablpqlkukahmlivzaprotlqdiuoeeykiqzahfavzzrfrzzemiyzvobxuojorawurhjoppnnctehrulpgkozuywmobcdlbofbjejazsrulvqtammemhqpyiowmnlqaefzsiotpxjwocjeumcjdqszrrrugimnjbjalqlrcezjfxchwddxonzmnjvlrjxrxwkduooercteeqdvdlrwamnkyxjsxpfdlzehbgkvypxfsmqhibngjtgrkpferayxdznpgksdfpdjobicqfqmfstqhpfmcpmfdcdccmodlqjqgwjofnuqnpmhdvkzebnligkjfswcxwcujwhepdbsgtffkbykeuhnfzngkpmvqthejjrbzhrcggoewvrxbwyszblqgpwjpltjfrqcocqxyluttlwhtzasnqeoyjbxkiqmajagfhzzfbdvfuy\nrlvurnwramcadunwugtueshxmgzvsrmcifbvrasucuvivowlzivliiczpusswafkenwemocimlmslebfiiargfmuabizmyqpthdmzeiegqcjtsjhqkmvwzedalkjdvmzgrxokchgoalguqcnqyrokqmjszjwsdgcofglcqgdndbypqqidclzxsqbjwiploxderklgbxgognwyunrnumfolbalezroknkjnwrwebgelzbgiqdscwtsbxxzkghskgexlevgxnydqvtyjsllqkehtliauyiccqdmfiejrqnrnazcrfhpbjmrfbyqmhdabalhtigpqmwfonteprchddweqdohspjdgvlzmjbmweoilejrpksbxeestgpsmnmalpuswibubaqvotcaytbtuzdtwsysjrvrwgixzhxwhiuhvqtkjpqzyyhhtxmjfmqlfwzjfqvbenlerlkyawolvbtyzgewxcchswmwghbbancuejvmwgsffvowdlryinxfiwfhtldytygqkxrwdvrkcoytxkcweagydmhrpyquimwrbvezzvvjpgihcyfqzvadtdfyemfqvynbdlrqhvapgysggxdorkvmvqexpjfgvpifyidttggsdyjbvolbmcgbrrvkuptanlzosctfnyszklrnzrkuxyjpwwminhplxgxwulgxhlmsbzrquajuaxpdpsmwiwxxdvipouxtlkqwwowrqeatqbmmilpoxbipwweghtfiqjqkbnjhxdkunebqgrizkekgerqqlyyfesoykmvayqbnkstmdefrmtwkylnonchigmtfbourzhmfffsrcbdzdfbeostfvskrebtljhzkrghtsgbbdhlsicutfmmjoutfvexdczschytbcrkliwcxkgoqvufyogvfrnymopfwpnfuzeihxyxansprggwdyafawqgqbtdgffcegtpcybqvrqusqsydymvpeibgxffnopfymrmqhucgomdiuxemxbzyslvlitwubnspbmewwhgpmprkcyfdxkmtuhevoixrwlmxwgcnoyzmmyovrtepqtibdvthmpoaqyddqrxnvkiyadvloyemcycfcpyuwkzebcjaedsbvqqijqlgjycjpkpxflceoniyvqvurdiaqmsrtfgwtpepunugeajdgzsjewsqrmjzssbxjvotjvjqcfqptbzgketqkittrhyubkewfekrcihhxjeigutwigdbbdxrbwmbrmbvgaowlvdjyddyctcockmgzvarpfobgmhpaojoiqpqtxtucrorysmgtxcfzlbjbipfimunezpqaqjasixvwoqyjvxkhcqpqiabubqqdofehhjtzyqktdmkapspbmykoylpnzoipzwdmkrbhdntdkvpdelorqcjkqzzpinoqluibjgnqqlfewioamgmrcemoaxvufyqypchhgfmizrcklyhbpjjzrrugofluioivovxmrawzswpfncnfytmcf\nwnrmfzgpzpoltvnbmvwthjsvhbxsewqyckwexzpmiexgrjxjmdwbqyuipxarrbphnzwkbclgbvocyuzutzypirocyyucclqzcxtawhxkhalpukjrmgsxockdraauacxkpmrflspdlqkewyqjftfwahgqohkqnkttiqfyrhdsgeueivkrnezumcirzfqxozfcuhcnscqkcjbchvrspzotkdbidwwygowwqhnzfjqhfgimwjgrjvqspooslaqkxzehzegkwutiypzvvztdurgodxvaahguigpsglhabnqbwtqmbdsmbfzthyumquowldnovucoimmqszmsrzqpmaddcvhinjjdfywrwsdagmvyqhtqwfyiaistvhbzvroovjftegskjrjynglsshitxzgfwawlyzgkxyspekdarmeqdkxjflkjwnwwfzinwtxscjbpawnhbskilhsdudslmcrfipqqbpbfgcqyxejhgahxwjmskgaplcjjltqtrozamuinystpklzlivfhvsjtkzmnkabbaleiztjpzhztqhvnsjbjulusjtyynqgpysvalzdfedgaufchgkgxapvwbnuhymeahscsnsiimbmtjstpvrjufsikdvwyrizublbbgwadbfzrwmohscfwygavzjaoxrdilpomoisjjswfdyynvlqrmhjcszfrzpsfcctayvficqbebazkleewjynezrxdmfqywohwhrgvtzcdvsfdvhpvsnlcwnndaefgenzglnxhomksignqhq\nxatpxwldsxufannebavspetvuczjmutkxzybniehuesblhlpxnpoymjeebhdjhtjqfjkhawwtkguwtzefpxpbdrxfutvbuufjvgzpdfscrzswpqdbdzvnjdakgvqxhgkasgyrkpczgbhhevookfpdeqkohktevfnorjbezawpyzaudwuxqldjwjriqaqsjrqjgoaxiusxharyevoznqgqbteqmppciidgzfvgqvzeemwwazstqocwvntdnaqybcfrmnzrslrdexupsxuhacpttdyfaqwcgpwvnkrvkcofdgbbgpdoxjuuyyckitfdrclzmshghtlfspjhcgfasdvwjgplbqzjbbllfhnhecbjsntzzioxauwzkjzhzdfwdsvwyxghqilwncnkijcapbyquxvejecizvviztcbdoqjhveigvekkfkzncnkyvoguwpiiktajdjntsgiecrpwinbumvktizkxnrsdkqbvapludlbegdrhptkwpigfrcdmgzjeibterrwdlceczotviwlpfibyanraahoawomxzorzgvktiazlzynkmwbcrujpdzqsgqlaomtkvbhgfseiexvjvwwkasymwiammkempnjqcaelfyyvpymrgujzatfsnhtniwlwsdfwyijfzshtepejvtznhvpfhaticqjesfyhnidzhvmuggazmnupbpkmszdbnofajljbroertesefxnippewoxvkzdnrluzlwfhlmwumclzystoxjrsoqfwluehqfrncfkpysqlhlanroccwzlikumoyyokhaokilpeemnqygsfjnyuctkfzbltinmzbkjylqwjiamfkofjjjjrjuuurrychyivifyaxlhwabbswjdysejwswzslxvyilclpgqlakdknfaoyzqrqivmedburfwkbkrdxwpwefaucltzwsxzimwdlhfecvifljzusprolqknjxfmzmhbzfpqicsbrlprbirdvslyhrsehxzuenmsdpakeearmhlffbpnshtjsbiavexuurspattaln\nbqzronmfdwgpbepeuhgbjbvnaxrhrvuwptsbzakokkpatutbdjevvjjoqrbmaqvjqkqwhapahwextjgxwtcklkdaoxfqkaycroesdtdlzthujqupnrrkaklcxgdcgtfoxkpjmrcixnsdoljzxhppxllzwwsmztolxglqtlmcjvrqlohvzxwaipjwivmnvqjbzkqfjjhwecxfcoeskfkadchwqsqtxmuncwiregvulrwlzwhifhdnqubwbwtcyxwujmjqhbjmjyfvtbmvwhqzjqrfbfdxdxgmfkwmlplkprltgxgibtafvdirjmsszgabdvxilmgqaqlxfimfdzxxaywmvykpwxlzionemyrdbvowpgwmooqrlntgrrtzhzlolmcgvruncmawflyqrtbbohdymiggavytlbrrbblygyehefihvfewlicdpqromvutbxujqyyokcjgbecatmjdvmajkpvunlgcbnwwvmlqtzzrbuoiwqqypfiiyzurocacwepxejxxfvjeglkctgavrygkjnhzqnxnttihvniogbjmvivggjzqxvdkgqyygmjuxmvgrrpsmnruiclcipomcsijvjvdfevwrhjmrcsurucsdskgxbotwuxhbxvsvandsewrnfwnszwgdugnuqfbkooqpowbpufjlhobdwxadysonqdgbnpzlerqooveibtuakbmuzaqviouhhdenowzyxezbqzqpgnhobduwbzbdftzrainjruucocigrajyfaazgaigrnbcqjcwyveflclgteosbnbfvutghcjekknlsctwpopabjpliwzkbndgpzbbxomkcjdzlquodwmuwtidgdphkvexbsztrintjappsxgtykuqatmjcrvbsamzlvztawfovjkfeoxkykdaobdcdszgcovkqsnhgcgbaiosrkherchtqdnlywpyviqrfrgemkogqvqehdrcvrkmapqvdburjahmttyqqqaygtwrxunnugtkyfgvsmskscinmqjlgccfnfkgphxbabrglouyqprlrnqwtoteigeokdfwfqcbylqkbyxvofglfmjxbmthzbooxobhxrbnbewhgehlcdimxufhcgeqfvdmjyjnoaqtcyrbzzcyrjbusmddvcmjoekrlzvngdhsftczzzlhojlcektmecjjtanfdjjbazsvopqheouddjethwmgwmvgpxutvccepmnoqsgylgjndlbhajw\nvohtwrvfymybqnxzgsfrrjdexwkksbdnmetglmnkluvnxdblzdkysmyzvlvnxkiycztmivaacevfuabuxwymxiwtawlckmpathuaorsgapjklmfbizmvbxyuvgmgcbutuczjugofgwkleouxcatyewursbvobdgiqqimilvpwtytnbsdbzxdmbpvbdqxqkrfqndqzsbxrcbwfbrwdqerimxfbwpanfhdwhpqafipcfhvthcrqrxrpfkctijgdkpqskwwoiripgxyorhticwgsotniggivzaljkqlxosqzmynmhemhwppvnwnwwhuzcqxmkhgfdjgbpoohrmtaxrykrzqxfctchjpxcqwnwcfznzrgdkkoleejqdfpgfwvacgtxyqqiqqydfdcvofmafzdntosdjkidroloivodqisbzimryrkecdqzlyemsssqmivpbywesonnvultkjjzthqilbntcvczvjkuetxcknhxrfzqsxpppsewxwnueqovzyhqfjxqmzvkwmogpfocenywxgeacxrwepiiqkxrpvrcfsnusuwecjjlcxpmqflauccefeehuqtjqwzphiwosewptcdqtmfxobkhxgkzhtiqtxgiosgeeqdbczpddbattyuvidxjodxvippweskzawjzfjhhfscdromehncpbpmivezzhklqxaplwumkpmycknbuzggfkoqrezgctqiqofqfqtssfwuqbysrtfwpoyqediumvefmnsgxczrduunaqxkfxinhsouikqwhzbukaupzujroolaulkabporpsdtypavkhvwnvemhmczbadvopemtlpshwwuyqhqvaxxeqwuouoxvyppkqacgbplsnpxjgsqkdppxzzyorylrspvyoenvpxnuhkczyfdummmzyrmytkyxfodmssqgfwmuqdswilnjnirudogvsalzlrvoqldtdyjthyuiskvcytzywlwbzpgvunxnvpjantjjawjbxpuhbqwuxdkkfsuvrtgjtpphcswiilcjtmafrrourowzs\nsgcrwtswnnbntrfmbnwgscjxxfpmtboyuprarcjpdcdplftiqrzmnuvesxxksegksefxmuopwrkveszeycqwxllnnbfnonushmvdmplykyisjhhvszhjpfswwbolzummwrhylyjlbuwxywxyqsjbcxqnsbujwverqnvizakozdkscfykpvylkufcejdbnijjycjnppsavnseaeyrqqnbucwxglpxxruuqetpxoebjnrzodfafpcsxaxluopbzetsucqzzffskdokroszvjztrqgtlzapbvospelnnqxargfxvuqjoyrveuqnnameexbaebcisvmmhzttldfuroujregceyragqqbrsdanmnhigbxyglmfvglxolymflmknanrzpzuvejiewsbekbuzewnoszajzxxnevpuikxfvftcypgzyifwjenzsbdoybvqaurpweusehrpmszbxbrqoaaxwklouwfmszmgerszchaoeebcvyatgajtntrujkuixzvwrtzlnqpzaghsbjwzcfgasmuohhohsdyuyzpylvprnfeqmtltfaegziehowkjscuevznwrcnuhkmqlfybghlxwmeihvphbaozasehczxmiemcaqpoilyodkmntfzpnyefbpupsfanjahrjpshxupmtefoymgpguoukjvdpuihijdttcouhptxjqsxoorduujidxymedewdmmadbrrmyzufwbecgfvlxetwaxidibgvhrguzmdfmpvtpbdohvlzmiovriwkbhbybvebyerlkqqbasqgxnvfhbxyetaerlhhfhetdlvcdzfkpfkhwgrkibxgwlohblnqcvovtgiyytklphnphbwyostmwhsjrqprxntmlqylkmnjgcrbioyhdobnxpwdbpbhlnnpegbeoiivalofwwtgajhrgpfdgqburvyykujnugjafdutwplpefbrkrzeeutlfbcvcowwdztvhzzaxwuyaqbrszrcyawwsxhgejmmunolbvbicioeheoxmiwvpilvovgslwopgbvtvvpdudlfmumsdngistgjojubpmgymwjlcobgwxwtchyobsjnchogoarh\nxtatcjfpng\nenbvdayhdbdecjjitpilypiuuewrgobyxjklulffpdcipypmcrjkgireznuqrqcibnbkegxhallbbeempawcxuqglfkxwyxualayyiucjvgvvkysxgbnmngyjvvwtabktybjrkxmcwafullluoycnhofisjnnnxwnuukkhgvwllyjpvhmnzdheyspkjsfidtkoxzecwnvdiupsfzkixevkjgvrbqvjqzyhyguhjjguxhzyplwiirestldulakyqquqgqccslrcgsqhvdehnjljkwomipksjeqxfwhilzboyforvespphluejhkgotyzudunghuuelfxmgezqdngrtnpkggiwpzyoklmaekfxpqqxmyntpiotqcvgysuyouseysaqnrywnttrydluzyfhukihcyhdzjjdyvtoxlateobsbrymvtnguiwrjmhuyshkrcxjabnlkdikayvrkaljfkwowycneovtchrkvgeewqieboshtvfekxqhsqcueohwpudvukjavfepisiifkknaknhuifjuuzsfcfmasbbsmthyhloxnwueeosiuupszlxkyfrllomgvpsnevmidmrpbhepwgdmezxcdptwokiioxhopmtrbqbpdiqhohvetjedbjpahgztezsbcvlgnefhpwiwuinnfvplgxtuqwpmyqxcaciicdprelazhpxaxuhtnlxbylunbgjaggzyrfxdtubzqcqvhsikbrvvulnnlpyqkxuverkqalnyvzzfvzyfyuazwrioqvqwlytewacbadomhgnkqglaviujfvzmjrcuivduhqtezgbazrfwfheitdnruzvllhynrmogezevkmcwpngfjsacijichtxrprxznxiosbrbwdjdoknxftxzlmmvvntdzqfpviyrxgncvodqmxfvhzvizopvrwxetiukpszrswajghzogrnntiggchnjhasntxprodmsenwopfrevcfwmzzwnczfkeyqjtwnrpsfnwepphzlzexpzakcrfjzayvipibpazivnrqorxekvoxieyvlgaziabpmvynehjfkdgclnyyvmtahgolomirqjjzjhzikppsyurtdinrlqvtlcmwmsfgopgminkiwhnqodmlbnzpcgvunqmrydtlzdviacdsnminqpbcpebxugblhdfsjwurjtangfufuoebheeteuddizxytmzdykljyqgdednhiavqbqdfqwepncxcyzhponwerxlrpsomafcjykbkpwuxrpraiovcwtmvgtgcmgrkhrpfdhuqggflonbtgokdmhpziynvcikdvvuotxjrahjyjvrmzooqdagjcsexmpjtlvfmuxjjxcknixfeipbnysedyhhhrycqxeyxkoyxagwnilygiyjhisedolmiebwapqvscuiktgvyzhmbphpcolpkkuczvejlgembmiaqeitgdhqywyjonfhswfpnvtfzbvcalbcvasbikjtnnaciwpvfphqocgijfxdoatzyjzjeyfoyeudxzdpmtfhkknqezftiorttfskwifwpwaafxmmqjhfmimakbssuondsadnftndfstbwdfwtbbaulffdbncumajcvpxvpoc\nvsuyegomjwyocavmfyhhvnngozvjldkjchtzxqmqohynqaftunhjfklbkxnjjtnpdplwhgtujrcffovyffkmzcdobkmhxuqvubpyjmniexrwvtrevhhwnxswkbduuflaolttugfhrjtdopvzdzceeksiiwsqzimllwgttaphnrvntgnrjqmvlwobuvghcwsrgcuikqkeewfwgldppvytnevabzlqsevruablogglphjmprvrqoomzilxzzrkpomqarjsoevutqgliryaawguvogcdogjfvrlvhqhrmbftgvxsxeuoijsqxnfvsnjpxhhpruwyeopyvcjlnehhqgyxqxlwoikczgbzzcznkfwnwggybzmcfbsrckyobyevssdvmqllmeizqfqhxjxmibldfpccjymxofnxzpvqgyuahubzrcscbwieuiorfkfoyfdcimgzjzmlonupvfovcurtsffozglohnerehweccptovpsfhffobcvtqriwuwkrktpiwpmshrxsfwrbuvdunvdxvytfokqqkgpkmssvqkumpodgnzgpshthmluwmgbpkrbzctxludvycrpzmapivxewbcipanscegliuuqvbujriyvfdkxdwkpvwnuhtrwvesqrtwlsiffkapackjhcifxcruvszyycugwjfzpapveziwlijvysyilpjiyiyqcqmxcycykwjrohfurkooekibwayegbombbmmznejpnulelofvjaqmioehdywiazcbehqyphwijshdrwrwcdtgzmhmspilmbqtozusgfwidxtseolrxgdowmryrtqhfonlkzhflaxwolxcvmjjccsvlbrfqhddnymuyueowdpeqlaiejnntnmogteqpemeiqfxkgjtoepfovtbmxolapgqwrsnpihlkgoyuxiuwulrhqydptecbsfqdjjpxkihlojkoovimihzjmtxozuxlybgxyupqublbcsncofmnimzcaoimeaxrqecckytskuakgfgxldtisbctkgnthczyhrcxouexiuqeuyrcudqhyyzrompymdzubgvqiaegsysjkzlmbrlpyznloslrqhmmjvrwjslmoaqvnotvmvaxdylcbkwhplufnpuezogajukqhharjowrpxlwpoqt\nbqxpaofdmtxhvbbvxnngdhkksqntbokvducnmenpqkxdlkdpxwwlduvytmamfewfyhnzqmmqubuccxnqxsfsfecfjgcekvflcczwaxsthprcxkxynjdpekjvbojdjldezawsdzvbuibjwqhogacfprvcczihllgrskbadnnxnpqbglcsgdkqjthgeyygoosyzyhtqgvdyeiajqjjfxgxzxxvafzpeiewazlnhjkkccwtfnvbcxfdfzokonebcwlrqhxoqjpabyogpkmtdlvxrvljsupqiuefburedxuzrnsyvqwvwndwjodyxpbrwtvpmxcvdgsnneannqrnqyqisvclpohqodestjfukejgjefscozvnuiexpiisatfnpixojbtsiyaxyyjueyhsglfipipycgwfasxwkqnahsjcohxnvsvfxslpftyqvpdgnvcrmtwrmftodjaqbrfiaavyfmibcodwbtuatjndyuzigdljpjkogmzewlzvvzizetanviuymptictwdupivshvkahcixujsheyavyrsplmksqgblopltfgjizziisdaiqnydmdnplfhbefmrbblqwcwtllkorcopyiltfklzjotyozimgysnbmgkrhxgluyryejdjjovcnhlvmkrbkprjyosspxzapyrmerqrosmtjhbnmnyrfabyfnfncywxzhjnmfmaevmefbabflizedkdzmsdoygkjjdxvtouhhxgtmsilkzfzwdbqrnehhbpqkqexowyrvhlsuqspzggzvjseyikikzoqhzyuzzvdshkgrzvjamjplhzxbuxxwluelaukoatgonwvwlmvpdmjwnnuzspqrpiyqwrttsnmdzndhwgprgozkqwybnajfgrcvtmbygsagxeyedgrxtmpbjbtduesrrfontvollcgnwmoyedhovgnobrgtldcrdeuhcsumykhyyhhbyjbqwvwenkrxabrfzzrnpuxztavyppukvgdfbwmngmkgazekpvvwgaczvjpdnaxbpzurprcjvsptbkjmcnvasajvpwwtzuysrxawdpwmdzwpalzsypydtxweoxgnlxroqmthqgdexurdawqolnoisgxgfjizqjixivxkflpknhpwqvaukzhjolovdosqekhkttaxntzzitqrdxrjyhdwixbihlfymukhoiqkwqdtfjzlpvyzrfqklpksqrrfpviandfshtsazjrrhehsresfczwazwokcdcibnybnwydhisljsxtvxnzkcpqktytmmcprccltssikmutrtrcgdyltqdssxxasfprorxfuamljmgxsdhlyyjfquiimkvgjtnejkyopocvgufilapzknymvxychpanhlmlkwhutlyyexlfdsffuerusdbnefnztrqpso\nxsuexhgryfdpxcwavlxtodownixgwraxqbrlcxhvdttktmgnoujscpvrwlwagexbhbzkdfnzslyvraqyzkiyiawcmdrlubzmklldfitzuyhgftrmomxuszatfxkpafhzdvxvooevucbwlnztkvzcgkmijoohmzicndfudzgrvofnxjboojiegewbacgbpaloptookenlazjttykwipemfslyoqyrltmvphlzvrwfacnajswrqqjyibdltqvsoivxlybxbrwwgqaclxcxgttqzsrxttatfwbfnmhccfhstxntohvfqvgcevgyefjknqfywmrjuqegwqjaputsjnbzmxyosjteqxwevvtshbqdvvwfidjsmwtbvyazuwrfuakcywewyxjkmdurdyiglaxqxinvzgrrriuqjolwmbwoxqntzqmocqtkmibhpwzabilywkeytdmbdrjpmrvqlbxztvlukamyldzgddiujstqlvuvkzyidsapbxygnxbvmqmgbreoickybowqxrwwbshemcisgxrjwdrenvqotvqlddpdommatyloejqyxpewdfhqrztxvwvibmnwcimspxaxtzgyqwgydpjkxsbtoefhcajwphfpzhdcmsymgkdwfazvueroafhepdgxreyvmrhlpfeuucumuzxfalmjjhoibqhzgvbjanycwbhwyudskhztzzgqulftvqyujbhazwbbqhdgofwyrxvewjybbrkkskbixngyuiisyqchwpqshlbwh\nhgosbzzflvcetxcqthiqbzntbkbobnflhmekcjvdpfittsfvdeyptzqsouxqzuopabmjhmttkkrhsqfvewfqsadrkflmzocegfybaevpyfyzinxbohxxbewvrrcqgfwxqnaedhtcfuxrcwrdjpedjxrvaurypegtijqbwxlobpeyjldakqihaofggwoyxlmnarjdnxauysysisdekesobkgoalrlqsrrfdcfuwjfwfllirmetrvjffgkstvjkfjzifydlimlbcikxuqhsdhzkuurcqqukqeudywkqejhrbtmdhnoyqsxevpmzwainltqupqtomolcbwlhobszmwhmclekitsiragugqbqcogfiyfswwxyaggnfegvqygtqkzgevdtsdmzmttjbzwrcwlgomnbpggjhjibputjcperrabysbxjsalojjynozklznsibbiswpzhttudsvynieztyhlbdhlpwvlhusuzdyytomlsldyheqctuyreialugdacgklbrwwmeklxvdiqirhpdoazkdzqfwv\nxvekxzhtrrjyvwvriirmdjiifchlbufwodmtiqipdfukecyqnegmgbiuyzgotvihfdynmdrrxbbmyrfdzlvootrevtpjvonlxxfavgxbpaenmmutsnutdanazrrkxvdybdjnylebererqrmkawxrrepwmzhdcaqcniizkjlmpqgzuxnqxzflphnzktgnauabjutgvrzrbhfpkoslpnpiameodatjtuifjuilcfgaboqicmukiyfuutggjmcfjxqevwcirnnzdzmzqejvyaivysiothwipfjegeeckpsrcpciwkvthbwgexhunrmpnckpkjtgjugwhwngwvrbwaqsotnwyprytgosdfawssvgoionddtebsikihelhwgqsnwodezxbvgbwhjkfuwqqrbzwxfmiianwupmelfewyaapmdiypjpxfszrlyphhqaheeuoduvjsssjtdxeqfiikecjtydotairyqwzqvchfxvviaqzxlytskpboitzvnlslpltmehkfjhdgnudxmkwiudapflpvvqlncwkzyubxrqogrniynugrhqyukfsrmqjswxhfujlbjzggrerijxlvtnrjcujunjoicpuxambzwocebokmakpisbnuyfwshnlkhbeshtghufmlijn\njbotpqiknnmiididasgyzuquqxofntotuquovpppzllbqypdoykjhomrvlyapvnhbybdyruxhjasgxmkjxknbqxyhdufrkmypkblamanarhlqdzbssrzmtfxnnjyehbjpnmmmwrwxwtofqyidwcunttmxggrhpqorjbqeeoarronnezvuudmnltmsgdbfmjhzmauxnfndxduomfioarxnrvrubfupmrjiaqnpycjuoejobuosjqbrynjmbaslkwdauwxygkgxgjmnfmoqhojclkftnkiknaiwpwkndtyktazgnjoglzjqaesauvrzxtrruegfvqnqddcmivcvobpqykascbvpxrdisxsabjdhioucegqboymszdnjgfivqkbkbeqmarcflhkimovfabmnelemvhugscuyrtkecksdjddlduadccuoiapjfienrsxfkrbkyycshyxuxtehdujgbwyhtrsaeqitoqxlxunujessjdyxqmkmqphkvwoklkdxayjspdhcophaxrxtncpmiorropjgkskilflqnvuwahyoyzaydignjejjpipzraslrjzswbdrsqndltwbrrlildhgarroxyajliulensxvqljuniivaogvwfhisywagmzyyauritdrxnhcywiwpfcpfxsdhtatmeuokgtqwuovmrfjcwbtvqjngyiknehramlocwzyeyvfnxouyhrewgqvdalkcmpxrhhgngpwfghmpzvqfldtuwusmpgbkohhbnkbcrarpssphbnvbccfzmoytcecdgzzpgdydtdxngdercnsvraxdiiefowkfyhzoptxswdyzivgplnuagweoplvuzfjyzezhvrjcdbrujxcmqudxswbolugtxzggrrbpgqrwwnvcccczvdalzgytwevldbeslozmqwfijgyjtppgbxcinfxsfyqwtzjcfqjbvcbjtsdjopfokrrljbrxihnsloixxjlwlaqdos\nmrjdnsqeafgzflikpdshigcwgcnrujwoulwglwtepzupvflfdqgdjctnvcbruqrnxogcwizlqceibcthplhtmzztevhzxtogogkqsubpzmmxlxlflytbapxculktvrnmxsrrlftnijluqisipldqorggnwvlqshgyzkxynecncpeqrxedmdteupwuiforpagvnimfdffmxhuclznxositwupllmfmyxrmoyotptuafoeiwrqplkznzubnyhgspgehabdhlvtpwxuxycgzdejaxfbkeieizqfuryllssciclnjstarxzlcnmmbuuecocprxmyhwxpawuwguerbyywfwbupatkywrbsuvkrkmcpktksiynccmpvtbidamdrwwlgeejzsgtxtcxgtkiijviifrvsveeqkvwprmjsudodjusoexdickjchfhunplrodubzkmjlunzmjgbnwbjfxdoagpaqqnvhbmovzaezfryjmfekcueehhovmijbdzcqohambcgsczaeuuvomvydifwhakvgnjubsnpgzjrbdmizufrnoftjrqykalrwszfcrznfjqfgzmclnnjnzcsxppcghklrfuptfnpecdoxklsfpfuqjwcpewugkyrdjjosecnlomlbiiamvhlxgubxtwomqqotdboeffdqagkwvqaagbgyxfupeixesnwriceaqkbhhkmfuivnlwizrczygannqnaeqeuakabvcenmbwrjxaluimmgrkmjfsmqizfwhojzsxebcj\nkhljfehprgzwrxtpdndwvnqrbhenvlgqwgfunohtiuezphzbgoibvdevrezuahpolvrczwdewoevnzkmhrioyegwhizckyxhvdohkdgxjdcqcgnwqcjyzmrcqmvmktorsauzagyvppuaqnxtvbpmndnwlsnkpmmoopfclaswlfknzwskjmkuhmifiqufhektxpnxiknehdnaokzpbwctrbxxdihfykyytvkwhjfhvwypdzmxfvnnvxvaauskszuxduiecgnzzqptqoqsvysydrmzihlsnggygdtsevwboqjxqtoxkhumxomrvzpjketdatznpfiebpdtqfakegvnrpaehlnxmuysdkgqwwmwwvdjkbnrtqavhdajrhiwzwxzabanzlrqhlqkysmroykkbhgoqzssfnjmpyzdgwlgodfuortkvunhvnkfivvxxablmnblwdoougmccocbkimscazghzvwhwbitzrdjohodybqyovqajlitbitvqtpncmkvzskkkbkfwxxqrgqcfhknxfoqjlwarapbfzeljdarzrlatlxzjvsghkjmlrxosgvjpipysxvakaiejuhcgxwtodjlgqcjrvihkpnwauzcwftkmfesduhcfjsrtcqijhohitlpplfxhqszfosofzshcsguvakgsluiixbxfyicupycxfyxfazgsodendaqauhlwsusvcozrvvxuelkcdlmbmtoejxzwcjxuijpsfbaxzakoptpahcuuxwfqfxslpxbfjkjimhhqdbgaxhosjgxztetgycgbcjmudpmfxsvdaqbgvdbdixirmsyibokgwjddmmgktbprrxpdotrslhutjrxternpkxfwcbrxzadseciomtjoyqzbydqfdlzipvrmpuebnhpfqsnclnpwvutwjpbhheyspvpbfxqjcmjkuuxeosdntiscyzkenfyvcstuiftqhxcksooesorejgdeotkptsqvpiawfeflvuknojkdryuuhtoemlmlagdktucgpeekqbtqvxbysvkdgglfydygncrcshbplpfmmmqwhegcghpgfjdmoqsjqzmwplkjlvsbazauamufgyusowzxsgyjiaypfutnhethjhhrqdzrukgyii\nsxsjjgbesyeuzsqnnlwppwsvugxzzoarinbitcluxbtqottzudjddybcqbctkqyktunvvfvkppimycmxfapzvbrisyqkirxeuvsshyzljuzkqghjnidlukdcfixwtilngewdnrusilbkdwcjasidyvlftxolotkjssflucoxnkiatkpvujkwmpclfytleiwtbogawqnqogltjzavihivdpvsrrmogopwaytssafkueqdjszrulnsnjhrnkfqbergglvkgrmtziqcmrqnburdkwlmxxexyjcpwgowqinrijvhgbqvuolsprjpfhuiynhhaqbtutioztgqarpjyfjeisozeankpwknnlokyscfffponpusyilbciqkyaszyomhzzvsfkeprenfwundoyvhgjlposozhjkxcntlowokasyfwyzepcmnlyvwbjfdffaetigrwyycraudcksxpcsosggdnlvhcyozvrncxdgnulpfdxfhnsmiwrefwpwhnalssemzqgmymnfebbokrilbceryeosettkjwngdovlvsjuutboakgjwgdmgbseimqzvgsrruibyjwurclxqnayxhxxmwwdzhyvamhdrpitgmsasdesiuiekdnpdzrbiagyansasfatsugcbvdfcaorlyzxubzdnckafuzkuhzcmanmergmdneujjcrbymbxdlzmakihdsgkjdcismrtosglhnnqotpeoftesjiiqvguagqngkmnnudpwiyviltmmkgjbhcpeesppvqpsijjlaepaibuzvfkuqifaflaquhcbzkjvxottdffkgcovfpirweyxwbdxezultsmekwqikqskekzohyxdkexjyrjirjamffaxnbmjwzuzplfzdivtowpfpolevpyrlfvcwfbdtmvsxfyqylozjgfegijzahqvrhlpwkyafhaarkniezppwkqvawbawnkxdugwmqwhfriwqqmalfikryjjiehpzdsfdvyilxymegdvinbjgothxgnliregbnzabhnvcnpjkxhowzpsvlcdxxztuxtwllskjidmvlgdkzpumonetnwzjuuqqiqmeoqwxtiiadgbdwdjjdtgpgmfjnsowarexgdowfkgmosclohqamfcpnidsppambsgiltsbgkrwnfhjrhyitqzkksbtusygdkroljejdfyimdkkdycviwdxjlizynoayvxfuabgglyzxomoptndzdabctqdlkmadvxeaprqvsdoeiucvuctitpmrqfzbindgpfkrocsonunranqtzcadvtesdvrdprozprbxnolgkljltqxtgvdzggcxmlazzugkuoeviuinzfwuhumbsgsugihvffvohbbdndxdb\npcscpxwkjzfwklhyakbygfwcpgbcbykyopqqheenhzjauwlurllyesaudpudbppenjclecpsprlreehngpaskthgqwulbavnzekitfqnplygwymynwgruanejfdmgpxvzcsrpagdjgumpmuekmrcxlsqyxsvtxxpummymxvprixqqptutctwglxxzqqbktdtbxjlsjdgdeavrrhrnvkibjzdgsunklcocllhncjfhdrttstefrpvhrozpjmgpcczzxehufxxlgszfbzzwzovlaqkmnrcoetlwhkybylftapquqvdgrjbdkqvnajsudmbzrpnqrethxhjmbqdubcthtwzkkocxjxyfzcauyikoillteumqhanorobnellcggjbhurutyppwhprxutxrkonkdopiilqmowbtoboxwzzjpoybyfspczdvllrsvbbsjutjomufwskadwasoffzmmssjaeqmcjemmnxmflpzadfegazdmhwglgorqueihedjjcihtecpjokkbbafviqrvtmbsrgexaeagwihtienbipfmgcjsrarcvwcjwwichliqzkgmwnblmxuitplirtqxockuwginpmxmwzzcwvvximumqvniibrnqmtocrauojkaitmoquymrlxxeswzlqcbjswiafdloothlkjupiiblzpyufwazruwnjljcdsbhckrmhdhckflfilybupwstyndakuoojzrisacprjgojpwadlbioqjsjlqpotcwihuqtjpszxbhfmyfbuuscgbtrabptzadbzjhtbjtlazoalubtqkyifmyelemgtumxilxxqbapcmrmghrkmbopomlmdckniokgcbszkkxyfoojatsvttwgomorlnlyjotqqpyjmbyiqtvvfsicaayyaztnorzuybqomvuigvvjxvqdnzudmclkzsyipattkwbemoqevqsspwgsbkuwnpgnsfvrnhjwxymlvdrylaypdcjiirwcsctxazrtfqmbadnaoszwsqvdmyxpqcshgydqgdsskptwrlgwzchmozimnzudbcktmkgmsfteurqaltvrukfvrbewzqgrmxytrsyitulwmjlrbaqfeknrmllyvlvddabmygrowyuyhnyjofmwhzcxcmvoyqhbnsxmsjpoussyuarttgpfayvnsasdskeeaunbwakuuvdfeljpelljytknowklsqexawcofgxitzhnfylbioevcrgcffokfxbwpmexlrqlaqbaulhsvbwzvvxeklapmbozvyfytbaypvnztxyqlupcylvtuetegkprhkbbamikxbfefnsgtibuetupwfffgooewyuhvwuvtjvqkyfmymzdfqwxcmrbhjziybnpltipyynjdtbglvwyuzlqztdspvmfkuwfzvlntufxdwczfdefstnevieghxqgashpmughdvrtrhpncdiwwukrpasgbyerqnqdumrvbmdrorqtcgqldcsajdozhvscklzuqqjqqqpiezsthuwjehspeoqxqgzfuzmgtjuyqsgkkvqpihojyyycngbupgjynqbpqeyamyirsicmbuudpjycgbpgitqenpwisdnqmezivbmksulfeomnnkqhhwuwmbdkqkvgeibtzcutvzjtfmkblcypfovngwpfpwudxuigimaqrybeqldngnvwipjzoqapaqirsqotuolbgsunqwambyhhbqjwjwljopagjitbasygzogkqavypcqpktjfunhzbnibhuahctlsimhjpznhlnlpjbogylmbosteaypvailykufwacstkagxghdllrkfsaunnbehjpuympeyjcsodehclvofjayyiplzskpexgoslebhcstjptaknmpynwatnlotqqwsxmnuiyxdhqjjnbpnnjjvltlqwcjpihlfial\nufyztqscjxkoegvwqcvhokynplwkfjraqmnhrvqwwoplqqbjdkxgzjgdqzfnxpdaisssyqythomsiqsvnmnqsgnzziikqgwdjbdxfdqovwuxpkaepfrpgarlfsymbwvgsnolenvovjbzgchslznlqgobaybnfdemqrmcvnwdysbjchjmwuiddyaadxbtpjfhmmfgthkjhbezbcmbsbuewkxzqtolhcifreyhiaaeiemriccjitmcozpbalwahktfauxmnvslwzzfhmzciilfuqwkmcxibppkqxpyxgralkzqyuhsjltwjcchqsnprwfrufcevukhklnykoldypkzzzamtuhecmjwurwwqivfbvardljynccsvuejnzzxeqcjxazhdsrtenoijymgfnlnkspfbldoyyiigelttuklbowyqrtfqdtjbhoidganqibheyzimfkbrgehppkdlmwpzeouyxptetfggpvdbmbgmrgfwzbairtbzdclbdjnvmjfaprezobucoozqlppqfexkouetnlhyezazxqblittfqdjhqddemzfugrsjkbnzkgrnrkiqkrtcqjtanpylkogornnrsffgoiuhykkpactyyfdisisactabnjvsnuykoinlvfahfhwcquagpmzvtezuijoqmiixvyassdmwoayfyezjftqnohgonclkiybcigqzubszjfhlckcmvdjujreqhwjgzhywtoslbx\nozopccjbzoayltqlpsaplqqhsvomduojdbphnqomzsjoyxtxuskacomhhovcriuwzphjmwkwskafebzjylxfhffvmbphmpkblpsbagdkepgwsukhncjrlpwacrtdyixceuwuskcuwdhcwqahgnrzkpjwnenwzmyljnitbibshbimhilruongnxbhwzscktovuxmgssqkkttytyhoqwbyapepqfkewelypxdhyppjmskybhddvghzodrmmptxquqiehghmimtxbastmvcaqzaysbuhhuxvphwidpwuzzeiegmizxtaycfxbmlujnmdckyggzihgorixesdzvafdgiiarkqspkavlpnrojghncytlclpbqovistbouslsuudavcflmetzgnozpjihvwoablutddadswnnmjqyqkuupwkaeqirvmateafttviacbpmjqkdnhchbmnmzlnlhjmlziikhzwzdwaxgubqxgobhgkfcasjsqzeuqhozammiwqychzlilnqllqjwgmayabkaxqhzxbbttgofaccbhfwqbzkzmzirkegfoprqdmlkrrlbynxokbqqtlcxjoughqapqcnklpsmpznlsdrpufxriowdsalfjclxrhblujxhdlklrlglqwpafnatyzxcvywhboaasycvomagqzcuvvrvjypbqsmzwovxxaafebogzangkarrbqxmfbyqaevnbrimzuabfvprlellfarjcenaovxsjfubbinrmzeyoqdndfzagiwnxgptqeuqsggdppiczrcaijlmgplpototknhdolmokmbfspoptsxmkahsbrjmkzbxwtprsndiqzsrgaqgdptkzoovonjnznahzgiscuwpnhhealsvfdjetysmkgfdqjzdxpaqtfntixyazvnmkuxjxxonspdtqevzsbuhudvqyihrisbhfnaehrksxqvjnndxywdxafedkbdgefsovbklyisboedvyszxmjjesdgqciicenkxeajwuycaehkjlcxjzbauupjfthppnstuixndwlysceqqpaycusglniolwqvfybjyxzuchpdizgetscvhzxxqirhnybglczvurslqpdpxobbqsbqhhzmcxtfhqqktnsfglvomnmvpzabvrfiepwhieofvvfllolkgclsstzdorsgmsbfukieyegbkqsnlgafnggrgocgkxxjgzmxsjiavixgitbsgakqfckoiixqeogz\ngqysmpzxuxhbzqcjrcngssbbkftjjmwxzogekehoikvdmxcmcadywpgezlixixnvxbzrxcwdhgptwiqfmldkqocbeczkezylolqembpiflzsakcwxqxdnkpgqhlibtpkyghvjnkrvxgdjysmydqdtxqzxuieoqscxojatnbyutknxvuhkyguphnhadhffbbhwlhlrwdoherhsdunaspwlblyzfuvrveevljstoqelzxmjuqvjafggcgwaldepybnzahqbwcceaapahvsypohfwsiutcukynpugzkutternuxyxlscaclbazbaifrpyuknbtskdteirbmmcfdsznwjzvpuixwqtssjhuwmtrtujfchfiarmpeklhewcookdjabiithemrxvjymjqphgradfidxbfbvjfsywcheccssivkeozadqrygpsyaxqjjeqrvisueeutmbreyjntiqzumeilrvkxfmaplzfrkvadlylbibqtnbtfhxuijunzickwuszojhaaoinbhwvjrohzhsqwijgdkhzpztczgsewlcjddnalvxjffyuiywtervnmdipjrliqpwhdsezvanxpeeawlxxokslllkaepfmkurcfrayfevibkkxyivgxpdtiuwkzbklgvcfazmpgipkuzyjwxxpexrngfaimuvtmhdwqckcyvhnqsgzyndqwcprqznybzddzdvceqrljoajwlvkrgomnawfcgyvptxeyqcpiycsigpiizdywddotkqsojpesjtmlpttiufvwgnacrmhplyvqhzswgnsbvpxwjjozvgnzbpjlcqjefiwhxmabkreocnhvwkznpdovchzjjyumoabawehenjshozmdvfgoiqhpsvksvolkzahlrxdnuszjsvhrregegdnbjkvxrktthdkjkwuqkzhusokdfkychmuvenazlsslejpqwwwhjoqu\nronyqshwxwfkkujidzcvxkvqbnfovqgubvtdgmlikgawyydqossqkochkautxvqvmwrltoqxggbjavnlihrbsoveqiezdtyngpaowmsiahkuochszclvgshytbyuqqdiwafdteqxljrivvdaxbqvmtmcfwehcovuxaesfctojvcjspgdjhvhxzdcjnnvrrtiytdljvxqpfmenzqpkgflqletaqbynuvznsxnjrieznzfmhhbhpqswhdsnpwjrvnggmgpboaiaxngqibncnskbebwjhnchgyyvbmrqiifxqluoididecilzmqyakavhebihebpxwrekwchjfhekshwnobkhufdatbxkoqvbmkscsccqjvdzsomxqywijikyqncyjunyphzdpkrlcnozlqxzmcvqfwuyghfbbuniqdsfwvifrqsmrgqcovjrfgtqtqgnenlqfxisdtmqolmmgjqavqlnrdfdjxgdzqwmoenqwjubtsdatnu\nzpuooqrpuvefaerynkuxnmqafcnqqjqwlkyweokcmnbnzwuywnmnbttfgcbaowudnmuuxnpsoufznneededavdwcqxnqxnpktafgoqunjvdzajckmblzrzjhuckcvbyxgozfdapdzyjjofmipvrwlsjfcgdwxrmdwzuxgwpgekdlqbbjcrxnnwpzmkocnywqmxdptltnvytrzgrjfkpiemndlpexjdafelhbbshcspiapolbjxpdcyxqfilraqigizvwhqohvogmajypjmuojuogsjqtbklwvqkajbdwjqrguvoancyjmbhpjhmygpscrpespqaticithnqadlkncepjrrhsjlvpotnothwysokzftfyqqfqpfpuwwwvsruizlatofazijpiobpiyfkplqlnafeunakhwrktlsuxbxwlvzznzhbtv\nraflrexsrrfcnribfrqivgdkybcvomvleeglkvbmhklxesljqjibfapjivfvtcdslmfjmqhssqbfgdoalyulrznvmhuyoxzgaakchhppretonbsfiqpqnadpwzgwxnwemgizzivhrxnqyuhssjaiepqlxxzmdfppswxrzjctbuxjpjdgijyohwlvkpmqvlgcyyuxuwnezqttnyvrxuxmrfzulsldildwlsluntcrxlshlftcovnvovlmenesezchmysfqkbxiffttqgojegdegmacumgvxqyzdwrisgsrhmawdsxcqnkepfjjcrgexpzxfzdkpufenlqfcpvoyhwjuzslrruibfwmsmzsotiqxdzwtklokgfdwnmwtfzordsdmrwvojzofaqicfnwkwwrxlzvwejzvwuthmxnxpvmjicixrormrgazfsmmxhnkykazsflxephdalafclmigyadrbutpriajuponbkngaernvfqyltdtmmocrwufotwulevfqamdhracfrmipabydxkgcjhojxpvtustzlmugtofvrjiowikgbchzlphymnyfugiccgjloryiyvfdczueeyszsddbzypawseskqsxlrlvkcpthgqkbcoxelqjlftllipiuivqpmorwiwkiuskrchehxs\nactlgkzbbmrbasrtoafnlsrjlatalhjbcodtzjwopavpzpkojogfoyxfiavygpsvqtbclkvaiswmszhbecpbynghmuzzyqqhpwfijjfwzuteqsionyuomrgzfkhapwdoipgwnzelthpuqhmkbmglfbwikmbyuspfmcmakigpdzzmlkeazishhvxdidmsoamvrrjkskbjznkdzfhnfeexufxqnlthglbdjvsjapajlsjkaivcceobarchkmicwrsvnaeytnzxvayvonminrignjgfuifeklvywjlztcmonxlyxibwmbfitzcqjzslzphrcjjevqftxmtjvlnaypgrzryrumyiyukfaqdgnhiokscajlnvnslmgustkimwagnvhilraqaubleaqeutqmqgpyvblpagpweujhrwntwpresbzeprwrpradmcsswplcxvzzbuxmhgyzzqwpnthicyqzhfbzqgambaqwcgafdlbsxfzxxynskvbayzbuecaabuiihrusylazgefmyxbxmtlmxnxjnxpolaiuaamxbrugmypcoankmoofrxtsuqolexzefczgyyqdnciljazxwzljzgyrfvsqpcnwezgibboqqmuvvjneptwbwdoxkqenngacqgvjlqxzaagptqwdbjhrltakcykrectmljlzkohfvdthvbdokqvgklltdazsfblenmpztvvijvfnzpkpdepxrwgblgaeuitufsrqmecshfldchtyiwtwkdvshojxztjlaiprljoznczrrecuglmdvkaufngbdhaxcqcfnxelvbzxubkrhoxzxkrpqfougxlpdelimhtaqrkzlupincexzludifmxmyqiuvauqvxgixmqvgjstcongurtfroajfcqrpegicnalmrgokbujfdyidbpelloeldjyryqkmocwwhvixarrgo\nnwfqtrqosxqzrobhskwitkpjptebwaqtorwaixbydvfyfxdexidcttwmomzrdlhzavqigwtajuvznhstslyeoazuwwcioiksyurgdlfibulcnvtyjqyosqyvpbzedkyyomyjnnluljrrzelgkecysmrlxkwquqbkkzofvucxpuwizgllpubgatfeknralnlgcwghvlddwszbmcpgqwteycdvbtzclksdgisxcbwgspbausadblyxbedckmjcpgkysskchxhsftanjkldqjxzqbgvxybanexnwreifqdfqvqialsoiytgdulyfobddpnatjqjyardbfojkyzsqzkegycfrhjhptufsckxfkacwixjfjbynprxrigeftmrylegxxeqfivcorpczcdszrfnypyxzomwpazmwemoghmbmtnxvwkptcmsoroxsnpeejnhyicpkhjnavyhfdyvlquxizmkmsgnvjeqfgxscfhtqwsklqtxhtaignvgnqsvcqzfntstqepvxpesdarfkuejqwjhtebqzbjptwkqqwjhfcfaccwforkesmupnpflduzajmtdxuungcdadhqpjtulnygyiorzvmpstkucoaxrydftiwfldtnggxwcukseptpwmaffihwkemcxzalkhuhnvacjfynzvyuoolkqcdmbstknqlijkbtioatdjireouphqgnznxwqqgvtcklasuovptqrjrsjuuceiintaqwceraznbdohojtrgqxoigyrtuvmagsqdyzcfiznmpfhjeuynllrmgekzcrvhkicfrxbqusbenlxzrqgtbtbghzbrwtdywrqdwaovswqcfcubipokptbziwfgxyxtzdmdkmgbwammigcojpzrinqeztgradnnhksemtvyinfyfszxqghvjxvzglyvbahmxczyqitybdwrxcjtlumoiyvhvkctxskihgbzcvfbeojzivisgkvduagaokccbbmqazkyvrptmcetyopuloesqvuxpvobjnnnfrfeixxhattmlntunrrsurwygjjrtwobstnuxtiewtbvvzmmvpslewcgnlaqcwxkctunvxmbysdrgxwrgjeitikiuxprznklwlmzboiaevdvkkiaualcupfkucuozfeuphohvxcaegxyrzgtjwfaqfrzoofhyor\nlacwmmoyrnvyfmoesegpvislfgaqgemxkawpqubnyqewtqtckyinldrdbgapvahnrwezaxrkidiaunbxntsruirdgngfyyuifinrfhovdqrktvbmalnnfjygxzsnvuomozuypypllpshkgxyqnynigcrdni\nwkfgtjtpnyvgxxcuhkrhrwjcnrfirdoejokxzkurspsmygxrfxifyncnwgtbrydwzbjeqhdkuncuwvfsrzgispssszhjhumlcoothbznfqpfwzpgopvcdmlpvtewbcvcqdatrivlbxzmfcdlqvgagfhhfcebrbcsjdvjitlzjczkbudavwxfekjmqwvbtijpqwncsulqfuoxvtnyjfcbpswrfxkvdqkywwipubtjzcktqfmkswijjbuirzrwhhmfklhwhyflwuxtwddlwhmpxsgvuwspliodqlnoojgqgqhtczgabuilsdfptquhwpmgiaylaixnqzlqyrbqdtwjfhcfxpfdjuihpseszzmilumjdhejklrwpuvfmecppzdheygfpyffnvepgzkcdukmyffdxfhuaeflncuvfanbrztbhlnrzaqeewkusbkaijkwdqgparodcefxrdvenjiqcykukzuhkufwbubvqqyupqhorrzcjhyfphwqmthfxlsqvarxauytanxojdcsfqoidjiluhlosuwhgmgidjkuxjxotkuykewmbqiuxknlnercvolyxnlivzawzchkfhbgcwnoaljjgxpxslrqbdvizbkvhsapbbkdycjuzqbpzptougkzuwugysowppnfwfzwkiidkggbownxopgkwqxyoyvvntqllholmxjbojikdqxmoxnegaandeavfudctzaxtlgzqhijibscqyreqexqhgnmtjzvovjkuxqmpyojvrvzlufdtivfwwqtzqfpwdrefdpbkqgxqzaymluagemgoplixezleruabjhthffmorxbsaubfgaoroqglvdcvrprfuxvgxxtgxmaabrnjwonbbnaiubkhgvbjefuyxfadzxfinjdknesmnibvbsmauyodgfpqxpyprhsgsnivtvyfkmiywcyksurhempacbycnjmlvwxzpdopculalzbpcbojhpgdfevbpdywairjawvzrozchmpcxcknpsnggyupjdflnvhrovxrnkaegqesekmjcnrlpbsdwxnxabrllattoljjbdhfthlzsavtfiovuuhnbdulnkhgexmppdsdpbitjlsfrbkdcfgzhqkvqfiffcotcdksgeodapdnpenpnuzhchijxnwsirwkcfhtolybbzzuoetpvjhwmcsqadumhwzutbickyaltpwbaxitkcwranuldzxgzvagvxfhuhromtzcvgznjjfvcqkzvrnvxhjpeympornrthnzttdlxdmrgjrsosvxmalfuzdxssadoijngszjerahqfxyonpibdlrusctaztcrrmvamaohvttlswmlfwncayhcdqbtahiayxsljonybsenwchkiurghxscmbmfhckatrgwklxxqqzqtiwjcmnuvhpieiqhlajtyqrffhmmiihfmhnujpxsefyutxrzmcdqyvltqfyrxheyiecgvyshqkuydnrkxgfuvgalcpwkovmfjcrjfisjyjtkhuxuifulnuqltlxrrljqjbabbamuziypseapzcirxvvhlvyzffxxenxwpfnckwariaqxjseamitcveheovaebjoqhzjcvicrjgdnqgtmsmqhjagbccvdevhgcppmsjccgrftczjwfjcangxfavfxpmkrcgbrrcyenznqaoxbgwxygekoiyrihjqnthkcqqyjablfzrixjntlnbxaaplonnyjytdzsownnjzaejmfsbnvgasepxsjnjjrsjwjbkuazzgbwdkzhumknuvjymaljsfjdogxhlprljpuwmgbtlw\ncwqpllhocvhdlqeckciutruvrrubsvkbhlwvmovakqvnvayvvaeljggzmpgbgdxfguoxhdvvtkbvlcxqvanebhjzsrrqdodlzpvdkpfytepvrwqibhijcqirvopkdujdvdzxgbhfzjqevzdjuspwummurbmgdsfsvfwvgtapqmuwcqcdrwihpdbqgspdimcroynpklrpwqpljzwkfchkarchxqjdnezqafdsogorpmuxkecmbmtlakergwkeupgzxnsuyksrpqosfofjsbuvhurkbhfwdigriffqfakqxbxucbwbascajsoklsbnboszyyhvmvihnvlpoclupomzbaoydukieaivcdfjsankjcpykaavmgxxlzxcjkhkmkeumoreiuhoozpmlkaqxbfyfymbtknjksjaqazuplllglltwjmdaalohndiazugwoyrgcwdeogzaifaswwswpcomilxiegxthkfirrssfekpagruepffdeqhrzyxyayxhuksmloudgyewpyvimiwoxvcmpccsxviuoqgnepyoobniyvokxdnusvnqqqrpimtwwxyfrmyffqinsfhvlzmauzeeoymudaktnyqaphldqbjhqyolvdyjgvukmpeumncuqzsvcivdqtkqcnmwfpldhbfbndtypijzbzyomzwsxvdupvnqlyyurttptcagfivhrfomidtwrxmtleztkkpvagrgbahjqrdppvtizcoskrxixldixdwmdweewrucgnfijbkdpryswbiyqpvtvzsyhwcrbniouqnjwinshmfgxbsuebuualnqyhlciiliyuuzzbmfoqdjlekuiswdlfbvlnxvjdjhvjcngceffhfyeypdpyxfnsoixgrhxoluujhqgcvqsnvfcefybqedqrhgiwqzxqxnhvg\nobnwpsxaakgeqancpsjmppfjlannlzdkcriwbyacnjlqvgabsfqgbtbfgoazhnpscolnpordldkenoqqyaavwgnrjomaanayfyfwuuzwlcjhfabtwlxxlhunwuipargjstswchvjihjxecbzkiqxripuomxpvjmagvcbwhqacgxjwevqgfwhohdzmtytodurbjztwbneiapjhitzbxnnkmyisjldkkwqfdikvjpqywbiqnknderdytsqcaiueghgaozpempipyljotmfcumelcfxtuzoaiyhktcgziniglvsxpjsilnwaxynurbaetscdsqftmplnggnssomwneqgvweshbuwbmyfdisegrflujnwwtmaavfpmjqayylwqboqrkavlctzckqjjdyxwbbjtxkewauerqrexiltfhulidrwysbertmbzccapsnhjaexlncerxfgdhradwvqkthiwvfvsqlwqawlmbtfirnbngftfstxdlfichespakshitqomflnozocgcwkwidmvochzffthrnkoinvktopngdwmzfhyvmvdskrcqhzpgmdgcpbeohyxufrsvrybfgsdetplblyekheniwazjrnhevtabdpkwztluwvtuhzaynpmpwcbvagnjcgztlgillcxlppxasmopnilijzsbvtbussxawbtvksrclrycrkzgxtawwkkfaewcnndlorflkpdkvxoakzhdaljalfguwtiepmzfguggwiouippnfcmdmixxiuqbggpdbpxrjrgdrffaapjjbrkycncnipmhufmhjgqeibwvilqfvddexfohbjmrqqrflgtvztqlxibpzofxyzcscmzyfeqmcpawlxjdtkkigoyaetpmyaczprmavobnpchbnlqhemigmlkmeswtpwdikkcckunraduhwossuusdkpbguycxqahlnugkwrqsfwclowsfritqxbzfhvefuvhkrnppcnkvcalnehakdnjtrzqafcuqlpmvfyortbywyffcvtgtzvgejzfiejqgmixbdpktzdlyqdwztchbuslzkftquixrehfxgulpmdyzvkxnteixlgotaxszxffwbabuxbtcvnaucyrpcemvmdvyblyrfynfysazmqdljxjkrzgtokqenbzmurqdzcbjypdauqxhrjrcgcuoecvhvqwlspibwcxvdmpdwwthtdkjmrfyiegfhfzkehivvwccltyvwcknqyqpqxeavkqdfqkoobakmdsbrooketekhwqhaheesskxgvnyiqfrozxiixvjrngcsonhtlbntkwzzynnimmksmwopfyvusmfqveikndgtsgusfstmrxtyqatqawlaiyornhyrtuyczcgmiuicpwlydukjbrkmzpya\nwzrfwgrntuylexoyhkdxzzkfdmsglogmuzbmomfrqvszdgibzrw\nqzwsmgezqrnxprftxrgmaonfjcolnqnbubjkbydbhzdsjtoqrhpksmkfoqveqf\nmovddpikzmajddnnikodvhojygtojnmztnyujrpfvvbuonquprpgmktuibsiqxthqjupousdbnczvsunpylzysvcpqmxjppopwggcbqrzdkhgyavkpqbrmlazuepmqlxiwmfshsltjughvnlchqkmwezrtexzlichqzgahckyhzgecagsqmojatalnhciqkqlfuykcubndwgzroywkswmxxhklsjolkqcteacndkudzxwjztxcdbjfleqtsrzzbynegbsxpkyrpwoaancrzgmcwoyzgeosubsubdkhnhxpavlyiihnioztumowrgioclmqeeurwudlsuvuccccjzookcoekmjwxacqtjhftccxixkuarpqrlsmuzflxdtckqyibpjaxzyjdakuexklgzrniwkyrvmjzufdtslnokbaorllqawgymwdlplcggolhkzvwribnrwlqotfuxagsiwdqsduijqoeaapvzoucfhcxtngrdsjumhxcuidmgorzfrutyzgzrbjlqfvthfrnzjbmqlgvt\nojggnnlbpdllvaazsbxffqtruknaolafrejlwbdolbgrmjifgnaqpwzghwytomijzbfudqoxmevjkajjvbcklcwkrsvifvetmqrhkplcejoithntpoftelgufhkcpucoicbtkryfrygjcsabtlhgyotgoqijwgjkilszqzgudbyiehhptczrqlospcutopwkwqfxdsufvxkqtdfzxffvabqqjwdxqjdwfugghbkiqcdjtiwculjnufeohuxphovvjgdcfzztlnnncbferoctfinwbamlzsmlchpnpdao\nxvuvvrjjftrxpvdfhmniudunshnrpjbtpsmnowvvbavohmnxnvjkjhgiwgcgkopfuufsipamdqhjzlxwvxrymavczvwotxqrgmfctdafwyqgszwvytxyxpnlecefduvqoiadhifvtqtvgkslbisqzrgtmtuhnzbuoffrbnilhegxydjdrjcdzwjvkpznmqcdcqwrhvptmhysabtmlwjgsgqhlzywlzcrrdvewqkbnszlsgsvqydjnmjbojbamaowghcskuhxngvgxtddsfqsazyqqeobajcocznvyiwkdqgfyxjjyvkuoapdvfbugonbgdiwglpzgiqxxkarhohnpcazkospbjlzwihhcgsihcsavajnmllfydjagcmujzxaydrohgzzxvshmcooworgvzowcvreqvlpdesajfwehyjyvdnuqbzllzkjhkprmlbtpkirzrcyopgncmqbxbutdqbniomprafxrujavvbtijxtwqdwjjnehyycivwjcjohiybzowavcrgmwpjhvtkwneogwszvpskdremehyutztbgvpshjcdrkpennuzplqiwtncsnawigmoqwrfwinhocdftjnqahpbfeqrllxvaktmevkxcgwrhmxpghfsfmgrxjdxzqfplwsoqpeiwfihyvkjcwkhulcekidvztcbxpswhcgwmtbgemsibthcrrlogbhbqwhzgtolucjhqnsiymmeahmbhrwvpxiwvqimojwxbetpdvazkqkiapfombqfbhgpextahkgoefpvezzhsbnavcvdwkzqasvltfgsrzrqfhmxgnuyniwizknclsqjobmvubunsfsbeqemokrqfjdkrghqqvlufoyjvmxdmhasgvrcvihsydthtkbwbsfvttiexccdckfjigeswdvsgrsrfmoayibevvapmheffghveeysuvipusxftfbnrnnzycxuuoygvkyhmjwsiryyklhzosxdwncojjicljyucicjnrptultnwrtmvutwijyrelvnexaynbnnfxzhcybyuzxaqszuclahbhejvduzenfriishkscnyjjdbkxnpelizughiaqyzlefhotytwymlueailqttiejnaelihggfyukjftkplpeuqxkiqvjmfzlwyvcyrmpcemlzcqkmsrpskxxehhpvzgwisjckrouqyzqdzvnouqkpguujsqqiqvapmiyivcqgwakjrfalitzzkrxsgkjdfqvjlistarpoprzjbgqcpvfbkdeqqzertppsolwnegmtnbltsxbebeayrgrgktpiubpekjcotchrpgwljpqyrzzlvaqzyorpthpbkiueadusckaphyfysvmaagbehwbwygxrimpcotqvtrqfrcuopyurkfcnzbnbpwnawnupdntifmythcvdhjhwcubwtjajuor\nrijxhesaazpkqjgtjwubdxbagxualojnxgvurqnbpiybjqdmyqpwscgtrolsdqbdfekazirlwkddrrafaslhylrjltxcycjzgcyuefsvlaucjpxisyrlvaxdokqlcjrfdixdljkthszmkfgumnonvzmplzerpjogxxtnndftvjyyzhszrorfneonolhuqgqxmcfkzyxndmkfyizpdxyvtpageptqajcvzizccuxspzdgmchnxloymoflnbrtkvxwkvcovwdhgkmuneqlirrcjcjagszkjibettfswvqufknachwzoltzdwtdadcsjbopruya\ndsjgmfjhbfiizgixxvwrhrvyzrlrgfdgeqhwheidhvjgootundwwsojvagsmponxnyizcignnpnvjtubmldfstaiewwrpfhevwqhdynhavkvrlwylxdxylnusbbwgylqbfcskuzapjqvaadkfnrqjcdkzylxshhawlkbgtgieflqcbuwdcnzgfmhyhhhkzyzwrqigzpqkbxadmxrimothqqaqoeadcisdzrmcpoauflwkmeauumzdstxzjpxiqijyccrvxhxyzbqfqmatpjgcfsnlxstdzmtsikocblwnxptwaliolarzdhqhqfnabefbjpsxhrkcqpdrwkgcgdzzmmrirrkwejielhyzjpwzgcfrnfjjepsyfwmevjecgbnymepbmjyvqwswsklhjszngkeakmuzwknxdiwdoahgplnonqizawvcuecloakxcnns\nogiuqczfjdvxztrlmtmlywrdhl\nnlzdqolicduhwenawzbbmggiaadjprpsoxwhvqgiptporxqwqfkdikhupazskypphqlheqdhtfnddvgkvbmivtdzsaxkgygvuzjxhrmtqqmscxiahhaheleikytagzeicxlgiokdriwsrhvmwuukkmbpiaaxijmomdsvnxufefueolcplgxcxnihoalpekoxqgtchiewelkmnaosiifkstlftixosfbgdwtfkruvhvnbesazayscxazvdxfjondoxrrkprbzerbixrzfyqqhbaxzasltoblmcnvcrcrcrzkbykbnalrzmvfogfcjybyggfyfmwbcagliphlrivylkhnrjwiyvtlovflfwoanrrbrjrngcpeqjykpnqmcjozlpvdsfzvleygdewazqvgmxqyvexwrxxmmixxfrxrwylggtqccvdckmzaxulliivjusvjkhyphbjykrmucmchxgbfbklkemuapmotriuyroiqggclenyelqawoszvffiajwfecyxmfdihvaupwjzcgijqzjbfahpvmgbimyjqddnqjgtxkujgdsvyocwmvwfcpmksgsarbmscaherrwxsrcepykqzrroclmqdnassquyeldmcozybjmouaokatakpvkgwbedwdqhbktrgammnmkgtumaitrxwcmgmsyzivmxsvzhsyzbduwslfzyaiwfncvgspflhjnstylqzglmfrqqmgmvhlpphevtgphucbxjnaxkdouxwyzsaxxlidkqofghfdjkbxtrvyhsanpyxyhlcmxgcixvvgblbtcbfgtfkixefkieevcapsovguwandtbbzegqtzedcassnfxnaapjgofwennprnfdtxtyubbxqemufzdjaxujdxfzphpqqqegdxmecjzblefwdbrynrpvjgpurgfsysidvcathmvxxzrjpxkjmknztljuxdeklplwythfwiqmgfsmzesbyh\nigthygbwygoignxhrmkeozmwsiwhflhqpaldvgwxbphjlrgttpihixabshhramidtkpmooartszokctzkyvysejgbrjudxppxwaadjigdutklrymkitfpkscxlazdhedxfpnbjuwqcxunkdmsumeqskofjubdlzwdmhdvdddomfclouhfuvuxktuonngfpadqvvdiitjaoisgcdyimabdoaojarwmauqyspynopwshegniojkjubcgrnzpkznwnnuioatnxlzpiouzqjholpbpqbptlkfeapndiptwrlzkcsqphmsfyiyxhqiwmkftwaypdrgqjhjazobjiizndyqtoldcxreprsegxilmqxckvzmusoizypwucoqzarfziqfhmjgcudhpugzsdccddnchrgmxdquwmqepaleekurdhwjcvkaeysqegfrcmlsmoedqzgyofxeukzfbdglzcvvugnljzffyjxlsdgfvpxfgmetpcxycjllunjvhndyttwojxqkdgoempxgfuajulevmdlmzobfrdpflpcamw\nyekwcwwdoxhaywejyjgrurnyjgpaosbxrkdikcosgmrcfzqawqrdrmrhvknxqglbaxcpyxwsbqeijwyxgipxlsnzilzjdggogsddxoqxmttixvyvpjsiqvtimrnjlsjelxmsesutwcwvarzszbsccmxmkctlsgytgpqpsyklnxuzrbzmrpfjhcpgngetffvbfminwyslvxzbmcvlmxobkkrsanvyzwkbvtsgsblthridmuzpmppdamslcwiccqvislfahorybydfthztnixaukkdkiiiwtkbtcddvntyiqnglagvwbjyjsywxwxqqrxsjlwgwpuvbvpekcolvstnpqbbawbyurpzfjayhuyawfqtmqotraxtkwlumqmtboulugfdnprmpkxksctunyolnkmqvhvxqyjjgtkvlhkveouljgzicucfakvneeqaaizymxbuqicfvammgahxpzwzqarvosuwmrswaqbomshbtnnilkgbnlywodcjmpgehnwthdxknqutgmknbkvafrxrrontlpkxwntzhgjtiljxvhjqtutdogjcgmghcemtxohqlyetxiebqkdlicazkagbyjrkqawcxglyosdixinijynsfezxiiktnnsyfrieqgrnouxtbpevdavabhejhgraqtzxkfowuffjovboexlwdlmjryxnaxygvsaodkyhwjckizrvbvijhiuevuhqoaflqfmmeulnhcrdlrqpicswddcrsprcsuhcywjfcmzwbbtplswowzxcukgshtabrnpmcyyberegghxvzmndreanwqxcdlpsivbrbayuuwgulljdaovinjszoqgxhaslqulbqklowxjiefxrrzwjtizlpqcbmjnnzwpwhjnprqjuqzjgzambypbjyvgdfmziipxblnmbfqsfvfuxgbjgfcpmmbwryzuqwvestoizdumsfdyjnsywxksnozrtggwoaayhutkgxymxuznueknyykkbdsbibvnmtkatewonrtqsildamutiibsylgzusehkpwqsttkyzsswuxmfxgzeffeglunwzpkvxhvzfoserdgpznvzkfbvixmlmzhegciyzvrtaobjuhqdzdasgspifhcdzkdizjgwinprlogjxtiejriwxdbpuwigbziblfonsmntsmajpvylxvfxqhrerjooxssfepsfaaudmfcfewrybywhjfwdmqaesovreqsedcslmqwhfdhnqprrfjkwawclvwmnmaymagohjziffyxhxmmymnbxr\nhjngjvepaoanmvspnwfizbuqfhbedqqcdsqtpmjsyapmsniqxlufodykbmjtatcmejlaxcgwoucdszuvgkkcqljuuprliuzfwaftytlmeamdqhjrgtsoyexffngbjpjerrtjzonapdmlwycopkyjaehzvnmtrfegjfcnsnuyjnflottliyhwdjmpomirmtwhyeuhiojewkwuzbjzgvbdxmzsgaycjdyqnqfkjmsagrgfnivulldxntvmlvdvaxguqqegbcyexlsaukqyslyhdyayfpnkrerjruliwuisgwdzsmdczkorxmgxacfcakvhepnhgwbwmmjvfiqhiocwfdslywikdfextzjrpwwubyjxnsuozhapfsytkvmysxzuwgwfjyklecascnjqyiragftvqrmztfvhltdjwuuiditomaonjppqhqmakaakxscrecdiuowssjpzcbxrpsnokmuhwrlvsikqhckfmbltfnttispvyluomzkysrnwtvsudhjncwuviyipxhzcjvxwdlukkbheyhagcxysqselzvproctepphrxhbxwlsachzxmjsagtaqugddxqyysrfcqatqxjxlkekprvlzmfzhyektgs\nlcfgcwyvmhyxswacpfdabcrgazxhuwswnljcurthqbfivhjqskjawyqyvapjayyazjuscwxuacppm\nvngumvpbpicqrjpshtqfvzwdqdmgwskejmrodandusjdxydrrcynswlnnckjoyozffkewtngxrkrxgthkkwwpkqbbwwxvdaknjxetvvicanxeakqxuscgslrariyzwnbymewwmbjxckeywpecthuzflrsmxhsuucycdcmvehimtcpzgxxmwybdfpvjaouznvyaluozlqjazsulpnjhndjhtbczonjkfrqzikwvnywplmmdprilrhjckwcvnrhhxcqxxuwwqjnnyafgvhzzafllaudsgnddbvlwbqgufcwfcctvfykibnodsrhnbcuwtsprfdxevdvtlivvkppptyiftosggtvbmajmxfdmwqewsatkjidrqyfyvfpergilbvxuziquzpodabtnkbqddpibhikzvnjrhjhgbivpwssltjrnemtpjhjrondmoovqrquvnzjuxpmtetglidssksfqwtjnuyrcrxugljohdgktqmgbwrronewbtqkfkfsqdqbopouaiwvmkwvhvlzhthahfcpfjpicqskgppyuurxauvyfonsiisuxzqlvdgvpraeorkqozfuzehinlekibfmidcpzdyxluomrmroqiqucpkdumiycvusxtqpomwqtoesfxxwryaocatpemfclcdpniqxyohgqewuqpvjugvzwojjyubohmezypgdifbjsgkuoummsalpfvmxantzcmfedadlpgtzcjbkdwlfaaokvibjokrpcjuvqtqrketseccfocmmyveeeagamniniadloplnakxjhbndsntdamqkobzyaaupnrtyxrdygnphfffowbzpjfmkkdyphambwguqvgindpxpzuaqaveqpvqmclbmgqigmlhpsbomoyevwfuofkruxnyniirjmacibadjpirnbzaxrrzkggfisdiqwqwvbzjvrlpuyxnrvrcwloteoazcpgmhtmpygssipgaawjwypnjntfutsvyddjyunrrkyrbgjluuyxfuatzflyfkpryujalitswcwkxdoieriuecfpnccmyfgjgsowrftjqaruunxyjgwmwwpsmismaorogrgjilcwjeximkjyjjrrqmthrlbackxudvuokepstjfhlydrpukhkdpzdbmvajdtzyugvfhcnfxwbyrdzurwmtsisewycfmqxguvxxbpfawpsjekxaksszdbryrtltxmobcwmaszmnmkczwffsmvkrxjunvtohzoyvizcsfhgpqyvgmpoypljznqprrhhdtnqhrvpxwpuwfkfrihsuqgjoummbxdbcgraucbmoaimsodnsnjygufgepqpwwegkhsgagalxufgwqrxjexqvajkhfjgrtsojihzlxqyapavipshvuljkzrxmzufgzkriyvxwcrzgiozicgtcqqbtlvblhmkhfffmsgijsuyiwftstnnesaootfgywxwbitmdpbeyosbuegonkxyehhdllokwxbjdjvaxaftczmsuxqyvittjmjdfafdcxtrsaxuyaeydwccbwziowkacajmueprmdycmkgobuzfjajlrlkxxkfsatvnukspswmabzjdqesbflixwlcqziwvchdsynkhdncjvbkkzbeihibigdvyynmpnehzlfbjruwlgbarhcclceiemkydadrqikskfztdmepvmuskmqqkwoqvlhmgmlpuikjxypqlklcrvvsxvkxrpbsbzellwbaxtoimjkdyihdxhjrgvvavyujwmkicglzdxrspuqlhjnfemuuajmvoxsjyavbgzmozeq\nwlqzoayvufrrdzwutgbgykafqtnxtbimlulxqswmtnnrvuydsuwwshnrfagdovulnwoclgbyllrrinkyqoligjptorrjlehtc\nkqnrsvvhurmmpnzwrmaurkrkztjoihsgyeuujyrxzhjhyihgiwgcceiwympvgspajdigpodspgvbypiohashjmobnzlyayhuldzbtdiwxvgqeemwlvgkinrlpuujushfjzwjeagxasaqetoloffimzplnudeffgachzrhizmaqeswsuqnizzdfivitaqyxubxqbtxtvacgqjtvxhe\nqbrosfwiociaemvxdffmcbjzjvdfnwygcrbyzcuinsoretzalydelnedsknhpbtxrtmwhkczzykvaecqrwyrhmueewkohdkzhnapvvzoqlbpcimqaiqcsaydwjbafbqxeuxfpavpwplgyuoireiqbizvcujplzsmoskldgftigpqwaabeouhodvzfotkyrtuffmrjdifognrjkocalwjhdfzblxyydvuigfatjninyyqpfnlzpspawmspzoriyvchiyfvjlquljujtskdljgtfdxzegwlandwhoizlwnnhizwuzawjtlzgzamjwgpdbebvuwjnvposaqadmqwxhsmbhfutadmaepyyrnztguzutobuozvgapjnyjmhzaaqvvumbwqwrwyqwvvadszoucnqjxuommdhxvmqaqmqrlmelamtqxqnnymunsplzjclbrsvxrhfpvhaxentcgbdbdlcyyllfaqnrlzlomfonmihlfgtaoansfrfrnvvkobplodacoyclrzcgxutpecqfuvljzdadjsxhmivkbxpqfvvznnrcokmpdcgvmnmkitjgnaqtgzjokkkfnmicvsvjyeemqrvmjwcaxhfuoqhwtzabdnoakunjrenpbziemvvnjndozrxkxifhxjrotzvuuiyjfkvxjwhdrukwhursiqpikuynrzuzukqemxuwfchcslbmntordzqbmlqrztoneofxbuwpupclxikxumgykwtbesxkvpbflmhtzyljicvmkmhudtxfyxprholdjupdjyhtlfgeiclwumlabksmownwvhqrmefuogveddrtztzumuiioltyszgtrtsazhvinubdrmowtxhrkiwlobhtxituoonplzrddvmjckkqzqfubfqekciuybpuqefeijckopmtjqbickmaameizjiqrmvzadvlhnxydircnwlmcytsdrwfbtcizcibpnyddwssrgamwlptedbnjtbqnoafjbixtdntmktzuvykekrl\nnupxutjmiscrndidhauxoenlnzjdhvbxxurrsrcmqjklgobmlxnietgfmtitcubuhdzpnngsnxliqchkntgsqknilggmzxwvntladditzqivtueznxpydxqnsiekwcdrnyidcqojzhefxgayrytaeyqrjuvvwnlpjuzrywvojlwicivspfkordsuhrlzuivxacemoalnbipohqwqlnlxtchegbbxcfjhsnxiqolnfssdsuiuevjtwwqgkcscvscdabvvzehlrrwaoggqkifycgbxzbfhjnwipekpklayndfdkepqtpoqvydycitqaahatbhknzpoyikmaffuviouteypjhfhmbwlektykwvhmerjyiaampmdwlxamxelzwammxfdiftkirgnnltsoaqzupoxqkbfluizxbkdoirybhkomamsxsludysqtgdedgjxruvasvylremmpcyuihzgmvqxroikdevlqmrszvsscpwjdtanmjjtheaygxhnqmgnzeylxofywzowcvfapzucltlzgjjlvppucelwyxwpnmvcsfewwafidzbywajyshmdnhrmozsyqivspjxdbsfwkqzfjssibwonwdpznhruouvmhrjvkdofhdtyplznfqgopquyfzdbncbmyaatfqnvygwflobrdirgqnzsicxpeqbvtcbwbfjuqfrxroienvawrknvpjtjrtagcgijuklyipddljrnglnvztfkwswwolpnkksmfrmukgjblzhlgwbscropurmvxgmdusodptpvjwtgddndbyqffxmhizzrqzrfwpvawrxwduuvmtixnmkahbezycgukatnsviqpjblwhaambvlkfipibbdeyekhsuqexnqtrwccykksubcexruojkkncdoyjjhgfnjbbuaqkytxchdpaxfibcxabpdmttanbpckwkuewpudnqhjoytbunwvinnbrhkciadgbxhdneyrsuwnflhbngfzlnrjfaoxgcosgqjy\nufauigzslutcdfmcoqozjajvzxkxysnkqezxbflakczrpbqnjayedsgmrimuywfxiupjgjltjylgoctmjqgayfidicexbbztlxawowxrwupmnxljtbsvpahaxawvnhsqsqxosczpfdtyvswwatzavmmoyislvexrmliobtxvykzmlnqllahexcnncokxrimbovvhvrkrbtveezoustfvambekskxjboutpcdtxyqjjasktswcnftvgqfpxhkqspyaprgwqxggairilxccxvkzbxaentapizroimfrprcfrszuuoblouiqeguqarxcmufkyzuhygadjradlrjsqgtlxpvovcupgsfqkcjzlykgujpzkiccfmhihbuflktvitmpdwvajrxqjwhbckjgeiynxhxigprilnoeetellbnpbrckwolworuxdvqhnkwxgybwflmfgqsfajuqksbhpnbnzqavgyawnhayiamghphzhmmcntezkmqkwkdnurgnjsrjjcfnkaplznowgndloliztbveuaoodtmeyjhtdctuuwqdzevxlffctpsdgxwzpeelhjejtglaobyjempykkxfnwlapuhjodnpttkmdfhfasfnqfipebrsncnwmvjvlqiffhhzdgjqbzgectwwbsbkldmticaiadpukpmdbdjwsksblepefqlmcdqwdjhcmhazwawyedervtmvrlxzzjwnfwstjzsegrkdaerzulkhpflksezeunamhdypbqspejzhcjxtbblrvakdsqdjtkjtsomlaxcetwsewrhzbmlnrbirdurdppcqqxtpyfxadctjqtlgjwxmkpwfncufcupspcfmsyhdxfwkvhfjabpjcqyvkmhykbnbhvsejmvyebsmjfabgmfpucsnyjqnydeyirvgbfyfwvzikwanvngdfyfttelcxyayvdbyhlkhwvvfhilgbxzebzvxrjhwbeokrnevwdlqsecivzoihqejunuiyzcmhjujjocggvihjhlsidewflxulphmmsgxalsqtunyrvxxacpijcvlfetcvtlcwevvwqvyuhniywwiphcafvtqavadjjskbjsmykbhylzfqygftcwtcdqcjgudwfzipnoouqkcniewgtaejdxnksieqzpfspnlnwlzjqfmlgenbtjsloimapihpfqulpvmkyfimqtapxldnhbxqhahjszzrriuelznggchjwypfgptqvuynlzxitrzsn\npudqgagldjueehlfuphqimupmqeqqaufakomyarcahqxkmuubjcbclcayfrjdvogxwgztravclcjlrtebmsqvntlivrapolplsbqaofzcmauqwohbznlqztiavapzkdlfwlvqlahthsufcpfjtpeoyujbqdjmlwkosookzappezzjqijguqlnrmlifxynqhmniusrpetyeznuemiebhlgqtvqiwctaelvmnvahcmxvwgstsdpxtimvwryjfgafcuzmehodzwyykbfzclyycmsjhznenbjkgxnwznhyrdekhlkjxneplolryccrvndtikihitkbafwhqmlebyelsdqdfatmyklfewbijosrclfgqccwujzyrlegydxgygchcdryccelrayrtgvmihhaewfbdrkwojppwozbhbbxnwahmujcnymwplikgfnbskfskzsromsdypqvvuyvwymlcmukgvwregiwketlppeirrwzghmktbanhfyvdzlecvdklcpsgyyxgxpwrhpihslnpcnymvgdetnntvpkgydkbykxmgihxgqwowqupnehwldfwmbipqbaonompbznnrkzgwuzjsphcnqdyrijjifwrzutycdmptbqlseyyfuoyndqvifrmgimordocaoghsbhdotqfjiazezgpyvfowbdtokoxlvthdzmkonvownvvyluihtcxqpihrdrunnlumjnwjldumlialavlbwqrvhxpfvzsjjmifuceikmhklicgatgnvadcunluubxbqubfhwvrtbuscdfeahswapjhyrucrihffwknxmnotufkeqnbnlwjmvfwczihoatsvhxhbrjbpxizpeunuqoxkkbnxbzmehakcxxzzbfwatptaxlouxshfpjfmejckkczvrvoucvwynszdxusyinaobbxopsdkfoeduhuklbqmfmpzbpkxscribpjszfllgqwfwylofoiadcjrcjbpkzpgyvbdgiidtyrqecdgtkyngkyshobtwfqrqvrncojfrwhtqslfnwdlyvcrjigswgqcxkcbfallxawdpooyftnmldhewfnzhkxzimqxnkagjcyiygyobdoedacegkqjmjunamhucmmnrglzjwxkrcjkbwwbwtzvsdxjpbwqqmdlnvhanqvszsycxzthdilosykcomielefjcfmgbodvjhoxsrphzaahakivmypdhdnpcsctzkdernnonxihhbubcjuxflntfweodqjaixbmbavbtvkxipeixkafbkvtqrwzqxwylzspbtzskawlyevvohgpfbpdhbnbmtidiifdjepeijjowgtxpmhgbtlwomajlspebwgirxpoxoxqfqsrzbfnjkfigknulrxvtvlukauandgwrhgofcijfhswtpsrrzndttaqntaisuokfbrvfpxpmfkjpdgjtohimetgccpdgpcdmnirgycywsnwojtjtjrviwidvxejnfhssjkmxsthifjcbprtjoihdanmgczjtqpchvlvcnddfwefqmvkcjgqzyceymtetuyswxvflhivmsjqbhwwhwpxztbolfapagyiejprzdbznvxzxgufspgkxeshtaatbqitmojupraiqedezplqnhxkptdmlckyamanwuzbqjlhzezwdcjseqfzvoyoezirdeoxiqwflxljkqpuyrvdchmswmutwxfqhxrpadwtqcotvxqzxrrblbwweaqwornertvgxbvwxisjwvoigfrtzsmunmjxmjmvgufzljkyzyowhhfrxrunzasvnhxglcjgulmgqesunoaoetewlcsqvbecrhgeggqkrydoarphpdegiinjlceneftcgwdodgtnlrovyvjkgqlkumzrwrexbvrbtueehizwaejaioisfxmvtqgapjyredy\nklpxfwzlalqfclqqwexmpcmcycfyguxcvnlzwsibchljwomfayogwpofftntisnmpzftaekcffsrbvxzkhfezrocjubinuinrbnpjdpdilrgoghjcioavjlltihsdecopkhokjzrlaljcrurgvnvevppzwfaaspwkxjdurirfkdxhkrnzdcthsmickcrpnbhrinwjyxmqhtpffiocgibhkpptkoohzsmkhkyouuddbfdninncesjkvqbiczoxdejgubzejzjhaagimlguwvgvrhdwweqnltdwjqspyucguadovclqmjvvubekzdezufugrzfcoatrsnpurodwhtmodgbyqkvnwufludnklpryowhxugerdpajmehzdwblprfuhefbqdtwppudmvxwntptsoeohzbtorwzygcvfjumagvdjhjjfawipkxjosbxwgzcyqnrmmbwxeeubcrtzwtayngocvzlvisefktsnsnvclwkncgfnfpwblzyzstnumkypqfxodoupgegnxrzxbvjswdghawchyhfjfzrpuvnehhrrovacloqgdhzbbqzhcuifvwaczwfemexiycxrqpwpwjffwxviigtqdbcbgvzfkuakxjwaogdifnmuboupxxgttdgotxzxfyzpdmyyparlxgitenwpktqovtzentrwhzvpbfzjxhhtbelogjyshxakugpnprqyzmntpjklrcgmicvfdnrjivoasbjfprrjwpdlpfkqgxqsdvycjjqsdqtruiqcrqbpphjfmjtsdvuhlgylfhdazxswkmgspqxukfrccbsmjlvppqdrnomztpzhwliocolsvahwzezgrzjtgyavbabfnjkbjxtrdhpbcnlnkshjskzybxejcqaqjowsvlfprwygvdvbfepnxsfsehegzbpeprwsyethbybfltncvlzrfsketvyeyaqjalzdbdrfwqeauzhzquejgolkmutjbyxjgectexsxrjqnusrvomxxcryeizvdcikrprlgvyxllaqidizimyokgaocwvwajro\ncjoibxgrjvmagpdnofgrswgyqnmxbqknavupkbopptfiswwqdvkykoqhiqygtnrvhoajbcdinksweulbznkovektaloovhtbhpfpkweckyjjhdeyohdhfdqfpqagbsctupptdaiqosuxqnepdtpnvxmqzorsqidpshwtdfmvtrsoczavcwtwdcfkyrwawprdpvajshgzuxuiaxucflgafxqvnvxudbtztqploegyrlbfvafnrwaxatgvbvxcgtxquijschwordgvtvpyehwlyfkiesvdegfgwfzfpighsxjvkvdakryfbmghysduojhhdwuabkwawymrdrcvewvhwisbpgvbmotvwcluoahtgpsiwgizupagtxaaiysjmozqmxavybqfmncpbzonnnbxaevlglngwajtlwgjdumcwnkglyfoplnowlaownjmidvtjbdaexxvvjtdcgbokchbmjgrxtzdsyvuvxlqmtfoxnghnjzwjlpiyjlwfkvhwvahrgqtrsxskizjkhhmurslieptsxbruufqjvtvjryjhavljnikwmxjebrtqfmfikjppjorpmveugmwhwjevdkqsekihgxgovicykdzhamxalpeaycmjkweimidajubwqkfzqrfpqnllsvzfngundffgigjwwsewmmewmhzyzgujemfaebaxtefyjlourunbsxprkbrcmdmjdjifbsyjfgambsuklgwqjgjknonxhilrkjwllctadxkgqppexhlzydiycxnafrvatyhsqcbitsttwizluczuhwhmkyeevemedkzwsgungbdgjelrpxoypndwcvrgsdmbshttbuuoizpvuimaoznrugmkfvoropigfefidsfpevjgmlqtdmqbqpocwuiydfqphpcsnmfjpivcprsyddeekcydweruviomrejbsewqyuvrmtcqmblfhvjtlzjacyqowogzcpzqujzbjdwfhqrnaulyukmzxwyekpbmgweowktcwasvhtvwoudtqjqjuqqncahrqemyxkbjxdirukjsturtoloikeszrsmtknfdlkyfkqrvmoczhphwtpummcqqsjbkagsvnmomokrqwwoignlmokxsjxjwaqoaqregnvgabvfuurehxkjtqmwxgxfdqeabzcvxrecdugyjtxqqerbfkndvqqttvidczjmyirdwoswgkaakxltcpdoeudiaiurxizrbfuqcrnrdziqgqlcavofgppbqowwmoumvuknjvmpssdekqnczngyofcvzbjdkakuovqbbioomnpfsplljkmcifvuvyyygradizacyyfmjqjrxyllcrzjelwtkgaowaxboctwoeuftwwtblxqtnstxtebampfymxkyxiwewugrxnrsftibytfqicosvvcmrbyjjamnxxrtysgefuzevnbjvqvrwepkzwwlzhwtppqejfokqpwagyekwfqnwqgmxitoelimsrdeyvthfzqwqhdgmmvyhbkqrjdtnkizngybuzotxwxovlsdleurspckcspafiduxdzecwpkn\nqwyqczozsajykynwnoifbhiuivcfxafzpmqfbgbrlvkixyfitpbizfijemiemcmicruqkbdruyaoprzpzvyqfooulgxxxqxevivctjvcrswdsuxlzhbkydauqwdrkydaizlqwedyloygutuecpxg\nwbzkrnfnfffiilcrqcuoaojbimfqhtevbudjketcguzfjqropezaqxaheifmunfxdaxvszwhvtjyzhmrigtywtmiryhswdqzqqcbynafgfgalprihovvjrygpzblduetmfqwbvogclbndzvagrklevgevybxemlwakbokoxlhbqxdclpmyyhejbajphynuftbpkeletwvivotbjnqkrzuvonplfjfdwoovmyakhuwjvwmrvoooszfjkaskxnsoshtwiwvnefpxdwooccadansktcyleyeyfmsilcvahrzdaczvrfjcszovhyiyvxokdrjixgxygvuxgpexfxzjtxinzeagzmihujwpokpwjtwuenijouanppummpewspnvshibfuzzzilcxfjcaxazovizjilfqgvtyhvmbdtybaeoljbtxkqunoxvifpyehmjrkhhfvusfqogqpezterllmvjkrczfajhyiqanfktwmmhnqgxyeidwcewvkvxofwwptxmfuhszsdwpwfocculvvlucknmmcbvczsiviooogaogarovmoznbyucbzvtkfqqynnvheasuyijwgavtjcicruzqykrxybaotufmtvkpcezzczmocmvrlxcjnktjqbdsdeuelwkxnvibjqsjcrbplndvruqccwtgpofnaolxzrnqiwhvdkyqbvxhxmmuidmhjkrcezfnsalqczwejipfpgtvumabxxwaozmxdgxexpopleocrygyredgazjfbzbdqgnmfowakldkhpaterkxkcelrzfvecrkvoudmeovxdptppatrvyiiczjptmjjnimmigqcruqjmgwncyoqnkxbxqttuxkoleabheppuqdumhaflhjjobkgrirmlrkiyfssaoshozzyhytzbkokmbwdnmsizfenfalcalwcdgngneqctlglxtpdkqevnutfcodfgjjbyqhlhmkdafwesqocnozhucxtjmqpcnqnppovzwxymdafaleghvjlzdfbnaubnuavrrxohpuxijubngdgzyefiidbdwtiayvfoudwhfxarkanzfngeuolaivunrheaqrdnarbsvxeutczzwibowhgcxskfuuburuqlrbwkykgnwvlbngbcsnsxsevcgjznjcekyimqqkssilcumowzgzawyxiezqxofmxhkenaevgfqbefemjgbzyunxjilgjhoisqyqrfhxegixjjeqcesxcwsmtjioftwwteesjopergyakjxtlgdjjampeyqkctncrvirnwfuhdbexbznjxhzinjboqv\nuccwocbetqsqkkobkgexybtzbkuwuozkclgcwaqrmrgajlksqgveovdpzsolsjcoirgwmeateiwmugljdabecyuapglazrszcvdkelwocnoqepabkqfmfzrryvrprdedpydsfdchahnoiwarvlbyhtcssajiidrkjdajrvkygtkejittmirjehjgsckxlhqezybxqznqtqjevmwmwsxncwxzgkhtwwnthwruhbsudvvkyrhjhyjmlfrxqiwsxzudremwsmrruxoeifbxcgjintkthxrnnuagunrpnnnyvnlhavvtvzprsssbdiasqzqaqqdbqkwpyyvxryxbqoxyenmuuuaqspnzzoaqwtfvjhqeotzmwsbytnpwyorhmmdsimabarvwxahmhlukpzqltppmsxlbqrdpsgawmvofcgjhxirbjhtepodutwsftvyddtqvmvlknoqxopbtbehdcjjqrxrqbtelliscxaheqfjsecpkdykaopsaqtssqoaooyizpcvsvejjambepkbtzshebohmfvcdmsryyzvytfokqzvhkgiquheiiawgcbgogblfptdharvvkskfwhxnpofglgqkminclmpwerotjkakkqvkacqsyqxpntkupfdjroebvzfrkpmtfqxhcwuqrnkpwvzcvwiwihlfzkgfrwsyknaeyyxddjmwkoncviuxoouibqoafcadlpknhzzhjwjywvycpxcxwdfksmqrekjkujnopcxwzdojwmbuhbzkaumdbjqpudhwjxtrrssovoxhomddslzvainljgdpicntdpsbpbytrgzebuqryzwosqegzqafqvqepwnprqibemruutpapwqqcilugglcuvqsfxjfctkvbuwwrmtaykqlnhsglbtatswhjgdsckjwxokcqumvdmwqchdkcpshporvjtzobqqobjzemerppgsdkjlmrntojqrfsfvniydqcudargpkscpotjbuolhoidzeiworxcbahdcqvhebcwolfcmmapkcvfoanxbkqhxcxaweqplmyizipdcwqpztwiesaizaydxadytqnapckvispldiytibqdvclfdfzhqnvhzlkfannhaadjiciouesyaupffqydrpryglnlqcrtnkshgoezyzmcagznttxsopykfbqogisfnxwihnjjnuarcaircwgnygyafthubdfgofogcpnmdlfnnugdnlmczadtfwjwwigqlsgacnazeojbdchqikpqugyjpmveflxrhiaonqzvifwiaxjcobhledlnjgetigjvojvdgnrtxqvetzfimihwngwdqsy\nvoipnkjeojkmjfyzrgcrcegrcgkijftcuzexphktfwqxbdtuasbsuyupgdomjhyapbaqixlzgtvdcyltfpggpkrvpmkcqnblcoedptwseyzwvmvrnnmzxlbofdgrqrqcfapkyfhxzkspapplaifcijgltssndpskowvzglpwnlydttjqjfrtasfbghfvnjjnvtgoclrwfildfithhfvpakdfbszjylkeunzbizfkoerulcnjugvokywhpjymvefjhbyjzahnhnofibrbyhvjhcccwklkbnksvlsdvddchujtwftdemdjcznvatamrwee\nfntzirjivhnaxwcxbslybqbsxmtfetenrrogmxxyrmbvrhfwklaftsddipaohlekzpailbsqaowxdblelmudhdaptrclnzxhkntetanhfgorlanfnpoelznjbzouqgzkijndwbcjzsfjnacvackktmscubzlwesiqwqlwhgfuusvbardpwkbfxuauythhdhviudffgwokfiihvtqjuhyszhwymlfkpniplksqnwcojtkgqqsmagykhxffnytnctwzsmibefqougxqydsawngvyntfahwjxwvqdyknhfmbbzldwihbagastqvndltrnikttwirdjpbgjhtnpbpzgfhbylpgfizsbgzasvjilwncssckjnbhlpothajkigrusxeuyqxiyxxptpcwdoziqxfugnnfccfthuziavuhdbnhhyrhtasdfohobaxvgmfavjuczvlkpxmjvrhfevcyoykxrqftwtweddvlqjcujdgfgvewqwcqagwjuzoqyeynsxudffunvboeyrdxykmqccqxgymgvtxldvfaxnpnkbgykfeeuamlideasekbivuuimahqkxsgjzhmuvdpzdxeikwnwxrpsllyyzkwrsvrdtsgtadinpgbpcbdifkmummrwsjxvibuzoznunfcivuxrczwwwyilfxijgdnzjikzaaeywxqzhelvcttlcrtahrjkjapzjiknjduoljovgtulozwarcufqrzldsrzgdjjwtsklapusmdenxqyuqecmblegaqoxzzvzjafcyozxphbpaodtskcsfttsqfxslulxzqzgropbnpuct\nkcarqudwedtaefqtokxfpbdvkkkqbqmuqjbgcgtwhdzzicaerhinszbjtduwrddbhadszuvyvzakovninocvekgcjqiyhlxzzxouaopozvzxcicsgzfssuqkotelkcianklorfzhmwurfjxrqnsymlnscvckioszozsllcbuwgatefumgmflzbjesamgxqvkpyhhtxpiouxdxcarvlweqhhznffupscwojysdxmaufloiyzvxacdazzjoxgnuvmijncnbibqifzcmpuhrcqrfvtaqmbjikjdaakfkkuhedfjgptkivdzlpcfljsxjrncrcekzzlnjrpvjkuqirduxfntnanvzampczwfjprznbgucuaviusjmbukhcbfcqnvdviktiermaqhlvzvdgkpjrfqyxfuwccbeffrrzkwxgrscppwjudnccrkwsttbqzedcftroobxvqcclnzxrwuyauqagbazjtxtcmdsmsjejjicpzlajdwunohdylbtvtxzuwizcmzxoxweclugbseondmljcrisvroynpcqlvtzsctxgritrgeaagljomfmtiuekgsuvegdqomvvaaxpapgomrdnpqdflteuxssrbusyavjstunttulvzkjacfbxyuuebsklvytcdndlmohzesvhsdnzznxxcaicctprrbedmrecwhebzhwgrcxpzvxximropjvqschlfrxtxhczoxbrnyzrpbqvzhpnjjwuncionru\nugqqowcrjepqzobvylphbgmpjrfjseejrnbatvvfqkvkzxqjaueqaujgxxlywpjstvtduueufhnvqkfjulqrqifexlerylbnhuacylpxzchfgkohfvvuyxaeakdvvnnigfmxaeqjptyxgodgrkhpevcanlwapzhwbbbtrkhrbzqgzwztdamxlojavyaifjgmtminmvdosqffsbuvvupfdmbqhrzwdwyenvsaodkusfbigcfonqyhlqbyuubipromfevwpuoxofyagjgmuoqlmuvflfhxaiuvaakruvdnmuwlhgwufyjpfiflyomflkubycxbglxzbfvnvexyedwoplpckmsytcoabmiuyyyuyoonfwhqqwzmaddisosfjiouqtlqdxawfonpqbnvbdljlzestlkqjbjsygenejlnxgcxfdjcybiedazjutekvmyjjnqumepneijthhihdzhddcicewglaxpbnsxemvljxhqcboduxjcjususqbqtmgfurbsprcnaaehnqkehnqaixbxqxtcbewicnhwzrodwubwmsickbezqhghpoxghticusafjzalrgtjtsciywwpynvcktgezqjjxbaxpsirbdjhquxtkkjsseimatclogonfrqknltxyojeaiogeoxwbqqpvxxrmvpbgdguebkzbbgdmrfdgwpnlmqopwasrmmpgiruyqxqzvclccspdhyvkhfjntouknywohwjtbuwyneaqsiclesffsfbrrfbniqfkizhcwatikfkiwwumedjskitbnwrbwqegwdtduvxoodotwxlrmkjhwupefusmyzllrbtfllqodkvtqidqnsdhdlziifzqrkutrolsqeegxzvsmrofwgbavrcmonkuyznprslckhltssprhocndphqbcdejhkcrdsjsbvyakznflpomorspffyfyiecopfchxrcsvqhohwscdwcyphzufzhxmfsxqxafdineevhitteyhlqjvainylyqrzrtjatsewuyyxnkohbozzyrvpdrkejejppidtmesolwuqvvlkfextegnxpmmcsugtnkyoiwtghunnywssjcxbbcjwpzfxleajdildodpihizykpdpgaqanlnnvjaxhsrgevyttfetkwopithealeurrssoiueuvvynfsazpcxbulathtlbllhglzhedjntecbhrhantyehfnaxrfquodwdmcpfnwbudtzdmxwfymtpmikfyuyhpmbltisciqfpngnqmagxhfzfkbornkfttshfireclfzmjcgfkcjskqhqrckwuvijmbaixtelqmgvuewyjqvzmdsfehmofnlcsswyxcwlwxgnmedgtpazkuppnyhkxyqxyakajygfyqrhroxpdvjlkqxxbvwzzcmvmxmvkdhdctqesjbiwfutdgbwjoxqgbzzssokllhaxbbsepkjevwrusgrlnicuwonavimet\nsfumqunaadnvmzfmxixhfdjlgfgjoljlfbblpkvvhszrajjtvyixsvxevirglbbbsoupcfkntyzlqmifdkpyggtedvqdltvmalszgzmtumdlplituhjqiirfhcecjjjmleffjrpdrsonatllzbywahhfgjbljkxhlnrvgsnxhqscqedxdjylafalxrolsrlmprnfzsdkykqqbzecvqifccptswmhiiemlbyufeltczfbawgfgwfkimwngsptxxpvgwawcaoglvpqfwcsdyxrjnectujfjhgbrwghjnmdbqqfyiyzmldwjfneqnwzzsqedagyzeqoxwnngrepipldrtxmfvkglydijjeeczohmqfqofygmknmpmyqhucgrzvqpngtbngoluyurkoivldwzwogrlthpiclyqefmthvwqromhmygbhgmszbpndumprdajutwpuuscckxrymivbcldbxgbbrabcweduxhsbbexvbeprwutheyxjrimvtjpsvuzyzytnojiwfkvvprecmrhpdwcvopotcxreriaqaokbshwcfctwzppozgdrkfmejipfemnmyjbadydvaxmgfwwruzykittjngzxrzhlybtfgoccbpctyllqwoauwyhgegbyqghfiadwtaxfvvxdphqdpxcwnakyaivkjsqufcgsxptsqesgmdolcoiatummetzhwxhuviufibtomtuvmkwnriepwpuixirqyyivcrobuhdhlphnmpqhqnwndaldocjycevmbyfysvkcsfnupngicykkewspcgqhkunxygxgcvttzvtflovcwkmmamziwjpcwhdhxfrxvutbgywmankdimmpdljxjsdrsqtdznanfrwnaxnloxunutqivfmryokkmkowybyjytctxrhkvhksugmbztftuaqffjpvhzkxtlrvmtuvziskmypqviditwskiuimambsyvlcymsqoruzpqmalrmwvvfdlggmlxdokhkmmlqfxbnuwectnvpncmituemctnsyjmdgqvzsdzatvrhsqzqkzcsyunmsmlbovepimqiouwlvsbjatosdnynppmmvqlpxvcbxolttuahhykxdqoqeijlvvehjyqhdrfvvtawzwylpzywcjeetwejateuehgvtfgxgqlnowtjrjlnjqmngbkq\npbmkyopxwqypafwcysaybsepqdmvcrmdkffooobauzpglfnfvinvwglmyjxunchtyfqiiplunipqurctximmhysfiwrisrijvqevtcrpsbwbnorhkjugocnxegopyurvqvnuexbdnewgigapnhavjjahccxbwkecntelqdjizihbemgnktknwuvqhclmaajaoflwjsbvoqlerkcbskoypugureeymudukyxppzztufmbhntbnjdsowbooxpdpfzmbgfyayteoqmiukflhbajlxharzjllxdhzoxjjyrtknlkdqczfbolkezyqzimmnelrgjupeuchafcjqlftwrvthgaouuxglzvepoiqtjfzinogkvvxmbfnhcyrubocsuzelmtogsyqtevabisgeskbhraheradnoavubnfyyxnchxhtpkjkofqaaotcawfavstmjqufqoaoiemjrbafboojichrs\nquivyctebqwenatgsfenzvnxwxiyslrmktgbcgytstbjztltaghwwbydkhmfenznqqpcxwwrqadaivnxpvpopocfsvylhiqyqnqyekjovyzeqvwzikyhzyjldogksbgfqlcnsvdzyeonahylkcruvytqvycwzfphdzxmyuekwpajerrckbxhvokayemxntaeoqlzeyitmikthwhdtyiopjbbuumnuqgkpbjgicrkubnurlyopjmjrdvfskqckqihwvctxaxxexlgibovwzckefkgfyehykyzothiamwoglbwjttpnfzlfcjonnzqyvgafxrjjnsvxmzochrnkmykuxbvingteazpdayigrvjejykajapprerdhscscgeqioksbonxrtlgtfgbijkdijccmtpmlnlhylolfgjueptzjcufyzeksvsuvahimriaztmhdlsqjgmayaunyndddrxpislwezrzlhmpmnicznovbfwzpxtqaurdxifzokmydvgcbjzmsovowwcbalefdqazvavuavynvgabiirqzhmeqoboyowpqowofbktryxhorulsyuigxfraurgpvxihzvkcqrerjwduylpvqyxupfxbmebczasnxtbrpmgzmifqydsrzebvieremkydqva\nuxwmwuhndzvjmjsdjhqionbuexjzojeqjzzrsrzomzznurpsbhnihejeidlkdpqampgkstcxdhovscucdhjhlveoimolrblcbirmdidpuyknxkmdqfqngaknblghqjytsdfdgiddvofmeiskfbetalauoqmcuzbemnltzzekhmamemcdyjobbeosakadddiixxygqlkrxedsbnmzgegepveunlpivgnokxzlozbguyrbotmgdwqzannvikxchcqqodbispmuogefedaecaarpszkltmvitppcwbwsmnctyqtpdqsmdpxbukkwvfqjxuhggunzrqpccsncjsndpyqjvjgbawawgnqwudqmxeeswiwznhlcvlpfnoyxpdorkavwbmmxdmashhcpfskwymfpwbfwyhnhzvhicluhjumorbyxbdnfxraqutgyoyhnfhpqipzjfgnargvxxkuirnlzpfoybwdganqyvdovppossfyhsoqqgnfswhknhmhoxlumqwaukpbypmuuejyjpbnybzlvkmumihpmrkjhuclsxuatphximvmscqixotqlduihpbukpcjuwzxpfxmsxjtcjgfownqjqmhuatjxhwisjpfzqrzroxpxsndwzofcrxdqfgwpgrbibppzkzldjmkgdbqrtxzzebhjzaaxgryponibrsyhivdfcjikbotvfjfjwhsiagiinllypozcpgarghkgzafqtarhxkwyumjmabrbrwujuzxjfnzqjxasiaiciuihfmqfrqvwfwosatplyhjvfvifvbkulzxnihbfgtkeacqjvklmbrafrfmfopoctzxcxyfjxorklpjswotgtktkrrlhqvnhublggmnqrlgtknunkmfiohefitquomrvivinlgqgacchhzlghaqnrpmxkmeiaqyrntvrkvtqnshgzbttbpmbukizisxpnluqlwdseyapzwzlrtrsxrivceljprqrbfdanghlmmiqoaxbhoclumjbpsgxbibviqqirlgdubpfqeszikthipqacuergdtlrdqfqigbbrpeziyjwhzxmeuxlaujzfofahhfibobptfkhzylbqxaqrgicrzdxybgzuyqcpfmkpskpbimhjigcjdgnztugofpsavtsaqekttbcwzrysvjwqagkpjthqmyvugfeegvlajnovhzakakmolqgjhvuidtdctzfoqtcokvcevhwhmcyqzjwlhupzslkgrsjyhfvpusakuvswyejpaumexwurkejjkaziwflmjekjwpvxvazlqvvgpenonqejlhxzijlastetzwmkgdnswezxkhkxwrmvoeuuvcltbmbfihlycwwqrwaygifcgczxisixirpzgevzfuylgjifdgqugwwfyshzaxvsumdkffdwzcrgrdtwprdftbuvfzakpoxvqgdovetsrmwptwzmzwvbhnbgltdeuymopieymcitsymydumj\nvriklbwxycjindincdpxomahwoizadxgivshceudzuwsaaqfqyrwgdrppmvvmynjcwijiksockyufymhjciwefopxnheerxvorlwejnudicdvbmkslvmboaoshhzuxpbcytgdzditkarreogubypejkyeapgbmcfxxiixxyxbgqovpdwqstgikqsigpiqqfjawsqaprnjqarmuytcmfclmwdowezppjoxpmzpoapgnwhbhjsgcqyshogjyaargrabljclqungwteapqazmtybicmchmjhfwcgsnwjqxgczhwxkhpshmxtdryqzmnlojdjimuggjipbesovrmpejcrvgvhdwvaofinwqgehxsdqoitzqzfhdmtwzazrjrqnlcogqtthdbroildsshryycqzomerbkozhtjkcdmrxmezemtemevnirwqjpyswmdwzcdaokyjiigrmogvbyyygiwupinjjufihfihtdxsexaalqvthrvgwovldosgzopootghkkccjqjdifubkocwyyvolikoojcxmodunzypwnbyfqfytdyoluluxzcbigwhfrwdiidvvvlmwzegmoqhtjcqljihzglzybzihgwuzsfkmxmutyktpuazrdripuqbcvujwjmlklmwlooqgfwwpckrahhojrsdbkochqdxarxwlenwgezgrmdxxsnbywexrkofatyosugfagluawqlgerzkcevsfxxfysfbtklydqsbnoedooaejjdbigedbtddlaxklpmlgcfhfhpwtpbijzpbrqaltazdkvvpqbzxgclmsvzivntuhyvykyszsxmfkkcbphmodcmofyxuzyxqvztiwnaelbggsukpg\nhxcxalwxitsevbcejgfgwotiftzqffwlmcgqtwmvqsjphjrangkdabxdzmqqdvfkadwmhisjtbeppibxnvcfatnpcvkuogsynhneydnfrurclrhsedstebymksvncsfwowzqgpitqkuykczmiuzlaoojjqiwsdvcugdqemucxftcjnwlttuivhfhemqowwxpxgntuzmpfnbjybkkxgqszxquvgypnvbnpegezuotwtkcyyloetmskrmblibnmegwfpqlwfpofmptfbmryphhsmhyaggafyynwdulddoxcaktnowsnvvxvjjqpomewxgoiudtycucvcheqvnuyrbphldachddtwktqjzxxlsuwlpegvdfjrgmgqbgdowbanfoculokqtgdkhxmencexdowgerzhfiqesekypxsdcujpnuohutlblrirkjcsimpimaubaothqtavxzvuolmczhgsttrykivfijodyvluqldgeigvgrrfoulqayhlkjynzpexirqtmzfwqizvzlwylagnaiovsumpqigzdjemdgkimeiyqatzxdhldkkbgbhidjwxmqffcaoelajkcqvaafgqlxrzpcnjtzpkujntmatgmliubaqgjmarvrxadcazvijyhqmqehlpmiqyrbhyfmdafvyydymbijkdkbwutvihcvyqplbephmlmgwzlejutpgovbiwwncwrocvjveimvpxrqmcvbslnajtvhebxqunbmtwagoakzxrviubneldnvpbodrgfaqkxcvxpquekqwhtbwarmysrrayhamszbywobauvmfxcrwfxbiosdtkoclqzhuoaqwplqwxprniryhcmewtnnwhxnuikskrhualzbzosjrtftdicjizzxckbtuonsgwzkwptawpvovmprdbslsdcgyangthwsbynmovguzigbpasztvkbmxlfytcwazyupzgafddsvcqvlnfpazfrxgfknrjkbubkxnhkncbcxqklxrtedyyrzljotqxlxxsblowpfhuzdvjwjdmroymppjwpsebuomseelkhserijrkyrdbanfsbuawikqxpzfiqscyeedhvnoabmelqcdyrqdiivvmuwzdwsrtrbwlphxgmeatclnvvdhmjhhzrcunaswwcexmpgjjwarzkxhurqcdmbyxypslixfsqkbpxhzvllcdzeborjqjbznfrnelhnnuohdzyslraynpuxgsspihfqwmkkwgctjqksvgkixlmksjxujbpgekzxndjarezpolvblhmhdbptsciksyfnkkluvomwfavpowkuvxdjbsiewwezhqawnucfgwvfmfnbpgupujpielcicqeuywqvqqjvxxmhhbhbqingbyxpdqnfgibfdkosez\nrmhhporcofxzrajomvilsccfvobbbjjevzftxelvncmlofhiitrnriovshaavbnagxuzbjicgqhqeeytdjooanogrmezseuaemidtvenqvxvtqrzejxpdqpaidopzazixzputxylnmiscbmchjrlotywdmdlrqxnzomtrpztlfzzwzgkcwfmiimyiradgilsgjvwyjseeyysbrbbrtownjzdhqqqsowmwrxksswheeanhyefysfkujkweixwmmoazwjvssjmojcodouuydsxopyzhcgnttcerswetzytqvcmkvzzlnwdzvianltohtjwbdxwbcrdlfzmuaitumzjdlfwyrabxqsjtkfxuxdhsblvqjzpbkdqcbdackcwxhuouyjwdduhpfxbmqbvfbxoofttbbuvtjkrnppsjopouqnxanezwywyykjwxygfzazbmzezckvlltcdsrtcqkcjjtozafrdjktpzcucfwqimcfywafjkfdzzoiakrhvbcfpfrxnempsrxvboalningkflgojblgjgssiretvxyqwghiititholnbxxwobfxlwnxlsopgfewmfrypzwljzjxxmywvxykvqvmcwxxxgpxxysztpqftaudrmqftldiatxliplwuxalnfocvckuttowuonwplixkcsvfufgryytqjmaorqdvfkyiqoeboswtbbhbxpkctqwgnkrealqfbbbqnszjlpsdahggyabmxrahqpgbvsizfjmmjclgaadwhiituggpskijkmasplfsviodckdjtjczzpakcxrngxijovdsyuuqibnhtymwztyzzlpegnkyyfxbsjgxoqiqkamumudimrpqrtfpsszmmewicioeugrgzqiylgulcidjjqpwtfqntktzlzjxigehrwnxrzdlajfcrldjjthpjafapynghrixdxionbzocbghbbaqiezravjhcodfpneuomwzfdrsqvxcighsufpfltvbagsogkolegtzhlajplxpvzcgsemuioohathfxswczqdqvdrkziggwcfaejwmmtlbjqdowkrmterjfumflbuazkvhgcwwnmkorlydoisxhrwcibvnxfezzxurwjqwticsitqpxhnqgstydqxlxtxialmcktsrxylbcossdxpfrylruvdhmizeqinuxyanphmtoqjuhjlozkiazfztctzpersheezdruugbqtvxcplllylkwqtgugzmgyjwvntywbskfntvjgksoapgtxpqgiihdjwrsucmkgnqsumkrhovhteutqugbqytipwtivwfxtbeoeyslgprdxjuxzfhfbesgouxabtcbpjzhvizqcgeabpgwnkjprodsayfzedhjdjehekkkhxajgzeeumckkzepkbrjjyfajlazjaduofreukueyfpqbzxuvcekhvgrcbvvawvkscqwmkfmhzul\nlzhgiqlepifzxzabcwuleyqxuoziwfcztkssysmagitujrlnicfiazavydtzfhnacqgloowcnkiqbnjqqakzcxfgsyzfywzucexjrsuuqxmokvndoctlhaxjacgpalepwkgwadjqhpyseupxmqyhjxddqdfutuyishmxnfeciqbntoatpxqgvlrtmbv\nifqqjlovvmvbjfauvcqvlmhgzugvonyfxzfzhidpadzhwmqhuojjwewjhgtiktndaanmwjhpmfqvkdmwoispaqihjxtnigequreyeybnvepaztvaltchrpcifxxslmleomflxqrukwspuqaozdudxyxgulnopbxawhsorjgbthmgewkaugzpumgcqgqzyipfhtciuxetdlmtnwnxjzlhbaqhrktkwdfcxqorxrgotdsgdiscuqqdggtwadzkdqljqupsuzjqtqvrjvimgxxsdckppiwttegdcdwattlbzqxqkpmxehezemcodlckcukifajjemafvnlugazhhrcpjvcgtoxtvbwnvgtjhppgtfhsanafwdukmorcdqjfucwrutmfufcibfylikeyzjsudjoxihxdzkggyljevwcnnilvwxvjhhykimcuizrxoafzjtqtacazkabqedecpdvxzlcfmneatnuawfmouvvxivxvyxcmhpfxthkaqoqdiuretrgnrjacflbdgfqkmxnfaenctudkdrueugpqsbkthfivcrreafsslqtgsrwgeocwfiqrufoistgaedkmtpoetgmialsmydrlsdvumrjtaxuitlehcbzqvnhxkbbwrpcioghnnfxxzcyflowylmtvgftlcrbpmnyboezefelhjujacnrmndutgygzlbzbgsyvazmbxgevpmwogyhvacdhkrjgnmdfpltubhdxkhlcznfdlpflpttacyyqhacullmxduzzkmprpswqlpqkebueffsqdszarxyhagvsiwbmrdwkaanybqhtdezfaofbiybomuuskngmfslhhkdhkgmihueincpwkjipflltsrmobfyzoafldbhgsjkfmdixeeejnpsecnmkvaklwquubqics\nwwmdbcwhuicsokffihitaivsumpsgpostyzzszsxtopsaeddaekqfpmdoypbtpyalsedinwekhewnwvpxtkcghzgdzkxqgbcvwthaxekatkzwgzmcroysaznkiswldlvrlvindsiliwpweozvoveqwwccvxrrjxitsdoctymiqjimhceexhasefrwypnposjotitgvprppyezudloxpzrrkopesqevfgzpzyqerjupvylugkfszpsrioisfsnvvephmnyolomazydumwwrceajxokbgnhaqtjnakfvafsutshglayemjmshyrrsgjlbhbkdsnmmewrxbrkkzgiskleacweuphexxrqartsxhqiamegfyhwodgewfycmwoaincanmdzsfpeshlwuyieoxrnifkpagesdqchbzonczxgnuupfuabkwlfrezhizfsieaxdojvngvqjuomkfaqyldflvycosynztbhjmqxerpakfvfzqcjuagenmeoghqoburxetslrftpdrmemzrjaxdihjrhmmbzovcyoclfedmsqgrfnmxlpxttzpkolybyjjhnmtaqpslnitzpngulvqfsfzeabbzjugydeybtafadidtwidlvgkwivnigwyvyaukgxkvahcvjokzijrrmcghetvfwafgrxqmugpjfdldzkskglnmxxciqctwgjmbafagpilbwqgaemfchefpzvmgvqdkjzejnucklynzqbstlsoiramexadssuqawynlcaxciyrctfcxgrnydocnfwmbbjpxmrtmjinitrzwhofvefwxgtztlmdshpgbduxvkimlzfuyfwqwsdwoknsygesmcydrpquwhbjhxgjzofuvshmgfddsdaygizzyyozgndgfbjqsgpwvkuyuubipkojyihwdmacnvnevlrrebtzmbiqhsnggiexlauixzsfnabnzahgyawgpeahampphmigditypxtwlmrlarmrvfsrxkuxxjtvfeilmogoqwyhqtmvxtuvmokwrxhqfvjlktrldtnwwkvfsqibcmjxnzoqccncrwwdttdpbegvsydstignhzkjpjqfvcbwijmwlzdmcwpcnpysofkctlxfmyexfhtljpqylqnbmtovuugvpqlbqqiastpragvapcxdkuqfghxuirtctitfpnjuahzvpzbuhxvgcuexmdmjcktlzfyvxcsflpjuonzglxqhermqnauwhewaouishlhcvnnstkpdquonotmyggnuicawxslbwzukowaxldjqivrwbettmatqebbcbbyzlscujloarpqmzjwkrqxcwpowbnoqngwhnabasrrxkwcbsidopednzvwcqlxansnjcjxosxzsdzrfmmyaiopooljxyyijodydjucmyniuajznduwivwlojghpcivvrbpvdcksrbxmnrysbrjzzxbhdghmnjwqdfeojszwgbmlarchpubugchoskdjmmbllcllykvkiuesitpsxomuxfutkrawekmsqdqchqqislbwispzszfpfknmkrufzfshpfodtpuuwxgefzhoovmjnwogduynmdjlvspkvsghzkzhiyhfdnlswiuzpzchesryjomiyvgsqgjkrmkygezgtbvyohddkidwvosrcdseuqwjyizjcuktpmxzfjfjvoruohdrudmlmhfgiyqghqyjjveeuxdfwdtbbnfflrustsejhfbxhrdiggmwmzltgpbtbpkmqqajcxchkydxrvnmiahbhreaoskknymoyxkcjehxgpbprnhdeqsfzpkbxmuqqwetbipubpiaettoegchjblgghdkroictybbpojjmiqfffsqfmwmotntglbptqoqoazytbavhnqhmxsxvuwx\nsrnedurycdcudtexwgaycxjuzfsvhwxsolaxvrcfjsvomjfimrbdvpybkpjrxugxlfodrdsnmtxbjrzvxnriipdkjykgcamxttddjwupvedolhkdkagmkxyqvwocnkmvutmrdpcmemeqzpqdpkqdsjhyzuiyzykjkiwxsocsitjizwjsndbxjxrxlwiukkqfjypgjljsjcuztktobkefbzqevbvjbbusgttrccwvjpakjszwqxndgnmamqgwxhtrccccydlomzidsdgumcwcjvozhbmkdqkyglxmgaoafowzgjjbjpozfdusoedgjsnzawgfsixwrqsxhacxzoqsnjplatocpbknufvdbjchivvoykbtydivlankqypvvfbuzffxpsiascfzltdqskcldqmeaccyxyhngkhonimkbfiplagmqwbwlplcgpkepdhcskxfczghmlrftgksnlxhbbifjshsebmljkdhwpianpxjrtsyahodrsxqbvxbtytyjwpkmxhysbcgmokvpggrjifninvonjdpuifyvajoijsxtvrtqckurvpiqsnmqst\namluxsqpglrhdoljiplflyadiozosxinxmfkpavqilznenigkdrfqnfbwaegogzoezjjpggoxqjiyqjdjkkzbwbyzkkzviqqsitqocvblpsxsperhkshrdncchaiihncyxjmlchkbaiwvjwcseciiyolskqmjqtjipekggvuoupkyuzdueoiizbinbkumyuwladcastwqbhfbcdsacczguwlbjjpjvgkrsktjsrxgjziedrlokvpttrrmhjiewkhbnbnuadkbwixdavhyaioszwuwuvkzimiyhdtefpkryvbcqbrsqhjdsqjdbftsiopqmqtknkcvtnzzqvjlukvqbozscluhbztifieaoprmqdhjtstrxwnhptjekkpcpuygmcdymsvapagdjjmyhhtyyemaliuvlnfrsicmlhluhxoynireajmtqwdujpkaxixugagkzbqmjtigbbeqsolqykdbyoyfthufijveuktfjwsmzxchjjjhxfchyfwxftpxqzmpryjapqvcvokhndduvkdfjsrrjaodavxkywfpeoypverlcyhejzryxwhjbgovcllmyislfyaktiqwqqamzohuwdtnpohizzpnjkagicsrvkrqplivriwaostvlsqpvcmmejgnencpcueawagfntbworakwzcyuwbjnwthvtpgirkslegulnnjssjgozsrgtgwlbicjjjheifjuebhlzscysifkebfhiitykebcfzdtywaffgfbjzrihcstjonxirxhxmzarbapkizekipyuovsdzorwqacwuuooxrjkwvcfarnyqhmcivnbaveyvrejdsyochtcddtwrdyqwtgfhjcqhchxoobgfwrskbtvqkvemjaxjnbejmfevjnlotiehfpujmlcujmggvpvxpzdguvlxrgrizvqixgmatkhvdpezgfysjsolugpqzzxrrbnjzkziktsikwowkavxfbektcybzylgxnnwyofuawghavgszuqfjfihdxlbkfaimhkemzynmvkzsujmnzbvzyzmhxplxawhddsodnnsaqyfjnatbhbgalncayqhpbpcicqfilqyxrwsiqnotcqmraczamoiuuwigvzuzlvpkfmjvdeyukwrndmdlsifqoekiinosbfotmqsjzlkpegtkknubygtmbdgsoeifzhagcssbatbbilnifmzyqehvereglgdfhjioxyhldofouljecfaykdwragedvveyzjlytnhkxkrksczpckefixfpzawwykrhufutcszksogsagtvhtnvykuglfdagyntermgkiacmdvldpcpqliagvcwcztkxdbpouivbfdpmhzsmewkgumqdrrwgqpgadqztnxudyrnvqbtfmibhcadslfdgogmptjnzenorhgkfmsfrncsvdhlpyhtgfjzjtjfkfbcxiepzhuxwhlfqpujnhsygepablvdnbaufyyxjnydunmtahgwqfenamtdnsjbzmbbtvqtbqfdtfynkkzlyfntungjvdomaqbqnblyvwiozfakprcixqidyvafmclvfelfhcqezvsrsanwlmstlenoarejzabpawyppxcjprqdmckgzbsbzzjoqvclyufwhcungdoyxdfmmijjxxrlrhobyzbcujkecfitaqkuqwfmcejfpgwnetyqwnxarvfaxcgbwgjiwgdtvyngzaiqbmwgvgylhznhazmqqzzcgblpchgflyvruihbpbklklbcxqjxhemqpugkflvhmosix\nbeysebafvactijuabwbncooebuarxguhucoxwydsyfayldbddekgkruxhjwlpchnfvdgambefhdcetjnzqkuxncqerzemelhsaagobafvllaejogcrlddwezdzzvbfydaikdzlzxbyaezowgoioxfanbyhmyfocwajjnirkzeqwwydccpsjfllrkkhargxwzxgicgdmcxgxzkianvnorcwkpcidrbqgcqnxeopkoapdvmakjlqhcycwcplkrkelfnjeoaoevgrlkzuyofjokyvvhgrfyawsdprjrksqalkzdcwsjnjvpzqrvtirglfduqheotydnpnqisnjqnxiiewcafporcnxclmbnphrqnfoxxqvvphdfmblfsspjarmngcrcrzveipwzonrpugkbdiiknqcebazmgescqlrtaoyzvcxiyiwkenibwotjycsquvlzzgczbephmsiduafwxvkzakvcrqtzfcxjvvyxgbrvsycqzfdcyjsysfobvuszgvovmstvvsrdsvbtpbyawbmehddqethmbkchtljpbstrmizpgngc\nkvyyhfaphqdltndsppgxvymytzkaszkdzukdeuvjrtsrencajvxkmsfxurknyrpaqxalwltnqdhqzbvniuezsjuteuyukxqjhvtuixmsmgvbxhwwixrtppbzojoltbjqfgpgxpktiyzhfobcrcdhyatuigkpvbyzperkxuktdzxdqqmrhkkvuhydxvdaqfixunhvdqfikbtamuuxkccqznepieeilrhqjfhomqihjyvxnsznibfsyckhzhtgfthwowmguetbygnskhnpbmemejsozpsxxdffjystakkfurxiytxwdxpkbyoqtnmfoldbdaejyquykwjomhnfynkandngbxdosrtxdmqwrgtxuhttcdqdlshcjegksuxlvaqpjluxgwhlppzkokgrrgejuhxikouimarqesxiletzkhtaswlkxngthyybcnlkmfjzpxxrtijhndbwmpitffwrscbivzuijbkhgcoeeigehjrowrzdxadeibohlgjrsikhyozkrhgwjislospuuepcqiyqlwnokujsioubpjzbtbznaumtvzwjeykkjurihvbbckhomkcqmixrcladcsrvphsdsktwzwhnbppjdmdsxuwjraqbaveutrmejhrabtbkozfplzojsbsmezakavpzhdzemgwzfgrxbkvvmpschtiheyktfphtbuvqspubnvjuyitqpsqrbkdudzhrpeizmsihwwjatewdsdnjnhhnbyqisqdikzxdjqzkwqpdmbzjuprjwotmknhzhpgzrkauuwaejyxzasajravlnvmhvqkryaruhuhficbrwcmiafxrbvvbaoojkjvddffzzkptkofcjrykvkefooesijfwpdyrdpcbhqedxwxhdxbeciwsqwlrayswxblheiizszqvxefacaxydrdwbirfqfvkbbyrgnhlabkgauruzejlicnutcatfmaqxfoegzxtwirqtsfeznmudahpoksypfxjybegnzyczibrrppuwdackqfoqjshfbbwhpmupyiozegoozegxudgjfkoxkthgskimsuspesktykkvuzjcelnahfghzunuuimryzfrirudbbonogvwshellxjglppknnrdahsafewcoupatdnwqfzatirueymnvrasoswdfrmvbchfntguyrhgkofumzpbzjiwpjmmjpmqqdwbimztwswwutqxzorviinxnujizihutvjcxwjcqkajaljhxqxkejkskpkwtkuouectgwtxcwetlqnjwavyemknhvfzvsxwnhuvkgohuutqjkzialibehuhsqbvycnbwtgurcqzvuzttwgogosycpjpsxrsuoicqepmsrslhjyrpjrqyjkgcqwkokufquuzxqukrqmuobdccffyxaueaaoystxpypoithbtpvwdklabmoidgzzrgcoxbfdkfgpoysbauifytjuxopzwhpwhquipmkvrbdbqmhebxfojzxkyxivnkxqsnnrykzfhiqfzjkvcicbxqivrddpvwlqxpndaweygzrrofyotouubaamrwvalqbevvakualuvzlpdyfmcfwcrhbsmrsidquzcgrrzvnftqmgknggnlkdysqsbiugxlkvdaadorcigxcomswewcaibjkapsuugnlyvnfmxmkckyazclsftqzqpjunkpixfsftympfloibojtfiuadkoxwsnveauxzpurzdmfce\nyntgpbzxgtxdudiwoiehljlfaovpiopjapilwzuuqpaxbisbykjwogxjweqsadrmtjaazixxswntsilmsvsurblgvqsllooqnyntgqvxinrbhncktmktqdwprskyrwjphepyxyguufnjpmhtrwngisryxhvdyomujbrrrpntljxrtrzkoihrxlqynpskddcxxuexkupmwkcllglhemnvziawviezufqayemoaymmxwnhpqzfkbuwxygmibhfxhojqfmwmjhzqekilmxiimoqpzwcfhfwwmtiurntqoxuksiibsglgoupvddlwubfwlquuddjyfmrxctaegholwhljmoyhaibnjteqvtxtrrtpzapdplkupjrwvzbbgcwnhzcvqgssupkzwyxelqjbufnputnkuqsgokzzhsstxgjdmvudziuidtacdzqsfjjkhbtclkeirdyjkgtbsnfqryunzrklinnwzjogpkeffgdowelkhxyxfjeegbdcexnjwykqxtijqmeivvcshyvhyygklcbiymgktrbxwcamwmjqygzovaultksuptkpdimztvvlkvkaiemaqpmco\nqjpyhmhzsrklqstgskwbmudevyajnasfcbnyvgsswwjassyqrzqutwmfvtxbmzsxsywibcwqodraufbpgotfbnwxgvgddywsvylolhilqpdqunzzjfspdbiewsgeebubdikmqtpbcxwfszxwelafyolubfygjulcqoyqswiokejfldewfoyraniknlsaonqzassgpbtqmpnkxekxogcxpqasonhpoelfnlhcpzcpszjrfosbrqdzvullmxeqlqqpcbceqypxivmbafdipzmrgpiqyfofwkwafsxihaefgoscoeoirponzdkakpkksgjytfcmhaiibgspvhmdzgossvezldhjuuuhpyioqqjpxtsljixuccrjwjdpykyavzmplftdremcybyksasaytwbvhgshclzbjgalfseoeliqvhlbljwdouoqkcqazfflsnopeeihtiztoczebnafqmedylflfvrkbwtrtylqqoxrmlimluyrxsstdohitusyswlxbbpnfagdzjylqxtzzhdwarwsisekpnirrcbjaylbtieucfeoqkqdcyontjoavkhodpwqhwyczxnlj\nzorqdapocafbiknjzcvvyrbxhpiaqmsszariwcvmjnbwbtrernzkkzujziuysepkzgalnzocexcjwppyzzclvkatnhnstbkktqekoxqijabkrbvixqvsscsmtgbjzannesrblcxbebhorzlgugpihnivgbcsladarecnacxbukemaceyhfyekbxzfdzzsbetmfxazrhxuwmftmjptitwavmrefhzukaocrofyzatjdswzdgxevezikkojjgjackrasqcqdrbtaqwitjbytxxzgtctqouloxomduailksoboctybodtntlorinqightfaicwudbgpkirmvjcjbrsznigxarwrbdsrnriopvrsdrphmdklwvwspacylzabaxvigevnhnnzlkznsyevyavpvqvecmxiylyjuqtxjhzhxkrimngghjenlwnwhtbtvfzurjgutdpqouvjmcaglcgncjrvzesieutjgzgltvrpzccxgjlolyxjkjosngnaytmmsliqmapjelomoemeuhzkltownehhafuklxzfiaexefiqrlhsxvuewmdbsoghbpsqqpbattzeymcujiivggjoaqcgjwidxjufzzwywdcqeykypkzgrwxwxvncgapmgvnbnfkxmkxyoxdvurwlzpjjirkiacwgjejpuzuqrsqanrtizqmejbicgkgrkztbpwqypdifixezkfygoaacicrndrriugosebhxfqgbvujfpjkgxdgtipfbidjuxdkzxdojaujrvaxnfiofwjmezipgiebjevdrzoxijhmgzvlchrbobbhivdwjdlrormareqzzjjxlhkogpmfqsqpsaaeahccgmwfgdtgcjyinwnemyfujwoutwddovdeiktstoomktoepzkpytoiuswhaxcikyapbonwvopylpbjbltqpcrsnzwskjzzzbzselpphuerqkxfsojfrwdbofozpojwmaklatfahadlanpulueoxmidfewnwjeyvpwidssbqramkcvfdwhvycmeutkvzdihxchcowbwhmxbzgiddxhjzxmowtaxudjiawmuppcgvnagruvxcpmfljigntqrshlbafkcvnlhrhjfrmgglnbzpkwgpwyjsiaamxbwqmefefsocfpliijniwmsmspbsmgstpbyhyfrntkexcvkwodhsyjjjtdeivnhwjjsrnpveklryzbxziwyamhijalrbbfbwiknwkjbigllrbpkrnsvtcqxvymexdbzrvwyborszoinafgevnceyjvqinzvtlpzzycfmmemctawdxunqysdymkrqadrbrwdfwiuwcmcdbkcdtrocxqmetvmraiwxgdwnggjdtxethfziqzebzmftlopktjolxxnszqxupjinrtydlkscrgfxvhexpvadajibtmzwaczzmzjidycdymblvnxvvokizbvduedyqrpinluxxiwlwefcmbkrctcozuuzfybfselosjcfbsqsvctlblfojcbycxprvnvrgcxkaxddvtiuifgywcdlrlgusouqnzixogbyqpnvoamsinsj\nuhoqtnzrctqbzmbjqcpwdzlvhmbbxxwpxzoicyhkvujrabnqasgybbsimibwkypnlvdcbpsmlvgzwuubapmoaogshuyqkvpukqurscbhfscrrytjawohsqegghvjxnmbcghboqkjzmnvofzpxvwluxviiassqgpsmjntnauqaopourvlgutihscyhasikubvkgbadkjvmonnnlrzrwirrfensjadhoznbnxsokeogaufipdihwubqgbjrfvykogdiiawoxnzsjsixbxfyehgzmqwbvkpjadlzamzafqbqtubkbqtucfexrzcchdjgtngmbelvanpkumsniajnwuaehvcarzjphozngolftuxcceyarhdxysshxkqaokvcovcohvsbainzcisdcxxrbmiyglvwnfsxpokguiultcciraqyntebowyfczkrcimrfwrfqatnbeondptqcbjctbrkznwosoecqtmbjaozbxdjeprvzqitmhwxewxfyqptojgkhsghmbvkybnadcymeyjgdajrvnmbjsnuvpebvghwqqemxgihhpwmycuhnipkppubenikbymvpmuxnxaojthrhooqdnkwkkqthvlcptathtaflypfjchcrufzbfclafngddgemkatwhprcqozcwcgknygzbcdccbkpcdfbhjvyaxcvqdxbqcxmygycgxxxkmgennrgldifptehppleagvapapynhzsqrcnocunbbhuscoobdobhhcpsszxfxhzzorjabrahlygcemmzjgqodknizoalu\nrnfjmfotynripfxgokobtqxcxnklwdbxtckowuzjetieujpslmqftxwcjopqnboeqhifzbkybdocfwfuezacdvsphwuhbhihivirqqcvrshkyoqwdzwudmfcqdmpvqnyzxpqkoceghofjetsrrkqyaerodrcqtzbarbtchhezrpppyiytowgtiiuddrqufrygiasorqrttexrmjydirhkszvwzgselktspgclnifrusrrjwredhaebzwmihmtuylgbgvveyuclhzuaqrwwqigenvomtskepsivrttwynktaijdwnsvsawrrudxtklgaemixtaasczlhfwmyejxwargdxtyahelblclshqywfajsyeqoihfkbwnuxewxjgowbusaueyhnmaugskqxfkwobogejnjgykkgisuawjfynzthygzgyjhrxofstlvhyolwqueubgqkgfxksxsmwfujyzuvybeqppdkehyqskhdmtilxzyzwxzapkhvtbsfoprofztatsthpyvsimwuybegttfydudmnvneqkgufayswhjngqldlqkjuuwkwvgzxdyvaszqtogwiqiduvmsysxyzkwujhjlrzajfdkbrdmwfemoewajvdpvkgqdadsiponanagzsrgaiwjiifuklylfsqujqiuhcvycfbfvnruuoryivbapdurgqwwvyftcnkbmghvduoycrzqaozgfxxtdnvhrkoxaipmunnaiphdqrqpydxqovxswbxevncpjxpunaylmjjsyratmvzdvrfgxsjvcskqblcxvblfztoriijukxvmtrxxxvkmylzyizrvvahyeytwgdylkzznatuwvfbjugevtsezsbnorocliabaokwuyftobppecrojsszycamdlealhfbjdtdjvnhjmtnqxdyccvhslnauklvnhcjptssxhtdxamosfokxsprzsoenvfyzalkvipojhloknfqqakbnwctwxngymhcrgstbcdbahfjhnkwwoilkioltfdeehlfzztpnphtnubismxzmdtxckfoesdnkywbrfgxazuatiqgxefolirrgmvujlgkihjtqovjusrchsfsxrdckoynqksijkexyjuddzfibwqgiyfzuboonlftaekjihjtbwhsiyjopgbedmwkbjgxoazyjzbeujyehtldhlardmbvczqabvvghlzobrraawalyktjzeksrxjipluynuvzxksddklqvrimmsmlkbkkdgjtgtdhnfkfczosxistjsaiahduskorxrguoapqzgeegujhpdqfochspzyfitcnpwbvsgbppvbwmnyfyhylbzwkfrvpasqdmqgguuututxcltmhmmncslhxaltwbjrpvmiaclyvjlsbdcujljbjjokbgmhpjhnknycggayoztjbaraqconjhasxemsxcmkfcdisjoftiafphdsiranbygkjioybzerfodofqpvxnqvlgemwqimqubamuirqkfnngqrhcsjhehnyhaaogqjosxebfwfbhvimcsciyrmnfppqyhknhowamxgfpsuzverfqzuwnscgtwkganuwwusybjidtoegeagyplfhgfpxyipdqhsmpookdjfcgxzhaekmtiqkoiyfuoxknrmqknehwvgttgxasyudppgjurebxiowefrpudzwldfcqfqblukhfszzwsqgcfbvgoosxahdwmwwjvfrdyhnppkfajadgijke\ndqiqwyajvfjoopyootrjavmwerhcevzxegqrhqciktcgjwogrqxljqbhmhnbytqkycymdpiwcoljklusxhasyttvadsaoifdvyltqhtvelhbafqfblhqwzpzqhqnpjatrexirxxtjuvcxeyzcaaqrfiardhhmsjgkfpvujfnlzpgvcgxbtpshiqexlmckgigcggdroolitvyjzuqwstfbraawwehhxbbuumshfishwmenzynrnlwmqkytwoynbsntuuah\nesuqthzzctgnbnuotlreoavjxxzytnntuupxwyqwacgnsehyizksudnaiyemgplxfyrqwcsafriybrjhbhfaffdjjgvavqsammjdyowycbaroggwprztknmltugvsiaihywxkiiwecmayslgpgxoknsknctqghfebifipnwevhuviejmzmbfcktwcudmqwnymdfhuynrssnxccexluuceqoreygwmxxrbnnhhtzidvaglnaabikugaisfmcqdhewlxyjurcbvhmjbnxrrtbltofpqciympmafotkqcbdtwobxkwrdtgsysfuoyoffpdkhsigekhqhtbpymdztyjoftsxutfzzdnqhpbwdfoseaywmjogfqkkzqwvkvdtlyjjokwmdoaskgaqghdfplopeboyodywpjjsjegprprruhemenkgrotszfdheuhxmwjslfdfshxazrmqbnwwtdrwjitaowartswyiudfsnvwdyywuccfjjbbmfogstzvmxzxvbhscbsvzwurxtnoesnejcdgcodirrkoviujgdohqgfkzezxbzgidkifwmygdqlwmhybztltebaqfnsfbuuexgdogzoonqggswbgstptlvpcntzpiplxlqfovwmxqnquatgxftxmwtgoevauybyqfposuvnqfmihjslfinmxrpfktlxrwunasnnmcibeaxtygbwpwikrwfppeezetjkobrsbnhiqdfqahorkruzxlxnhuyymxcyjczjidkynbnrusmxlvvdzlnkvlxfplmglaavqlhzdxlehxlpnozhkehjeghmqgjyxyrqquxnzvjnqyzzfbmrstitlkezrupooudqbbsqdqvkxhahkfuveluzjhsvnkgqhtdusyzejvnapekhwmjemlsseohwbvcwjafgurnbagyuqxqqmezlhhprrfakntoplvkcmsczzbinhutjlvtqafrkezvsojocwtcjunebtvcvywhaehhpnxktrfbkeynpuqyrzqvezcesguxtgwzwplzenxbgeazegfivmojiripxihriemtnehbqvezpiprfnxnlaexxtnlhkhvtjjhufgwcsbdelyrjkucburgkdelxxgdptntvktzetyrxmahnithuixwdcfxjvvtltotimheywqlyampfecpefveaipmvenzbdsufogrmpeotczwvdeosbgmgrxupfhivvbqslgmltamsctstxgzwhegrdcupuqqkgekqksdcqrxrlgiwjjoihlahrsqzrwasnmokbngilefshlbuzlcrekmbjvnxcnjfuovsrepuzjkexrfxmoinvgfhibiioixsxufuygkznsmwnquiucfydrbsmimpjmonfobdbnumykrtclciqratbyfwgssoozmpqxhhmhdmighvbbrfltlozsyrjmubnlvoxweeitmmycmvmqmlbrjhoywmsbtdjxcckeynqwqyanvjmvgdpwidoypdckxwhjzibfwwquemqqkjxchzbbegpcjcwpwkulfyflabigbsjktwsgyhaasfctscprqinveuzqylfjpduhwknibxglvecovvtijklqxtvmiurnbowxfnhuyqkfefuqudhbrspdyhfdahpyejivk\nndjyjbmxjpcxmvsddkasmlqoejqwgifhgmytwuvgdylotuyjuofjmcgztzmhshnojhkzgenzqyymtjobdyecyivrhxwtjiyickfobufaklnpjaedtizsxgronambzcjzibkfardxydynaepdpdximtiqwkvgpeartzuhttwjyfkikiwcstgheysynjldeocxduxlevrouinkagxuvtgdxrzrsattdwskvgfxqtzaesuvgdkckulteereqqhdxdqgsrmnmthsxknddcgiykrobiobirmisapppoeqektmlzlofjiwzauifiluleirrwzlvxaiugcsbdkeetwfxfozukqrmoxcmzmuqcpvzdibbvmaqcjhxjcknnwgmnftlddbaxbqwjnwkuujebpkeckdrmoisywcfamnevxoxvhzdgffmrarsvgochobscvcpqvemfdjpmywjkhyeqsabnoivxgjdxxsslakdoxiexkppdnrudjzkhackncqqcmolfhasynqasxeappurlrrjcwlcvcpyexskodamxjmbfhbflqvdkgofcajfurnwncydsqseosisbkyolirisdvixqqarjifttnlsxxucelbxbmiaumihuowkryienughakqbkvlqyfjjikixfgajnleglvuqjbwafmxmubhsjkcezpzehiwqcjfpoubrwjklccjvbtqelfpzibeifqhclqvwgpokcbqcybhwfzpyealudeutpxfhyxiotyiksgxwtgyemshuudbaybmayjtzbsbbplpdgmkqagsefiasplwadzfmkyyenncyohuqtjqguwwtmxefdwjefrkblhzmztwyviypjygjlogbogqggkjxuvfmnytrncohjoydblddpysigdxaduofihbaijfkscjcsapzfaspzqbuqmpvwalrzlftgxycergpdxmfbabxsdgxoexgxxmoxxoihikcdefzsvgqzppmegyrqkpxyzbkwodeucgevcxlhuzrleedejmiqgbdbyqqwhqxhubadhungfgcuvkqgmisnclnwlrszbmsudgvttjmusaczeeemlmdowvbtmvlfzlvbfmyofemtniccsxwkbzwlcoupvxqnxcnsgingnkoqcmysrxpavhozmmqipcedvjjdofrypcnhekutsqdukbucyiatfqdjjnhwnlngcnkvcuvtphkqzgeyybxnpktrshypffnowejqmgogesfifrkzovjqzdghjiwcshodbvmcmrokaevtnbvrmelafckzknuswqtwqpqyyviznakngyscpowyjenxdixlpmgjsdobdpkevxpvtvmzuxyxskcuvqzxheqvbqdncwaxmgnqyibqnognptcasjpirtskzvtdtzdhtowzrcfsefbfetapmheaarsguttxwhyjtanbipawaxfvpbmvpzgmqjmtgvepxxjjqolqyccijckjoicsgasdxbzjowqleobpsbevmopahkfrirdecmthiakurdxvyophzpdfetplyghrwnobxnnxfgiazwahcqpregvqmikspbpditipdebveirbiisluwkgwtipudojhblhuorycibrbvbvgqsdafgmtrwetrmvmaemyikpjlhfztchkdcgllofvwodqgpustlejoaywuprrrbpxaqejqxkqozfijsihsoarkhtragldtgrpkucw\njprmgsmnhtguqdgheavumrxkzpuyottypcciphphubugpjntjvrnrsnexxeoovaoqvfvoqyocevbyutxyktjagioqhepeaqsevpdbqauiabyqxquytpsggtxznuternypqfooviojdoilpoitlghplscdqonczbdjwdwtliarknabcswbaugezlioqhbdajqdsvleqqrexqorpkmailawwkwxdmhkflcrqxqbewlkexdyuqbzndwtngrhbtjmenqbwgmigfvffvttngbljxjeflfjiucdzksuslebdconeaulujbkigwwatlxescrwyupapwajhgqzbxwjdavukadllyhbldpnlnydzljdkkikezueuzzljilmodivxtmsodhsboxfrsrilucpyzmpxovpwbbzojfmnjvlnedtfdebnonvvwbhvxsspnqvvzsvbwzpisolwnwdmgaeorgjvqnxjawujxyakdiktyqtofqutwhlckodnajsgnehwduukhzuqzhpyummqlipuhmbbcqlqgaockwnkyuxtbauntabbcpqezobbxezhwhhpmvzohhpbekcvdzhvgquufzfuqkeblcjyyxmzstiqnxgeoigcwrczsqrrkneedpsrieslezfwpwlpbkqmlzpdrtwfvxdajbduffymfyyajcvqsgwqatzmqemscflacpoqquktwcockpqvkemthyzxtgnmhuwletkmqbsakdccwozgryvczclwlnrjugcxqttwioptrzmppqfokpwffybsinwwqkeeuwbgnwtfzmsvibwcywuoeohdfysyanhrvpixcmwbbaylrwxsrdszlvdzdjttwjncdpohjgawzvmrbxkogegkpuhlkknjryjjptmefdqsmndphzxsxcdebzrhscwultlsuhymtacplmjyupudtrulmphegsphxlvekfxeilspjhiknffluzrtrsakepcrdnlohugrvbxohjkdcseufwlsupsvzrvwoizukhvxjsljchzsmpbzltcbsjpoikcutsqmrkmcfvslpddwrsmzlvqakqlbelznxbiubchirnmbnxuzehmwuesllfsgyvsnjgwtjskikgtgkayhlqncosurybeszxrjlancyowkufwervncrlywahvvgynrwtjkmxxljqjmjdibbsuuvmggikznghmvkusuqaailbwjmyxnbufcvxyozflhunrxxtwzdyafnubfesihmuzjsqbcfypobicfgazykbvdeyfphcpozdzfwhfrnwpmcopgfjnlekyewewovdcodfnumfzuaelheieomzygzsduoghhfwrjsoloapmlicxikthdwfgyppfovogyvskarfcubesiwogbxqmagqnvlnwnupgdmhtnetlxoeahsntyeunlmgkbrfpvcstsslialfwbeigvvpkicroqmhnbccgiqcwbvnybhdqcqeucbqcxqniqrhleixzqntxwtibhbazkkpssbkjvmdvwbrvublhnapqtugddtqvqpkjyucrphclzlydzesmjtkzmtmgvziicllbzjlwyemmugbpboqbgjqqjbbcxqdqqfzjbnzsyqiwetdif\ngyaodtzpvblmrxzpes\nefilwbfonkbrbtgpokarpxtekvyhwrcvtaablrbffmqvzxvjsioiyefbgljjnhpuymvdsqhcevsaxhbtrkxejawbeehgrinfaycvrzrdglzomqbizmvxnkunsnbbnjwulctrtgtscnlgdoksrvcgpskaiupohjxoebcitbvxrssaxeyjrpmdjrgvdyfrqoteeepomilrmoaurleswdjusgknawmefymmnvomfcnxgczzqlmtigjqefszfefbtudqofjbffldofbtjehcygeuehnbzpaategslyosvmvlfhnrwnrhpsloamxtqaixqgfrjpovukznoxjvubztygaelzlsadpdrwwvqntpgmugobuhyrwfynueqlywcgpfdfdytgnjgwuyjmnobsgrluiissmjvkaljtmnvnefukuhydwasiarkjkhinmirqolblenvxapccbkgsprcpmtepwssbbtppxiqkfsqcbudygosqhqwsdymllvximffazqphcestdmqaetjofpsclhbxmuqhkajhkrdewugxnkjuntlwrmzpocuklyazvggclmvdfieerwteksriekdaoxmwpjwqayoowxqqdkfjusiurgljgpjgnmmcgpbblmrkguhryirszbjfjjqabynjvobbsvyvcczskwwuoxjmqbeskhsubxosuvznvfkarphzkfuiyyaenqkybugsiodrlvfxnloqkdjgaiyoovisrkeddaxygwqhqlsyqcmuhsyrpfvdioijzenzefignlupjavizezdwhetnemhyrmkflatxhgdwsjrkszxqaywjumxjkecqhjjonfeeenknpiqbbzlaognhqnzvlinkgnyyujmkhwft\nfnsriagiokchudmzjhsepkxkuexhxlvohufqpmyrnvnbcgebmreaosxwxlavffpvpoyajzutyylnjddxnmmpvfmfmtevwbpjogzfcpsbpnkxcrvttypvnwagydwllgqthijtroshhuyyjslqvflimzhagqbavxtvqzsojsztyjwknfzruandfyjqyyhicyuruhaanviavgyfazomjkmusuxjhgdnvikqcnneevzqiepqxqxzblbvoefijnyoeorrdkvzuptplkxlvbypbytaxehuxpsnognirecbcisagrpuxwawpqqisvhtbmathqgbeaeespyvapxygauiqznkywxxidkiubmgkuglvgvonqxoccdbmbzerjntpvusmkbpxtawnpkyrdtngseuzlwsollzvfzugsxpqkqjjfxngndxleflcejulvsnbytihnvvprkewrzulveconjqmfmjnpcwrqnphxpjtvkabpovmdkmujsbpfttkfjokrdzveipetoqxqxqlognuqsybmckhwnwcawysgdccbwsotcmwnhnvujwxualzzgyquuhpxiugzwmzwtpqutuautuvujxbbewifnuknzdzpxknsxtrwwacjenoneccfhptejtrirwncrxpwzzklmpxdgxhjsgwhlvaowsiejqwmtanklgfdbhygpqvlvmyvoiffzwplzulryjrzgwvrmaecmznsbowavpbemqztcaamqelquhlhjserrogsgmbjaimvgkmywocuhflbrhqboctdtnlmwwvkyvjjjuptlkozgvaynwzhzbegnfmdsnhcszkdazuhhozbcugkwzdsknkascuttgogirwpvnlymwkdhgumydvrrevztzpnndymopwyosrxceuficehpovoetchaocefuetjvvxwhrxveiznbyvzooujwbyolzgplaojpqabmjmsicnixayeehkotoognwnvxdxldnbivxbhdzqjeocrqfmvomweqlopihspdrqjbmuxmojselacujnlqklfdfurqniivmtrxaglmcmfzowxjadakkknmqmbmciubacckigtxabehwcqvhhukkhalhkubvbdfqlkhxyjyzaeobfrsaqrehgwzjxsnleehpslvqhureijyurxpqsdwvyeeoseoerxeitplkkjktfpbgtfpjybtxmauqfbndwtdeohkgxqlptqpeenxpxuobddbwdfyiekybxurdqofqxyhfoyinhowtlqofoujsgnhzmwupgffxkfkxkyzisikcabulzqotmadlukfzynwuunyphrpsrerleefuadmspfcngsiojmrsxxpxkvrvjsikjdtpak\ngigqsrysvkarmawwarmoozqyfrymowlcttbfhtkinjjgihwtsqyyfcuclsbtioicoplknsmifwrovqieeyfhjwewuacnctpyfzdytjlmsgnfpxozzmgfshpslrmczcqfnrjpbnpujupebtizcohruopvhyzegyppmtchwilnveczpbwnwdnchqpphwbpvfcwfkkyzjixwtbcibwzbmfabjmckksgjjhdxuhhztgavmemvtxxsxmtbeelcgaxobstvpbnclnzhldoylvlutbzwoxiauhooaucelqwkvlbbrpmhaviarudxfvjktlucghqklrsvhggunlepwmhuravecuttmmwvowoctyvnyfybbrponuykucjuophbbhywpaycyabpvtjzamxzuzdyrcmqvytnfiaqnimnncrgbmlydiqhnzakshrncgtqjnmtbtkraecuituteladpiqbhxycvxfahyozapfrslekfksfnfusvfjjvopbpoioktslclkqcylwylhzjcljlsjpjuljpdwadqmjwkrmcaowfqhqlefdiqfjatsmjrnbqjugruarjqjgafifgtkljbzdvqsfmygxkxkllihakmikyzjbwgeddsangvnmmfhhwykfwerbndkrrifsvfyamxzbjlyuaqtoejjrhayzjdzpnrspzxkacilojfgmpccvfeyxbiklmsexxdeqsrovmgehzddxfxgptwpkvbschspokggsapfajpwvbfbmlhwlbrcazxzjrpoamewhjpomgwhycborqmugykukfbdzidunmrugfmzfvrqffhxhqqlcqvjezqunpknvdvlmohwtsdcfguopghpwibpjfqhvuvzwltfbxesrhsuzbcpmrvevgmrcldgmqafrhiqovelhkecwxqzjhlbqrnrvjdvmmisyyk\ndxpdwxpzapijftbcyecxjtocpskjsgcoxjvovszresxffuvbwzpoqrtsmbcmtpmwuecfxfbiglbjuizxntwqzrdskwkbrwixxoslzstrdapnnnxqvjxssbugdplkpkyvrnniwsjcfbbgaadkfveaglbmprijymsnrbtsfmsvtdwvoypicchaawwelvzzykojsbxvqfeconolwqdvbdzjfpxxbvtkrmnkwntauvuqjemlzwafwykvsrqjmmsmymjgadtkeovwdicpksgsrvqwcstqnwyfxzutggpovthcirqbiaaeynbblmqfhobytbukkntjaxrgpnotiktjvrjtiyytlpbpliixfylqylheocsdaemxjiwdzfhqwnoiyzdyyqbeovqnlwcqtaemunogmxwapdmwzoibmooeonoklkodxcxqfysnafsshzrypaetemtjztdlhljhpgovrrmzgkneeyawzofvccqvpfvujipojhklrvdbtahspvzmrkqhwfachfszrtmklczdstesociyfxaxwfdtmojtxnmzediczmgmtxjgltozvqfzwwgcxongtrloyujjuhpsjcwlvjgsoaqotkpexiejjfiwixdaulonijrnpfgdhohsmzqraqczyshuwdmxdddixwyryxkoxfwuqjhyqgiumjickgoyryxticyanuefmgqrzdqfcbmoldplvbwrvtsaalrahnkpffxjjiwkoefccmieuysmqurprosxrskmhdmovxxedjerzkhezknbhrsfdcbrcuietprkrogivxnbbeifkgaapkwfsjfktsuiwxhkozwnlxwsbbljyovewuxnnusfmeettrvpzytncxhmjicajxyagwnriitdogbzdiztjzvojusjjhibykggyhddntsmisjiptwszatkdleuiobzonqoeigourkctuzvgaocaqyzdskgcfhpyfadfhaqoafuikwseejwnakqqworicqhbwnnkgwxizoymotvwoiymvwnemfdhjyqlnzcctuvxujycilyvfruqxeckutjkqdqdxupuqowybihkekasdstmhalykchcxjzbikypucbjtrpjxtkcmhxddodshenogleurdjkscpulsvigbqkiytggkdhafmpslfsfbpnqubclgfacmwrzwxatqxsguieanasuvmvucxhjmvnvxulzvjwcmxtpzqhxpdzchnduwnqogklsitdbwydezdktzmpbvzobumkdrwghrigthrcaveqtxmqsxgfibzsffbfvfoezdsozkkvpjankxgxktvotjlzqilrsrjjxswklujdimgzyuvopznfdxxqqbytnuuxtucmlzppzmihpsqwhnsrpaphtunbtyddfhnnkacethnuotrgubfzfkeebruguvszsxrsimsnlgvvccltooakniteytnaxcaopfwospyrylkvrqfoqnrjbxoiqrtpdyoghlminnouatjpafkwtgjadxvapvosklkoucyzfmehzttjokihyoyulasymwuicswhgtfgxgulrlzizfpsrpzytjwrkaazwrollcznaqvlozkvvenyjvqbpdjrinarvcpebbqfyxeaibbvnpugcapudujhspmdgnvryokofhdtntplegyxsovxandrydjvyqowoteuyrcnzabcptvyzmibbqbbdnzmnxtahhjmrtfakdizycusacvcnxuqsgzidrimbmdjclrfzkkhsgqcrjopyyjtlkrjnyshpgalvryft\nhrkbndkybcqvrkvkndurtgmfaehzytppddmklfczlgmcmphwqiqfzmnxebkpakvxdixgbtguukvbmxhwkbyatgwwcqzqzrlcbtbfpgitspopdsahsbtmxdtgqezgbpuqfnrpnxzmuazoyrhkopxxevbnfpnuwjnfdnmioziiwdkkkryvinvzipztotxltezivqmym\n"
] |
[
"NO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nYES\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nYES\n",
"YES\nYES\nYES\nYES\nYES\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\n",
"YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\n",
"YES\nYES\nYES\n",
"NO\nYES\nYES\n",
"YES\nYES\nNO\n",
"YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\n",
"NO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nYES\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nYES\n",
"YES\nYES\nYES\nYES\nYES\nNO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\n",
"YES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\n"
] |
CodeContests
|
A university student, Takahashi, has to take N examinations and pass all of them. Currently, his readiness for the i-th examination is A_{i}, and according to his investigation, it is known that he needs readiness of at least B_{i} in order to pass the i-th examination.
Takahashi thinks that he may not be able to pass all the examinations, and he has decided to ask a magician, Aoki, to change the readiness for as few examinations as possible so that he can pass all of them, while not changing the total readiness.
For Takahashi, find the minimum possible number of indices i such that A_i and C_i are different, for a sequence C_1, C_2, ..., C_{N} that satisfies the following conditions:
* The sum of the sequence A_1, A_2, ..., A_{N} and the sum of the sequence C_1, C_2, ..., C_{N} are equal.
* For every i, B_i \leq C_i holds.
If such a sequence C_1, C_2, ..., C_{N} cannot be constructed, print -1.
Constraints
* 1 \leq N \leq 10^5
* 1 \leq A_i \leq 10^9
* 1 \leq B_i \leq 10^9
* A_i and B_i are integers.
Input
Input is given from Standard Input in the following format:
N
A_1 A_2 ... A_{N}
B_1 B_2 ... B_{N}
Output
Print the minimum possible number of indices i such that A_i and C_i are different, for a sequence C_1, C_2, ..., C_{N} that satisfies the conditions. If such a sequence C_1, C_2, ..., C_{N} cannot be constructed, print -1.
Examples
Input
3
2 3 5
3 4 1
Output
3
Input
3
2 3 3
2 2 1
Output
0
Input
3
17 7 1
25 6 14
Output
-1
Input
12
757232153 372327760 440075441 195848680 354974235 458054863 463477172 740174259 615762794 632963102 529866931 64991604
74164189 98239366 465611891 362739947 147060907 118867039 63189252 78303147 501410831 110823640 122948912 572905212
Output
5
|
stdin
| null | 1,848 | 1 |
[
"12\n757232153 372327760 440075441 195848680 354974235 458054863 463477172 740174259 615762794 632963102 529866931 64991604\n74164189 98239366 465611891 362739947 147060907 118867039 63189252 78303147 501410831 110823640 122948912 572905212\n",
"3\n2 3 5\n3 4 1\n",
"3\n17 7 1\n25 6 14\n",
"3\n2 3 3\n2 2 1\n"
] |
[
"5\n",
"3\n",
"-1\n",
"0\n"
] |
[
"12\n757232153 372327760 440075441 195848680 354974235 458054863 463477172 740174259 615762794 632963102 529866931 64991604\n102338863 98239366 465611891 362739947 147060907 118867039 63189252 78303147 501410831 110823640 122948912 572905212\n",
"3\n2 3 5\n3 7 1\n",
"3\n1 3 3\n2 2 1\n",
"3\n1 6 5\n0 1 3\n",
"12\n48863441 372327760 440075441 31969951 354974235 315231620 463477172 740174259 615762794 632963102 529866931 3620058\n139572012 98239366 465611891 362739947 147060907 118867039 114119164 78303147 501410831 49230544 122948912 572905212\n",
"12\n48863441 372327760 440075441 40635764 354974235 315231620 463477172 1102766996 615762794 632963102 529866931 3620058\n139572012 98239366 222622949 362739947 147060907 118867039 114119164 78303147 501410831 49230544 122948912 572905212\n",
"3\n1 -1 9\n0 8 1\n",
"12\n48863441 372327760 755057774 40635764 156339565 315231620 182202208 742111057 13211473 458883009 529866931 3620058\n139572012 98239366 125015454 362739947 147060907 118867039 114119164 78303147 501410831 57813398 122948912 572905212\n",
"12\n48863441 372327760 771553476 40635764 156339565 109554065 141758554 369087251 13211473 458883009 529866931 3620058\n139572012 9487455 125015454 362739947 147060907 118867039 114119164 78303147 501410831 79768540 58647642 572905212\n",
"12\n48863441 372327760 771553476 40635764 156339565 109554065 141758554 369087251 13211473 458883009 529866931 3620058\n197984360 9487455 125015454 362739947 147060907 118867039 114119164 78303147 501410831 79768540 58647642 572905212\n"
] |
[
"5\n",
"-1\n",
"2\n",
"0\n",
"6\n",
"4\n",
"3\n",
"7\n",
"8\n",
"9\n"
] |
CodeContests
|
Our master carpenter is designing a condominium called Bange Hills Mansion. The condominium is constructed by stacking up floors of the same height. The height of each floor is designed so that the total height of the stacked floors coincides with the predetermined height of the condominium. The height of each floor can be adjusted freely with a certain range.
The final outcome of the building depends on clever height allotment for each floor. So, he plans to calculate possible combinations of per-floor heights to check how many options he has.
Given the height of the condominium and the adjustable range of each floor’s height, make a program to enumerate the number of choices for a floor.
Input
The input is given in the following format.
$H$ $A$ $B$
The input line provides the height of the condominium $H$ ($1 \leq H \leq 10^5$) and the upper and lower limits $A$ and $B$ of the height adjustable range for one floor ($1 \leq A \leq B \leq H$). All data are given as integers.
Output
Output the number of possible height selections for each floor in a line.
Examples
Input
100 2 4
Output
2
Input
101 3 5
Output
0
|
stdin
| null | 3,242 | 1 |
[
"101 3 5\n",
"100 2 4\n"
] |
[
"0\n",
"2\n"
] |
[
"101 2 5\n",
"100 2 5\n",
"111 2 5\n",
"000 2 5\n",
"000 2 10\n",
"000 2 12\n",
"000 2 18\n",
"000 2 30\n",
"000 2 51\n",
"000 2 50\n"
] |
[
"0\n",
"3\n",
"1\n",
"4\n",
"9\n",
"11\n",
"17\n",
"29\n",
"50\n",
"49\n"
] |
CodeContests
|
Brian Jones is an undergraduate student at Advanced College of Metropolitan. Recently he was given an assignment in his class of Computer Science to write a program that plays a dealer of blackjack.
Blackjack is a game played with one or more decks of playing cards. The objective of each player is to have the score of the hand close to 21 without going over 21. The score is the total points of the cards in the hand. Cards from 2 to 10 are worth their face value. Face cards (jack, queen and king) are worth 10 points. An ace counts as 11 or 1 such a way the score gets closer to but does not exceed 21. A hand of more than 21 points is called bust, which makes a player automatically lose. A hand of 21 points with exactly two cards, that is, a pair of an ace and a ten-point card (a face card or a ten) is called a blackjack and treated as a special hand.
The game is played as follows. The dealer first deals two cards each to all players and the dealer himself. In case the dealer gets a blackjack, the dealer wins and the game ends immediately. In other cases, players that have blackjacks win automatically. The remaining players make their turns one by one. Each player decides to take another card (hit) or to stop taking (stand) in his turn. He may repeatedly hit until he chooses to stand or he busts, in which case his turn is over and the next player begins his play. After all players finish their plays, the dealer plays according to the following rules:
* Hits if the score of the hand is 16 or less.
* Also hits if the score of the hand is 17 and one of aces is counted as 11.
* Stands otherwise.
Players that have unbusted hands of higher points than that of the dealer win. All players that do not bust win in case the dealer busts. It does not matter, however, whether players win or lose, since the subject of the assignment is just to simulate a dealer.
By the way, Brian is not good at programming, thus the assignment is a very hard task for him.
So he calls you for help, as you are a good programmer. Your task is to write a program that counts the score of the dealer’s hand after his play for each given sequence of cards.
Input
The first line of the input contains a single positive integer N , which represents the number of test cases. Then N test cases follow.
Each case consists of two lines. The first line contains two characters, which indicate the cards in the dealer’s initial hand. The second line contains eight characters, which indicate the top eight cards in the pile after all players finish their plays.
A character that represents a card is one of A, 2, 3, 4, 5, 6, 7, 8, 9, T, J, Q and K, where A is an ace, T a ten, J a jack, Q a queen and K a king.
Characters in a line are delimited by a single space.
The same cards may appear up to four times in one test case. Note that, under this condition, the dealer never needs to hit more than eight times as long as he or she plays according to the rule described above.
Output
For each case, print on a line “blackjack” if the dealer has a blackjack; “bust” if the dealer busts; the score of the dealer’s hand otherwise.
Example
Input
4
5 4
9 2 8 3 7 4 6 5
A J
K Q J T 9 8 7 6
T 4
7 J A 6 Q T K 7
2 2
2 3 4 K 2 3 4 K
Output
18
blackjack
21
bust
|
stdin
| null | 546 | 1 |
[
"4\n5 4\n9 2 8 3 7 4 6 5\nA J\nK Q J T 9 8 7 6\nT 4\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n"
] |
[
"18\nblackjack\n21\nbust\n"
] |
[
"4\n5 4\n9 2 8 3 9 4 6 5\nA J\nK Q J T 9 8 7 6\nT 4\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n",
"4\n5 4\n9 2 3 3 9 4 9 5\nA J\nK Q J T 9 8 8 6\nT 7\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n",
"4\n5 4\n9 2 8 3 7 4 6 5\nA J\nK Q J T 9 8 7 6\nT 5\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n",
"4\n5 4\n9 2 8 3 7 4 6 5\nA J\nK Q J T 9 8 7 6\nT 9\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n",
"4\n5 4\n9 2 8 3 7 4 6 5\nA J\nK Q J T 9 7 7 6\nT 8\n7 J A 6 Q T K 7\n2 3\n2 3 4 K 2 3 4 K\n",
"4\n0 4\n9 2 8 3 7 8 6 2\nA J\nK Q J T 9 7 7 6\nT 4\n7 J A 6 Q T K 5\n2 2\n2 2 4 J 3 3 4 K\n",
"4\n5 5\n9 2 3 3 9 4 9 5\nA J\nK Q K T 9 8 8 6\nT 7\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n",
"4\n9 4\n9 2 6 3 7 4 6 5\nA J\nK Q J T 9 8 7 6\nT 5\n7 J A 6 Q T K 7\n2 2\n2 3 4 K 2 3 4 K\n",
"4\n5 8\n9 2 8 4 7 4 6 6\nA J\nK Q J T 9 7 7 6\nT 8\n7 J A 6 Q T K 7\n2 3\n2 3 4 K 2 3 4 K\n",
"4\n7 4\n9 2 8 1 8 5 6 5\nA J\nK Q J T 9 7 7 6\nT 4\n7 J A 6 Q T K 5\n2 2\n2 3 4 J 2 5 0 K\n"
] |
[
"18\nblackjack\n21\nbust\n",
"18\nblackjack\n17\nbust\n",
"18\nblackjack\nbust\nbust\n",
"18\nblackjack\n19\nbust\n",
"18\nblackjack\n18\nbust\n",
"bust\nblackjack\n21\nbust\n",
"19\nblackjack\n17\nbust\n",
"bust\nblackjack\nbust\nbust\n",
"bust\nblackjack\n18\nbust\n",
"20\nblackjack\n21\nbust\n"
] |
CodeContests
|
Problem
There are n vertices that are not connected to any of the vertices.
An undirected side is stretched between each vertex.
Find out how many sides can be stretched when the diameter is set to d.
The diameter represents the largest of the shortest distances between two vertices.
Here, the shortest distance is the minimum value of the number of sides required to move between vertices.
Multiple edges and self-loops are not allowed.
Constraints
* 2 ≤ n ≤ 109
* 1 ≤ d ≤ n−1
Input
n d
Two integers n and d are given on one line, separated by blanks.
Output
Output the maximum number of sides that can be stretched on one line.
Examples
Input
4 3
Output
3
Input
5 1
Output
10
Input
4 2
Output
5
|
stdin
| null | 230 | 1 |
[
"4 2\n",
"5 1\n",
"4 3\n"
] |
[
"5\n",
"10\n",
"3\n"
] |
[
"0 1\n",
"4 5\n",
"6 5\n",
"0 2\n",
"4 1\n",
"-1 1\n",
"6 9\n",
"0 8\n",
"8 1\n",
"6 3\n"
] |
[
"0\n",
"2\n",
"5\n",
"-1\n",
"6\n",
"1\n",
"7\n",
"26\n",
"28\n",
"10\n"
] |
CodeContests
|
It is lunch time at the Vibrant Gujarat Summit and all the investors are called for the executive lunch. When Bruce reached the lunch area, he found that the waiter was taking out bowls from a big box containing some amount of golden bowls and other bronze bowls. The bowls were taken out at random. Each dish contains exactly one bowl. Bruce and Robin are the first ones to receive the dishes.
Bruce believes that there is a 50/50 chance in everything. He tells Robin that the there is a 50% chance of both of them receiving a golden bowl. Robin is confused and doesn't know how is that possible. He asks Bruce what makes him think so. Bruce says that he would have to find the answer himself and so in order to make things interesting he tells Robin the total number of bowls the waiter has in the box. All Robin has to do is now find the number of golden bowls there should be in the box in order for it to be a 50% probability.
Input:
Only one integer number, N, telling the number of bowls in the box.
Output:
The number of golden bowls required for it to be a 50% probability of both of them receiving a golden bowl.
Constraints:
1 ≤ N ≤ 10^15
SAMPLE INPUT
21
SAMPLE OUTPUT
15
Explanation
As Bruce and Robin are the first ones to receive the bowls, if there are 15 golden bowls then the probability for the first person to get a golden one is 15/21 and the second one is 14/20.
(15/21)*(14/20) = 0.5
|
stdin
| null | 1,156 | 1 |
[
"21\n\nSAMPLE\n"
] |
[
"15\n"
] |
[
"21\n\nSAMELP\n",
"21\n\nSAMEKP\n",
"21\n\nS@MEKP\n",
"21\n\nPKEM@S\n",
"21\n\nSKEM@P\n",
"21\n\nSKEM@O\n",
"21\n\nO@MEKS\n",
"21\n\nOAMEKS\n",
"21\n\nSJEM@O\n",
"21\n\nSJ@MEO\n"
] |
[
"15\n",
"15\n",
"15\n",
"15\n",
"15\n",
"15\n",
"15\n",
"15\n",
"15\n",
"15\n"
] |
CodeContests
|
Sometimes mysteries happen. Chef found a directed graph with N vertices and M edges in his kitchen!
The evening was boring and chef has nothing else to do, so to entertain himself, Chef thought about a question "What is the minimum number of edges he needs to reverse in order to have at least one path from vertex 1 to vertex N, where the vertices are numbered from 1 to N.
Input
Each test file contains only one test case.
The first line of the input contains two space separated integers N and M, denoting the number of vertices and the number of edges in the graph respectively. The i^th line of the next M lines contains two space separated integers Xi and Yi, denoting that the i^th edge connects vertices from Xi to Yi.
Output
In a single line, print the minimum number of edges we need to revert. If there is no way of having at least one path from 1 to N, print -1.
Constraints
1 ≤ N, M ≤ 100000 = 10^5
1 ≤ Xi, Yi ≤ N
There can be multiple edges connecting the same pair of vertices, There can be self loops too i.e. Xi = Yi
Example
Input:
7 7
1 2
3 2
3 4
7 4
6 2
5 6
7 5
Output:
2
Explanation
We can consider two paths from 1 to 7:
1-2-3-4-7
1-2-6-5-7
In the first one we need to revert edges (3-2), (7-4). In the second one - (6-2), (5-6), (7-5). So the answer is min(2, 3) = 2.
|
stdin
| null | 753 | 1 |
[
"7 7\n1 2 \n3 2\n3 4\n7 4\n6 2\n5 6\n7 5\n"
] |
[
"2\n"
] |
[
"7 7\n1 2 \n4 2\n3 4\n7 4\n6 2\n5 6\n7 5\n",
"9 7\n1 2 \n4 2\n3 4\n7 4\n6 2\n5 6\n7 5\n",
"7 7\n1 2 \n3 2\n2 4\n7 4\n6 2\n5 6\n7 5\n",
"7 7\n1 2 \n3 2\n2 4\n4 4\n6 2\n5 6\n7 5\n",
"8 7\n1 4 \n2 2\n3 4\n7 4\n6 2\n4 8\n7 6\n",
"7 7\n1 2 \n3 2\n3 4\n7 4\n6 2\n5 6\n5 5\n",
"7 7\n1 2 \n3 2\n3 4\n7 4\n6 2\n5 3\n5 5\n",
"7 7\n1 2 \n3 2\n3 4\n7 4\n1 2\n5 3\n5 5\n",
"10 7\n1 2 \n4 2\n3 4\n7 4\n6 2\n5 6\n7 5\n",
"7 7\n1 1 \n3 2\n3 4\n7 4\n6 2\n5 3\n5 5\n"
] |
[
"2\n",
"-1\n",
"1\n",
"3\n",
"0\n",
"2\n",
"2\n",
"2\n",
"-1\n",
"-1\n"
] |
CodeContests
|
A game is played on a strip consisting of N cells consecutively numbered from 1 to N.
Alice has her token on cell A. Borys has his token on a different cell B.
Players take turns, Alice moves first. The moving player must shift his or her token from its current cell X to the neighboring cell on the left, cell X-1, or on the right, cell X+1. Note that it's disallowed to move the token outside the strip or to the cell with the other player's token. In one turn, the token of the moving player must be shifted exactly once.
The player who can't make a move loses, and the other player wins.
Both players want to win. Who wins if they play optimally?
Constraints
* 2 \leq N \leq 100
* 1 \leq A < B \leq N
* All input values are integers.
Input
Input is given from Standard Input in the following format:
N A B
Output
Print `Alice` if Alice wins, `Borys` if Borys wins, and `Draw` if nobody wins.
Examples
Input
5 2 4
Output
Alice
Input
2 1 2
Output
Borys
Input
58 23 42
Output
Borys
|
stdin
| null | 4,744 | 1 |
[
"58 23 42\n",
"2 1 2\n",
"5 2 4\n"
] |
[
"Borys\n",
"Borys\n",
"Alice\n"
] |
[
"9 23 42\n",
"8 2 4\n",
"3 1 2\n",
"9 23 18\n",
"3 2 2\n",
"8 2 3\n",
"9 23 23\n",
"0 2 2\n",
"7 2 3\n",
"9 44 23\n"
] |
[
"Borys\n",
"Alice\n",
"Borys\n",
"Borys\n",
"Alice\n",
"Borys\n",
"Alice\n",
"Alice\n",
"Borys\n",
"Borys\n"
] |
CodeContests
|
Peter is a senior manager of Agile Change Management (ACM) Inc., where each employee is a member of one or more task groups. Since ACM is agile, task groups are often reorganized and their members frequently change, so membership management is his constant headache.
Peter updates the membership information whenever any changes occur: for instance, the following line written by him means that Carol and Alice are the members of the Design Group.
design:carol,alice.
The name preceding the colon is the group name and the names following it specify its members.
A smaller task group may be included in a larger one. So, a group name can appear as a member of another group, for instance, as follows.
development:alice,bob,design,eve.
Simply unfolding the design above gives the following membership specification, which is equivalent to the original.
development:alice,bob,carol,alice,eve.
In this case, however, alice occurs twice. After removing one of the duplicates, we have the following more concise specification.
development:alice,bob,carol,eve.
Your mission in this problem is to write a program that, given group specifications, identifies group members.
Note that Peter's specifications can include deeply nested groups. In the following, for instance, the group one contains a single member dave.
one:another.
another:yetanother.
yetanother:dave.
Input
The input is a sequence of datasets, each being in the following format.
n
group1:member1,1,...,member1,m1.
.
.
.
groupi:memberi,1,...,memberi,mi.
.
.
.
groupn:membern,1,...,membern,mn.
The first line contains n, which represents the number of groups and is a positive integer no more than 100. Each of the following n lines contains the membership information of a group: groupi (1 ≤ i ≤ n) is the name of the i-th task group and is followed by a colon (:) and then the list of its mi member s that are delimited by a comma (,) and terminated by a period (.).
Those group names are mutually different. Each mi (1 ≤ i ≤ n) is between 1 and 10, inclusive. A member is another group name if it is one of group1, group2,..., or groupn. Otherwise it is an employee name.
There are no circular (or recursive) definitions of group(s). You may assume that mi member names of a group are mutually different.
Each group or employee name is a non-empty character string of length between 1 and 15, inclusive, and consists of lowercase letters.
The end of the input is indicated by a line containing a zero.
Output
For each dataset, output the number of employees included in the first group of the dataset, that is group1, in a line. No extra characters should occur in the output.
Example
Input
2
development:alice,bob,design,eve.
design:carol,alice.
3
one:another.
another:yetanother.
yetanother:dave.
3
friends:alice,bob,bestfriends,carol,fran,badcompany.
bestfriends:eve,alice.
badcompany:dave,carol.
5
a:b,c,d,e.
b:c,d,e,f.
c:d,e,f,g.
d:e,f,g,h.
e:f,g,h,i.
4
aa:bb.
cc:dd,ee.
ff:gg.
bb:cc.
0
Output
4
1
6
4
2
|
stdin
| null | 1,416 | 1 |
[
"2\ndevelopment:alice,bob,design,eve.\ndesign:carol,alice.\n3\none:another.\nanother:yetanother.\nyetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n0\n"
] |
[
"4\n1\n6\n4\n2\n"
] |
[
"2\ndevelopment:alice,bob,design,eve.\ndesign:carol,alice.\n3\none:another.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n0\n",
"2\ndevelopment:alice,bob,design,eve.\ndesign:carol,amice.\n3\none:another.\nanother:yetanother.\nyetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n0\n",
"2\ndevelopment:alice,bob,design,eve.\noesign:cardl,alice.\n3\nohe:anotner.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ndc:dd,ee.\nff:gg.\nbb:cc.\n0\n",
"2\ndevelopment:alice,bob,desifn,eve.\ndesign:carol,alice.\n3\none:anotheq.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,bbdcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n0\na:b,c,d,e.\nb:c,e,d,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,h,i,h.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n0\n",
"2\ndevelopment:alice,bob,design,eve.\ndesign:carol,alice.\n3\nohe:anotner.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alire,bob,bestfriends,carol,fcan,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n0\n",
"2\ndevelopment:alice,bob,desifn,eve.\ndesign:carol,alice.\n3\none:anotheq.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,bbdcompany.\nbestfriends:eve,aljce.\nbadcompany:dave,carol.\n0\na:b,c,d,e.\nb:c,e,d,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,h,i,h.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n1\n",
"2\ndevelopment:alice,bob,desifn,eve.\ndesign:carol,alice.\n3\noneoan:theq.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,e,d,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,h,h,i.\n0\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:bc.\n0\n",
"2\ndevelopment:alice,bob,design,eve.\noesign:cardl,alice.\n3\nohe:anotner.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carnl.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ndc:dd,ee.\nff:gh.\nbb:cc.\n0\n",
"2\ndevelopment:alice,bob,design,eve.\ndesign:carol,amice.\n3\none:another.\nanother:yetanother.\nyetanother:dave.\n3\nfriends:alice,bob,bestfriends,carol,fran,badcompany.\nbestfrjends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,e,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:dc.\n0\n",
"2\ndevelopment:alice,bob,desifn,eve.\ndesign:carol,alice.\n0\none:another.\nanother:yetanother.\nxetanother:dave.\n3\nfriends:akice,bob,bestfriends,carol,fran,badcompany.\nbestfriends:eve,alice.\nbadcompany:dave,carol.\n5\na:b,c,d,e.\nb:c,d,e,f.\nc:d,e,f,g.\nd:e,f,g,h.\ne:f,g,h,i.\n4\naa:bb.\ncc:dd,ee.\nff:gg.\nbb:cc.\n0\n"
] |
[
"4\n1\n6\n4\n2\n",
"5\n1\n6\n4\n2\n",
"4\n1\n6\n4\n1\n",
"4\n1\n6\n",
"4\n1\n7\n4\n2\n",
"4\n1\n7\n",
"4\n1\n6\n4\n",
"4\n1\n7\n4\n1\n",
"5\n1\n6\n4\n1\n",
"4\n"
] |
CodeContests
|
Problem Statement
You are given a connected undirected graph which has even numbers of nodes. A connected graph is a graph in which all nodes are connected directly or indirectly by edges.
Your task is to find a spanning tree whose median value of edges' costs is minimum. A spanning tree of a graph means that a tree which contains all nodes of the graph.
Input
The input consists of multiple datasets.
The format of each dataset is as follows.
n m
s_1 t_1 c_1
...
s_m t_m c_m
The first line contains an even number n (2 \leq n \leq 1,000) and an integer m (n-1 \leq m \leq 10,000). n is the nubmer of nodes and m is the number of edges in the graph.
Then m lines follow, each of which contains s_i (1 \leq s_i \leq n), t_i (1 \leq s_i \leq n, t_i \neq s_i) and c_i (1 \leq c_i \leq 1,000). This means there is an edge between the nodes s_i and t_i and its cost is c_i. There is no more than one edge which connects s_i and t_i.
The input terminates when n=0 and m=0. Your program must not output anything for this case.
Output
Print the median value in a line for each dataset.
Example
Input
2 1
1 2 5
4 6
1 2 1
1 3 2
1 4 3
2 3 4
2 4 5
3 4 6
8 17
1 4 767
3 1 609
8 3 426
6 5 972
8 1 607
6 4 51
5 1 683
3 6 451
3 4 630
8 7 912
3 7 43
4 7 421
3 5 582
8 4 538
5 7 832
1 6 345
8 2 608
0 0
Output
5
2
421
|
stdin
| null | 2,578 | 1 |
[
"2 1\n1 2 5\n4 6\n1 2 1\n1 3 2\n1 4 3\n2 3 4\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n"
] |
[
"5\n2\n421\n"
] |
[
"2 1\n1 2 5\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 4\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 5\n4 6\n1 2 1\n1 3 2\n1 4 3\n2 3 7\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 1\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 4\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 5\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 4\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 33\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 5\n4 6\n1 2 1\n1 3 2\n1 4 3\n2 3 4\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 305\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 5\n4 6\n2 2 1\n1 3 2\n1 4 6\n2 3 4\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 972\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 43\n4 7 421\n3 5 33\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 5\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 6\n2 4 5\n3 1 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 1132\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 8 630\n8 7 912\n3 7 20\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 1 345\n8 2 608\n0 0\n",
"2 1\n1 2 4\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 6\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 934\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 20\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 4\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 6\n2 4 5\n3 4 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 934\n8 1 607\n6 6 51\n5 1 683\n3 6 451\n3 4 630\n8 7 912\n3 7 20\n4 7 421\n3 5 582\n8 4 538\n5 7 832\n1 6 345\n8 2 608\n0 0\n",
"2 1\n1 2 5\n4 6\n2 2 1\n1 3 2\n1 4 3\n2 3 6\n2 4 1\n3 1 6\n8 17\n1 4 767\n3 1 609\n8 3 426\n6 5 1132\n8 1 607\n6 4 51\n5 1 683\n3 6 451\n3 8 630\n8 7 912\n3 7 20\n4 7 421\n3 7 582\n8 4 538\n5 7 832\n1 1 345\n8 2 608\n0 0\n"
] |
[
"5\n3\n421\n",
"5\n2\n421\n",
"1\n3\n421\n",
"5\n3\n345\n",
"5\n2\n345\n",
"5\n4\n345\n",
"5\n3\n426\n",
"4\n3\n421\n",
"4\n3\n426\n",
"5\n2\n426\n"
] |
CodeContests
|
DJ Boy is a new generation child he has never seen numeric keypad of mobile. So one day when Prem showed him his mobile, DJ boy started laughing on him. Prem being smart gave him a problem to solve with some condition. Your task is to help DJ boy to solve this problem:
Given a number N, DJ boy has to tell how many numbers of length N are possible.
Conditions:
1)He can only press digit that are adjacent i.e. to the left, right, up or bottom to current digit.
2)He may press the same key again i.e. numbers like 000 & 080 are possible for length 3.
3)He cannot press * and # keys.
Constraints:
1 ≤ t ≤ 100
0 ≤ N ≤ 10000
MOD: 10^9 + 9
Input:
First line contains T,the number of test cases.
Next t lines contain a number N.
Output:
Print the required number modulo MOD.
SAMPLE INPUT
2
1
2
SAMPLE OUTPUT
10
36
|
stdin
| null | 1,037 | 1 |
[
"2\n1\n2\n\nSAMPLE\n"
] |
[
"10\n36\n"
] |
[
"100\n0\n1\n10000\n0\n3\n10\n8973\n6202\n4625\n5469\n2038\n5916\n3405\n5533\n7004\n2469\n9853\n4992\n361\n9819\n3294\n7195\n4036\n9404\n8767\n5404\n1711\n3214\n3100\n3751\n2139\n5437\n4993\n1759\n9572\n6270\n3789\n9623\n2472\n9493\n6170\n5589\n5408\n9576\n2200\n2411\n3123\n2052\n8482\n3484\n2949\n2855\n1758\n6985\n3337\n524\n3468\n5048\n4818\n6568\n8800\n6957\n3083\n4871\n8716\n3733\n1140\n2504\n3356\n3612\n3076\n604\n279\n8484\n1258\n2479\n1974\n5461\n5610\n455\n8945\n8560\n4389\n1781\n6623\n7727\n3385\n1169\n2774\n8203\n7737\n2652\n6238\n820\n7523\n4953\n4553\n8664\n8536\n8988\n",
"2\n1\n2\n\nPAMSLE\n",
"100\n0\n1\n10000\n0\n3\n10\n8973\n6202\n4625\n5469\n2038\n5916\n3405\n5533\n7004\n2469\n9853\n4992\n361\n9819\n3294\n7195\n4036\n9404\n8767\n5404\n1711\n3214\n3100\n3751\n2139\n5437\n4993\n1759\n9572\n6270\n3789\n9623\n2472\n9493\n6170\n5589\n5408\n9576\n2200\n2411\n3123\n2052\n8482\n3484\n2949\n2855\n1758\n6985\n3337\n524\n3468\n5048\n4818\n6568\n8800\n6957\n3083\n4871\n8716\n3733\n1140\n2504\n3356\n3612\n3076\n604\n279\n8484\n1258\n2479\n1974\n5461\n5610\n455\n8945\n4383\n4389\n1781\n6623\n7727\n3385\n1169\n2774\n8203\n7737\n2652\n6238\n820\n7523\n4953\n4553\n8664\n8536\n8988\n",
"2\n1\n0\n\nPAMSLE\n",
"100\n0\n1\n10000\n0\n3\n10\n8973\n6202\n4625\n5469\n2038\n5916\n3405\n5533\n7004\n2469\n9853\n4992\n361\n9819\n3294\n7195\n4036\n9404\n8767\n5404\n1711\n3214\n3100\n3751\n2139\n5437\n4993\n1759\n9572\n6270\n3789\n9623\n2472\n9493\n6170\n5589\n5408\n9576\n2200\n2411\n3123\n2052\n8482\n3484\n2949\n2855\n1758\n6985\n3337\n524\n3468\n5048\n4818\n6568\n8800\n6957\n3083\n4871\n8716\n3733\n1140\n2504\n3356\n3612\n3076\n604\n279\n8484\n1258\n2479\n1974\n5461\n5610\n455\n8945\n4383\n4389\n1781\n6623\n7727\n3385\n1169\n2774\n8203\n7737\n2652\n6238\n311\n7523\n4953\n4553\n8664\n8536\n8988\n",
"2\n1\n1\n\nPAMSLE\n",
"100\n-1\n1\n10000\n0\n3\n10\n8973\n6202\n4625\n5469\n2038\n5916\n3405\n5533\n7004\n2469\n9853\n4992\n361\n9819\n3294\n7195\n4036\n9404\n8767\n5404\n1711\n3214\n3100\n3751\n2139\n5437\n4993\n1759\n9572\n6270\n3789\n9623\n2472\n9493\n6170\n5589\n5408\n9576\n2200\n2411\n3123\n2052\n8482\n3484\n2949\n2855\n1758\n6985\n3337\n524\n3468\n5048\n4818\n6568\n8800\n6957\n3083\n4871\n8716\n3733\n1140\n2504\n3356\n3612\n3076\n604\n279\n8484\n1258\n2479\n1974\n5461\n5610\n455\n8945\n4383\n4389\n1781\n6623\n7727\n3385\n1169\n2774\n8203\n7737\n2652\n6238\n311\n7523\n4953\n4553\n8664\n8536\n8988\n",
"2\n0\n1\n\nPAMSLE\n",
"100\n-1\n1\n10000\n0\n3\n10\n8973\n6202\n4625\n4956\n2038\n5916\n3405\n5533\n7004\n2469\n9853\n4992\n361\n9819\n3294\n7195\n4036\n9404\n8767\n5404\n1711\n3214\n3100\n3751\n2139\n5437\n4993\n1759\n9572\n6270\n3789\n9623\n2472\n9493\n6170\n5589\n5408\n9576\n2200\n2411\n3123\n2052\n8482\n3484\n2949\n2855\n1758\n6985\n3337\n524\n3468\n5048\n4818\n6568\n8800\n6957\n3083\n4871\n8716\n3733\n1140\n2504\n3356\n3612\n3076\n604\n279\n8484\n1258\n2479\n1974\n5461\n5610\n455\n8945\n4383\n4389\n1781\n6623\n7727\n3385\n1169\n2774\n8203\n7737\n2652\n6238\n311\n7523\n4953\n4553\n8664\n8536\n8988\n",
"100\n-1\n1\n10000\n0\n3\n10\n8973\n6202\n4625\n2968\n2038\n5916\n3405\n5533\n7004\n2469\n9853\n4992\n361\n9819\n3294\n7195\n4036\n9404\n8767\n5404\n1711\n3214\n3100\n3751\n2139\n5437\n4993\n1759\n9572\n6270\n3789\n9623\n2472\n9493\n6170\n5589\n5408\n9576\n2200\n2411\n3123\n2052\n8482\n3484\n2949\n2855\n1758\n6985\n3337\n524\n3468\n5048\n4818\n6568\n8800\n6957\n3083\n4871\n8716\n3733\n1140\n2504\n3356\n3612\n3076\n604\n279\n8484\n1258\n2479\n1974\n5461\n5610\n455\n8945\n4383\n4389\n1781\n6623\n7727\n3385\n1169\n2774\n8203\n7737\n2652\n6238\n311\n7523\n4953\n4553\n8664\n8536\n8988\n"
] |
[
"0\n10\n68035405\n0\n138\n1806282\n799804923\n614417274\n488239572\n736488742\n760757087\n599480893\n589709762\n231163758\n23665099\n769123789\n71398755\n120410212\n92450581\n636305854\n780163537\n753406317\n172894851\n602024898\n811389696\n575085933\n353026054\n69307997\n167259556\n905823610\n237945781\n13571345\n185417905\n606929918\n51071759\n544895473\n242296457\n209498771\n879065993\n844859129\n284173183\n787418802\n792982558\n905973874\n138508161\n712808637\n976561149\n66883904\n213247879\n870017062\n299913859\n314122788\n750456647\n383485878\n183320425\n706312346\n525018013\n633533672\n948221219\n178589900\n581589386\n545509751\n398910183\n227478076\n444766090\n772760475\n943743896\n489934438\n142480147\n980888325\n699446347\n417584802\n360665918\n398010958\n604293860\n305358736\n182708964\n158413967\n758072494\n115920170\n53871862\n753576819\n705191169\n603490951\n518991133\n377631676\n268111018\n900057226\n37348617\n776531938\n384963580\n507358970\n279398728\n525281633\n368927902\n613485196\n779310462\n57324162\n129262880\n165697266\n",
"10\n36\n",
"0\n10\n68035405\n0\n138\n1806282\n799804923\n614417274\n488239572\n736488742\n760757087\n599480893\n589709762\n231163758\n23665099\n769123789\n71398755\n120410212\n92450581\n636305854\n780163537\n753406317\n172894851\n602024898\n811389696\n575085933\n353026054\n69307997\n167259556\n905823610\n237945781\n13571345\n185417905\n606929918\n51071759\n544895473\n242296457\n209498771\n879065993\n844859129\n284173183\n787418802\n792982558\n905973874\n138508161\n712808637\n976561149\n66883904\n213247879\n870017062\n299913859\n314122788\n750456647\n383485878\n183320425\n706312346\n525018013\n633533672\n948221219\n178589900\n581589386\n545509751\n398910183\n227478076\n444766090\n772760475\n943743896\n489934438\n142480147\n980888325\n699446347\n417584802\n360665918\n398010958\n604293860\n305358736\n182708964\n158413967\n758072494\n115920170\n53871862\n49306624\n705191169\n603490951\n518991133\n377631676\n268111018\n900057226\n37348617\n776531938\n384963580\n507358970\n279398728\n525281633\n368927902\n613485196\n779310462\n57324162\n129262880\n165697266\n",
"10\n0\n",
"0\n10\n68035405\n0\n138\n1806282\n799804923\n614417274\n488239572\n736488742\n760757087\n599480893\n589709762\n231163758\n23665099\n769123789\n71398755\n120410212\n92450581\n636305854\n780163537\n753406317\n172894851\n602024898\n811389696\n575085933\n353026054\n69307997\n167259556\n905823610\n237945781\n13571345\n185417905\n606929918\n51071759\n544895473\n242296457\n209498771\n879065993\n844859129\n284173183\n787418802\n792982558\n905973874\n138508161\n712808637\n976561149\n66883904\n213247879\n870017062\n299913859\n314122788\n750456647\n383485878\n183320425\n706312346\n525018013\n633533672\n948221219\n178589900\n581589386\n545509751\n398910183\n227478076\n444766090\n772760475\n943743896\n489934438\n142480147\n980888325\n699446347\n417584802\n360665918\n398010958\n604293860\n305358736\n182708964\n158413967\n758072494\n115920170\n53871862\n49306624\n705191169\n603490951\n518991133\n377631676\n268111018\n900057226\n37348617\n776531938\n384963580\n507358970\n279398728\n238770497\n368927902\n613485196\n779310462\n57324162\n129262880\n165697266\n",
"10\n10\n",
"68035405\n10\n68035405\n0\n138\n1806282\n799804923\n614417274\n488239572\n736488742\n760757087\n599480893\n589709762\n231163758\n23665099\n769123789\n71398755\n120410212\n92450581\n636305854\n780163537\n753406317\n172894851\n602024898\n811389696\n575085933\n353026054\n69307997\n167259556\n905823610\n237945781\n13571345\n185417905\n606929918\n51071759\n544895473\n242296457\n209498771\n879065993\n844859129\n284173183\n787418802\n792982558\n905973874\n138508161\n712808637\n976561149\n66883904\n213247879\n870017062\n299913859\n314122788\n750456647\n383485878\n183320425\n706312346\n525018013\n633533672\n948221219\n178589900\n581589386\n545509751\n398910183\n227478076\n444766090\n772760475\n943743896\n489934438\n142480147\n980888325\n699446347\n417584802\n360665918\n398010958\n604293860\n305358736\n182708964\n158413967\n758072494\n115920170\n53871862\n49306624\n705191169\n603490951\n518991133\n377631676\n268111018\n900057226\n37348617\n776531938\n384963580\n507358970\n279398728\n238770497\n368927902\n613485196\n779310462\n57324162\n129262880\n165697266\n",
"0\n10\n",
"68035405\n10\n68035405\n0\n138\n1806282\n799804923\n614417274\n488239572\n240677668\n760757087\n599480893\n589709762\n231163758\n23665099\n769123789\n71398755\n120410212\n92450581\n636305854\n780163537\n753406317\n172894851\n602024898\n811389696\n575085933\n353026054\n69307997\n167259556\n905823610\n237945781\n13571345\n185417905\n606929918\n51071759\n544895473\n242296457\n209498771\n879065993\n844859129\n284173183\n787418802\n792982558\n905973874\n138508161\n712808637\n976561149\n66883904\n213247879\n870017062\n299913859\n314122788\n750456647\n383485878\n183320425\n706312346\n525018013\n633533672\n948221219\n178589900\n581589386\n545509751\n398910183\n227478076\n444766090\n772760475\n943743896\n489934438\n142480147\n980888325\n699446347\n417584802\n360665918\n398010958\n604293860\n305358736\n182708964\n158413967\n758072494\n115920170\n53871862\n49306624\n705191169\n603490951\n518991133\n377631676\n268111018\n900057226\n37348617\n776531938\n384963580\n507358970\n279398728\n238770497\n368927902\n613485196\n779310462\n57324162\n129262880\n165697266\n",
"68035405\n10\n68035405\n0\n138\n1806282\n799804923\n614417274\n488239572\n691540661\n760757087\n599480893\n589709762\n231163758\n23665099\n769123789\n71398755\n120410212\n92450581\n636305854\n780163537\n753406317\n172894851\n602024898\n811389696\n575085933\n353026054\n69307997\n167259556\n905823610\n237945781\n13571345\n185417905\n606929918\n51071759\n544895473\n242296457\n209498771\n879065993\n844859129\n284173183\n787418802\n792982558\n905973874\n138508161\n712808637\n976561149\n66883904\n213247879\n870017062\n299913859\n314122788\n750456647\n383485878\n183320425\n706312346\n525018013\n633533672\n948221219\n178589900\n581589386\n545509751\n398910183\n227478076\n444766090\n772760475\n943743896\n489934438\n142480147\n980888325\n699446347\n417584802\n360665918\n398010958\n604293860\n305358736\n182708964\n158413967\n758072494\n115920170\n53871862\n49306624\n705191169\n603490951\n518991133\n377631676\n268111018\n900057226\n37348617\n776531938\n384963580\n507358970\n279398728\n238770497\n368927902\n613485196\n779310462\n57324162\n129262880\n165697266\n"
] |
CodeContests
|
The Onogawa Expedition is planning to conduct a survey of the Aizu nature reserve. The expedition planner wants to take the shortest possible route from the start to end point of the survey, while the expedition has to go around the coast of the Lake of Onogawa en route. The expedition walks along the coast of the lake, but can not wade across the lake.
Based on the base information including the start and end point of the survey and the area of Lake Onogawa as convex polygon data, make a program to find the shortest possible route for the expedition and calculate its distance. Note that the expedition can move along the polygonal lines passing through the nodes, but never enter within the area enclosed by the polygon.
Input
The input is given in the following format.
x_s y_s
x_g y_g
N
x_1 y_1
x_2 y_2
:
x_N y_N
The first line provides the start point of the survey x_s,y_s (0≤x_s,y_s≤104), and the second line provides the end point x_g,y_g (0 ≤ x_g,y_g ≤ 104) all in integers. The third line provides the number of apexes N (3 ≤ N ≤ 100) of the polygon that represents the lake, and each of the subsequent N lines provides the coordinate of the i-th apex x_i,y_i (0 ≤ x_i,y_i ≤ 104) in counter-clockwise order. These data satisfy the following criteria:
* Start and end points of the expedition are not within the area enclosed by the polygon nor on boundaries.
* Start and end points of the expedition are not identical, i.e., x_s ≠ x_g or y_s ≠ y_g.
* No duplicate coordinates are given, i.e., if i ≠ j then x_i ≠ x_r or y_i ≠ y_j.
* The area enclosed by the polygon has a positive value.
* Any three coordinates that define an area are not aligned on a line.
Output
Output the distance of the shortest possible expedition route. Any number of decimal places can be selected as long as the error does not exceed ± 10-3.
Examples
Input
0 0
4 0
4
1 1
2 1
3 3
1 2
Output
4.472136
Input
4 4
0 0
4
1 1
3 1
3 3
1 3
Output
6.32455
|
stdin
| null | 3,442 | 1 |
[
"4 4\n0 0\n4\n1 1\n3 1\n3 3\n1 3\n",
"0 0\n4 0\n4\n1 1\n2 1\n3 3\n1 2\n"
] |
[
"6.32455\n",
"4.472136\n"
] |
[
"4 4\n0 0\n4\n1 1\n3 1\n2 3\n1 3\n",
"0 0\n4 1\n4\n1 1\n2 1\n3 3\n1 2\n",
"4 4\n0 0\n4\n1 1\n3 1\n4 3\n2 3\n",
"4 4\n1 0\n4\n1 1\n3 1\n4 3\n2 3\n",
"-1 0\n4 0\n4\n1 1\n2 1\n3 3\n1 2\n",
"4 4\n-1 0\n4\n1 1\n3 1\n2 3\n1 3\n",
"0 0\n4 1\n4\n1 1\n2 1\n3 3\n1 0\n",
"-2 0\n7 0\n4\n1 1\n2 1\n3 3\n1 2\n",
"-4 0\n7 0\n4\n1 1\n2 1\n3 6\n1 2\n",
"-4 0\n4 0\n4\n1 1\n2 1\n3 6\n1 2\n"
] |
[
"6.3245553203\n",
"4.2360679775\n",
"5.8416192530\n",
"5.4721359550\n",
"5.3851648071\n",
"6.7678289356\n",
"4.1622776602\n",
"9.2221251392\n",
"11.1803398875\n",
"8.2612971738\n"
] |
CodeContests
|
Problem Statement
Lira is a little girl form Bytenicut, a small and cozy village located in the country of Byteland.
As the village is located on a somewhat hidden and isolated area, little Lira is a bit lonely and she needs to invent new games that she can play for herself.
However, Lira is also very clever, so, she already invented a new game.
She has many stones with her, which she will display on groups of three stones on the ground on a triangle like shape and then, she will select two triangles, one with the smallest area and one with the largest area as the most beautiful ones.
While it's easy for Lira to "estimate" the areas of the triangles by their relative sizes, it's harder for her to actually calculate these areas.
But, it turns out, that Lira is also friends with YOU, an exceptional Mathematics student, and she knew that you would know exactly how to do such verification.
Lira also numbered the triangles from 1 to N, and now she wants to know the indices of the triangles with the smallest and largest area respectively.
It is now up to you, to help Lira and calculate the areas of the triangles and output their numbers.
Input
The first line of the input file contains an integer, N, denoting the number of triangles on the given input file.
Then N lines follow, each line containing six space-separated integers, denoting the coordinates x1, y1, x2, y2, x3, y3
Output
You should output two space separated integers, the indexes of the triangles with the smallest and largest area, respectively.
If there are multiple triangles with the same area, then the last index should be printed.
Constraints
2 ≤ N ≤ 100
-1000 ≤ xi, yi ≤ 1000
Example
Input:
2
0 0 0 100 100 0
1 1 1 5 5 1
Output:
2 1
|
stdin
| null | 4,016 | 1 |
[
"2\n0 0 0 100 100 0\n1 1 1 5 5 1\n"
] |
[
"2 1\n"
] |
[
"2\n0 0 0 100 100 0\n1 2 1 5 5 1\n",
"2\n-1 0 0 010 000 0\n1 3 0 7 14 1\n",
"2\n0 0 0 111 000 1\n1 2 0 3 2 1\n",
"2\n0 0 0 100 100 0\n1 2 1 5 5 2\n",
"2\n0 0 0 100 100 0\n1 2 1 5 9 2\n",
"2\n0 0 0 100 100 0\n1 2 1 5 9 1\n",
"2\n0 0 0 100 100 0\n1 2 1 7 9 1\n",
"2\n-1 0 0 100 100 0\n1 2 1 7 9 1\n",
"2\n-1 0 0 100 100 0\n1 2 1 7 14 1\n",
"2\n-1 0 0 110 100 0\n1 2 1 7 14 1\n"
] |
[
"2 1\n",
"1 2\n",
"2 2\n",
"2 1\n",
"2 1\n",
"2 1\n",
"2 1\n",
"2 1\n",
"2 1\n",
"2 1\n"
] |
CodeContests
|
You are given an undirected graph G. G has N vertices and M edges. The vertices are numbered from 1 through N, and the i-th edge (1 ≤ i ≤ M) connects Vertex a_i and b_i. G does not have self-loops and multiple edges.
You can repeatedly perform the operation of adding an edge between two vertices. However, G must not have self-loops or multiple edges as the result. Also, if Vertex 1 and 2 are connected directly or indirectly by edges, your body will be exposed to a voltage of 1000000007 volts. This must also be avoided.
Under these conditions, at most how many edges can you add? Note that Vertex 1 and 2 are never connected directly or indirectly in the beginning.
Constraints
* 2 ≤ N ≤ 10^5
* 0 ≤ M ≤ 10^5
* 1 ≤ a_i < b_i ≤ N
* All pairs (a_i, b_i) are distinct.
* Vertex 1 and 2 in G are not connected directly or indirectly by edges.
Input
Input is given from Standard Input in the following format:
N M
a_1 b_1
:
a_M b_M
Output
Print the maximum number of edges that can be added.
Examples
Input
4 1
1 3
Output
2
Input
2 0
Output
0
Input
9 6
1 4
1 8
2 5
3 6
4 8
5 7
Output
12
|
stdin
| null | 1,570 | 1 |
[
"4 1\n1 3\n",
"2 0\n",
"9 6\n1 4\n1 8\n2 5\n3 6\n4 8\n5 7\n"
] |
[
"2\n",
"0\n",
"12\n"
] |
[
"4 0\n1 3\n",
"9 6\n1 4\n1 8\n2 5\n3 6\n4 1\n5 7\n",
"7 0\n1 3\n",
"9 6\n1 4\n1 8\n2 5\n3 6\n4 1\n5 5\n",
"14 0\n2 3\n",
"14 1\n2 3\n",
"8 0\n2 4\n",
"6 1\n1 3\n",
"2 -1\n",
"7 1\n1 3\n"
] |
[
"3\n",
"12\n",
"15\n",
"16\n",
"78\n",
"77\n",
"21\n",
"9\n",
"1\n",
"14\n"
] |
CodeContests
|
There is a 120 minute videotape with standard recording. When I set the VCR counter to 00:00:00 with the tape completely rewound and recorded in standard recording mode, I got a certain counter value. Enter this counter value (hours, minutes, seconds), find the length of the remaining tape (recordable time), and create a program that outputs in the format of hours: minutes: seconds.
However, the input must be within 2 hours (120 minutes). The remaining amount of tape is calculated in two ways, standard recording mode and triple recording mode, and outputs two digits each for hours, minutes, and seconds as shown in the output example. If the tens digit is 0, such as "05", add "0".
input
Given multiple datasets. Each dataset is as follows.
T H S
T, H, and S are integers that represent hours, minutes, and seconds, respectively.
Input ends when T, H, and S are all -1. The number of datasets does not exceed 50.
output
For each dataset
On the first line, the hours, minutes, and seconds of the recordable time when the rest of the tape is recorded as standard, separated by half-width colons.
On the second line, the hours, minutes, and seconds of the recordable time when the rest of the tape is recorded three times are separated by half-width colons.
Please output.
Example
Input
1 30 0
-1 -1 -1
Output
00:30:00
01:30:00
|
stdin
| null | 64 | 1 |
[
"1 30 0\n-1 -1 -1\n"
] |
[
"00:30:00\n01:30:00\n"
] |
[
"1 36 0\n-1 -1 -1\n",
"0 30 0\n-1 -1 -1\n",
"0 32 0\n-1 -1 -1\n",
"1 16 0\n-1 -1 -1\n",
"0 36 0\n-1 -1 -1\n",
"0 22 0\n-1 -1 -1\n",
"0 55 0\n-1 -1 -1\n",
"0 22 1\n-1 -1 -1\n",
"0 31 1\n-1 -1 -1\n",
"0 26 1\n-1 -1 -1\n"
] |
[
"00:24:00\n01:12:00\n",
"01:30:00\n04:30:00\n",
"01:28:00\n04:24:00\n",
"00:44:00\n02:12:00\n",
"01:24:00\n04:12:00\n",
"01:38:00\n04:54:00\n",
"01:05:00\n03:15:00\n",
"01:37:59\n04:53:57\n",
"01:28:59\n04:26:57\n",
"01:33:59\n04:41:57\n"
] |
CodeContests
|
Arithmancy is Draco Malfoy's favorite subject, but what spoils it for him is that Hermione Granger is in his class, and she is better than him at it. Prime numbers are of mystical importance in Arithmancy, and Lucky Numbers even more so. Lucky Numbers are those positive integers that have at least three distinct prime factors; 30 and 42 are the first two. Malfoy's teacher has given them a positive integer n, and has asked them to find the nth lucky number. Malfoy would like to beat Hermione at this exercise, so although he is an evil git, please help him, just this once. After all, the know-it-all Hermione does need a lesson.
Input
The first line contains the number of test cases T. Each of the next T lines contains one integer n.
Output
Output T lines, containing the corresponding lucky number for that test case.
Constraints
1 ≤ T ≤ 20
1 ≤ n ≤ 1000
SAMPLE INPUT
2
1
2
SAMPLE OUTPUT
30
42
|
stdin
| null | 566 | 1 |
[
"2\n1\n2\n\nSAMPLE\n"
] |
[
"30\n42\n"
] |
[
"20\n551\n147\n704\n1\n209\n479\n15\n74\n130\n671\n254\n548\n96\n255\n534\n180\n456\n131\n844\n20\n",
"2\n1\n3\n\nSAMPLE\n",
"20\n551\n147\n704\n1\n209\n479\n15\n74\n130\n671\n254\n548\n96\n255\n189\n180\n456\n131\n844\n20\n",
"20\n551\n147\n704\n1\n209\n479\n15\n74\n130\n671\n254\n548\n96\n255\n189\n180\n456\n131\n982\n20\n",
"2\n1\n4\n\nELPMAR\n",
"2\n2\n4\n\nELPMAR\n",
"2\n4\n4\n\nELPMAR\n",
"2\n3\n4\n\nELPMAR\n",
"20\n551\n147\n704\n1\n209\n479\n15\n155\n130\n671\n254\n548\n96\n255\n534\n180\n456\n249\n844\n20\n",
"2\n2\n3\n\nSAMPLE\n"
] |
[
"1624\n588\n1989\n30\n756\n1455\n130\n357\n532\n1908\n882\n1615\n430\n884\n1584\n672\n1400\n534\n2298\n154\n",
"30\n60\n",
"1624\n588\n1989\n30\n756\n1455\n130\n357\n532\n1908\n882\n1615\n430\n884\n702\n672\n1400\n534\n2298\n154\n",
"1624\n588\n1989\n30\n756\n1455\n130\n357\n532\n1908\n882\n1615\n430\n884\n702\n672\n1400\n534\n2618\n154\n",
"30\n66\n",
"42\n66\n",
"66\n66\n",
"60\n66\n",
"1624\n588\n1989\n30\n756\n1455\n130\n609\n532\n1908\n882\n1615\n430\n884\n1584\n672\n1400\n868\n2298\n154\n",
"42\n60\n"
] |
CodeContests
|
UTF-8 is one of the methods for coding multibyte characters.
Characters are treated as bytes on the computer. If it is only English, it can be expressed in 1 byte even if the Latin alphabet, numbers and symbols are combined, but unfortunately it is not possible to express the characters used all over the world in 1 byte, so the characters are expressed using multiple bytes. There is a need.
Here, for example, when a 2-byte string of 12354 (0x3042) is assigned to the character "a", if the byte strings are arranged as they are, it is indistinguishable whether it is 2 characters with 0x30,0x42 or 1 character with 0x3042.
For this reason, UTF-8, which is a multi-byte character encoding method, overcomes this problem by making it possible to know the length of the byte string that continues in the first byte. The specific bit pattern is as follows.
Byte length | Bit pattern
--- | ---
1 | 0xxxxxxx
2 | 110yyyyx 10xxxxxx
3 | 1110yyyy 10yxxxxx 10xxxxxx
4 | 11110yyy 10yyxxxx 10xxxxxx 10xxxxxx
Here, x is an arbitrary bit of 0/1. Also, y can be any bit of 0/1, but one of them must be 1. It is assumed that all characters are 1, 2, 3, or 4-byte characters.
Here, the restriction that at least one bit of y is 1 is due to the following reasons. For example, when encoding'/' (0x2f) into a byte string, there are two methods, 0x2f and 1-byte coding, or 0xc0 0xaf and 2-byte coding, but allowing such ambiguity is for security reasons. This is because it may be a source of threats.
After hearing the above story, you were wondering how much freedom UTF-8 has. Specifically, how many combinations of bytes are possible as UTF-8 when some bits of a given byte sequence are unknown.
At this time, find the number of possible combinations of byte strings and output the remainder divided by 1,000,000.
Notes on Test Cases
Multiple datasets are given in the above input format. Create a program that outputs each data set in the above output format.
When N is 0, it indicates the end of input.
<!-
Input
N
b1
b2
...
bN
N is the number of bytes and bi is the bytes. 1 ≤ N ≤ 1000 is satisfied. For bi, eight symbols {0/1 / x} are lined up. x indicates that the bit is unknown.
Output
Output the remainder of dividing the number of possible byte string combinations by 1,000,000.
Examples
Input
1
xxxxxxxx
3
11100000
10x00000
10111111
3
11100000
10000000
10111111
4
xxxxxxxx
xxxxxxxx
xxxxxxxx
xxxxxxxx
0
Output
128
1
0
778240
Input
1
xxxxxxxx
Output
128
Input
3
11100000
10x00000
10111111
Output
1
Input
3
11100000
10000000
10111111
Output
0
Input
4
xxxxxxxx
xxxxxxxx
xxxxxxxx
xxxxxxxx
Output
778240
|
stdin
| null | 4,165 | 1 |
[
"1\nxxxxxxxx\n",
"1\nxxxxxxxx\n3\n11100000\n10x00000\n10111111\n3\n11100000\n10000000\n10111111\n4\nxxxxxxxx\nxxxxxxxx\nxxxxxxxx\nxxxxxxxx\n0\n",
"3\n11100000\n10000000\n10111111\n",
"3\n11100000\n10x00000\n10111111\n",
"4\nxxxxxxxx\nxxxxxxxx\nxxxxxxxx\nxxxxxxxx\n"
] |
[
"128\n",
"128\n1\n0\n778240\n",
"0\n",
"1\n",
"778240\n"
] |
[
"3\n11100000\n10100000\n10111111\n",
"3\n11100000\n00x00001\n10111111\n",
"3\n11000100\n10000x00\n00111111\n",
"3\n11100000\n10100000\n10110111\n",
"3\n11100000\n00x00001\n00111111\n",
"3\n11100000\n00100000\n10110111\n",
"3\n11100100\n00x00001\n00111111\n",
"3\n11100000\n00100000\n11110111\n",
"3\n11100100\n10000x00\n00111111\n",
"3\n11100000\n00100000\n11110110\n"
] |
[
"1\n",
"0\n",
"2\n",
"1\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n"
] |
CodeContests
|
Let's think about a bar rotating clockwise as if it were a twirling baton moving on a planar surface surrounded by a polygonal wall (see Figure 1).
<image>
Figure 1. A bar rotating in a polygon
Initially, an end of the bar (called "end A") is at (0,0), and the other end (called "end B") is at (0,L) where L is the length of the bar. Initially, the bar is touching the wall only at the end A.
The bar turns fixing a touching point as the center. The center changes as a new point touches the wall.
Your task is to calculate the coordinates of the end A when the bar has fully turned by the given count R.
<image>
Figure 2. Examples of turning bars
In Figure 2, some examples are shown. In cases (D) and (E), the bar is stuck prematurely (cannot rotate clockwise anymore with any point touching the wall as the center) before R rotations. In such cases, you should answer the coordinates of the end A in that (stuck) position.
You can assume the following:
> When the bar's length L changes by ε (|ε| < 0.00001), the final (x,y) coordinates will not change more than 0.0005.
Input
The input consists of multiple datasets. The number of datasets is no more than 100. The end of the input is represented by "0 0 0".
The format of each dataset is as follows:
L R N
X1 Y1
X2 Y2
...
XN YN
L is the length of the bar. The bar rotates 2π× R radians (if it is not stuck prematurely). N is the number of vertices which make the polygon.
The vertices of the polygon are arranged in a counter-clockwise order. You may assume that the polygon is simple, that is, its border never crosses or touches itself.
N, Xi and Yi are integer numbers; R and L are decimal fractions. Ranges of those values are as follows:
1.0 ≤ L ≤ 500.0,
1.0 ≤ R ≤ 10.0,
3 ≤ N ≤ 100,
-1000 ≤ Xi ≤ 1000,
-1000 ≤ Yi ≤ 1000,
X1 ≤ -1, Y1 = 0,
X2 ≥ 1, Y2 = 0.
Output
For each dataset, print one line containing x- and y-coordinates of the final position of the end A, separated by a space. The value may contain an error less than or equal to 0.001. You may print any number of digits after the decimal point.
Sample Input
4.0 2.0 8
-1 0
5 0
5 -2
7 -2
7 0
18 0
18 6
-1 6
4.0 2.0 4
-1 0
10 0
10 12
-1 12
4.0 1.0 7
-1 0
2 0
-1 -3
-1 -8
6 -8
6 6
-1 6
4.0 2.0 6
-1 0
10 0
10 3
7 3
7 5
-1 5
5.0 2.0 6
-1 0
2 0
2 -4
6 -4
6 6
-1 6
6.0 1.0 8
-1 0
8 0
7 2
9 2
8 4
11 4
11 12
-1 12
0 0 0
Output for the Sample Input
16.0 0.0
9.999999999999998 7.4641016151377535
0.585786437626906 -5.414213562373095
8.0 0.0
6.0 0.0
9.52786404500042 4.0
Note that the above sample input corresponds to the cases in Figure 2. For convenience, in Figure 3, we will show an animation and corresponding photographic playback for the case (C).
<image>
<image> | <image> | <image> | <image> | <image> | <image> | <image> | <image> | <image>
---|---|---|---|---|---|---|---|---
Figure 3. Animation and photographic playback for case (C)
Example
Input
4.0 2.0 8
-1 0
5 0
5 -2
7 -2
7 0
18 0
18 6
-1 6
4.0 2.0 4
-1 0
10 0
10 12
-1 12
4.0 1.0 7
-1 0
2 0
-1 -3
-1 -8
6 -8
6 6
-1 6
4.0 2.0 6
-1 0
10 0
10 3
7 3
7 5
-1 5
5.0 2.0 6
-1 0
2 0
2 -4
6 -4
6 6
-1 6
6.0 1.0 8
-1 0
8 0
7 2
9 2
8 4
11 4
11 12
-1 12
0 0 0
Output
16.0 0.0
9.999999999999998 7.4641016151377535
0.585786437626906 -5.414213562373095
8.0 0.0
6.0 0.0
9.52786404500042 4.0
|
stdin
| null | 2,892 | 1 |
[
"4.0 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n-1 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -3\n-1 -8\n6 -8\n6 6\n-1 6\n4.0 2.0 6\n-1 0\n10 0\n10 3\n7 3\n7 5\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.0 8\n-1 0\n8 0\n7 2\n9 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n"
] |
[
"16.0 0.0\n9.999999999999998 7.4641016151377535\n0.585786437626906 -5.414213562373095\n8.0 0.0\n6.0 0.0\n9.52786404500042 4.0\n"
] |
[
"4.0 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -3\n-1 -8\n6 -8\n6 6\n-1 6\n4.0 2.0 6\n-1 0\n10 0\n10 3\n7 3\n7 5\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.0 8\n-1 0\n8 0\n7 2\n9 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.0 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n-1 -8\n6 -8\n6 6\n-1 6\n4.0 2.0 6\n-1 0\n10 0\n10 3\n7 3\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.0 8\n-1 0\n8 0\n7 2\n15 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.084383855678979 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n-1 -8\n6 -8\n6 6\n-1 6\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 3\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.0 8\n-1 0\n8 0\n7 2\n15 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.084383855678979 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n-1 -8\n6 -8\n6 6\n-1 11\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 3\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.6040485949053158 8\n-1 0\n8 0\n7 2\n20 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.084383855678979 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n-1 -8\n6 -8\n6 6\n-1 11\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 6\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.6040485949053158 8\n-1 0\n8 0\n7 2\n20 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.084383855678979 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.4463738836552484 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n0 -8\n6 -8\n6 6\n-1 11\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 6\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.6040485949053158 8\n-1 0\n8 0\n7 2\n20 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.084383855678979 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n2 0\n18 6\n-1 6\n4.0 2.4463738836552484 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n0 -8\n6 -8\n6 6\n-1 11\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 6\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.6040485949053158 8\n-1 0\n8 0\n7 2\n20 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.084383855678979 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n2 0\n18 6\n-1 6\n4.0 2.4463738836552484 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -2\n0 -8\n6 -8\n6 6\n-1 5\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 6\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.6040485949053158 8\n-1 0\n8 0\n4 2\n20 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.0 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-1 -3\n-1 -8\n6 -8\n6 6\n-1 6\n4.0 2.0 6\n-1 0\n10 0\n10 3\n7 3\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.0 8\n-1 0\n4 0\n7 2\n15 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n",
"4.0 2.0 8\n-1 0\n5 0\n5 -2\n7 -2\n7 0\n18 0\n18 6\n-1 6\n4.0 2.0 4\n-1 0\n10 0\n10 12\n0 12\n4.0 1.0 7\n-1 0\n2 0\n-2 -2\n-1 -8\n6 -8\n6 6\n-1 6\n4.0 2.0 6\n0 0\n10 0\n10 3\n7 3\n14 4\n-1 5\n5.0 2.0 6\n-1 0\n2 0\n2 -4\n6 -4\n6 6\n-1 6\n6.0 1.0 8\n-1 0\n8 0\n7 2\n15 2\n8 4\n11 4\n11 12\n-1 12\n0 0 0\n"
] |
[
"16.000000 0.000000\n10.000000 7.464102\n0.585786 -5.414214\n8.000000 0.000000\n6.000000 0.000000\n9.527864 4.000000\n",
"16.000000 0.000000\n10.000000 7.464102\n0.335899 -5.109400\n8.000000 0.000000\n6.000000 0.000000\n9.527864 4.000000\n",
"16.337535 0.000000\n10.000000 7.464102\n0.335899 -5.109400\n8.000000 0.000000\n6.000000 0.000000\n9.527864 4.000000\n",
"16.337535 0.000000\n10.000000 7.464102\n0.335899 -5.109400\n8.000000 0.000000\n6.000000 0.000000\n5.411373 12.000000\n",
"16.337535 0.000000\n10.000000 7.464102\n0.335899 -5.109400\n1.258935 0.849404\n6.000000 0.000000\n5.411373 12.000000\n",
"16.337535 0.000000\n6.036061 12.000000\n0.335899 -5.109400\n1.258935 0.849404\n6.000000 0.000000\n5.411373 12.000000\n",
"7.838280 2.189355\n6.036061 12.000000\n0.335899 -5.109400\n1.258935 0.849404\n6.000000 0.000000\n5.411373 12.000000\n",
"7.838280 2.189355\n6.036061 12.000000\n0.335899 -5.109400\n1.258935 0.849404\n6.000000 0.000000\n5.344100 12.000000\n",
"16.000000 0.000000\n10.000000 7.464102\n0.585786 -5.414214\n8.000000 0.000000\n6.000000 0.000000\n10.518003 4.000000\n",
"16.000000 0.000000\n10.000000 7.464102\n0.211146 -4.894427\n8.000000 0.000000\n6.000000 0.000000\n9.527864 4.000000\n"
] |
CodeContests
|
Given a non-negative decimal integer $x$, convert it to binary representation $b$ of 32 bits. Then, print the result of the following operations to $b$ respecitvely.
* Inversion: change the state of each bit to the opposite state
* Logical left shift: shift left by 1
* Logical right shift: shift right by 1
Constraints
* $0 \leq x \leq 2^{32} - 1$
Input
The input is given in the following format.
$x$
Output
Print the given bits, results of inversion, left shift and right shift in a line respectively.
Examples
Input
8
Output
00000000000000000000000000001000
11111111111111111111111111110111
00000000000000000000000000010000
00000000000000000000000000000100
Input
13
Output
00000000000000000000000000001101
11111111111111111111111111110010
00000000000000000000000000011010
00000000000000000000000000000110
|
stdin
| null | 477 | 1 |
[
"13\n",
"8\n"
] |
[
"00000000000000000000000000001101\n11111111111111111111111111110010\n00000000000000000000000000011010\n00000000000000000000000000000110\n",
"00000000000000000000000000001000\n11111111111111111111111111110111\n00000000000000000000000000010000\n00000000000000000000000000000100\n"
] |
[
"9\n",
"5\n",
"7\n",
"3\n",
"2\n",
"1\n",
"10\n",
"0\n",
"4\n",
"-1\n"
] |
[
"00000000000000000000000000001001\n11111111111111111111111111110110\n00000000000000000000000000010010\n00000000000000000000000000000100\n",
"00000000000000000000000000000101\n11111111111111111111111111111010\n00000000000000000000000000001010\n00000000000000000000000000000010\n",
"00000000000000000000000000000111\n11111111111111111111111111111000\n00000000000000000000000000001110\n00000000000000000000000000000011\n",
"00000000000000000000000000000011\n11111111111111111111111111111100\n00000000000000000000000000000110\n00000000000000000000000000000001\n",
"00000000000000000000000000000010\n11111111111111111111111111111101\n00000000000000000000000000000100\n00000000000000000000000000000001\n",
"00000000000000000000000000000001\n11111111111111111111111111111110\n00000000000000000000000000000010\n00000000000000000000000000000000\n",
"00000000000000000000000000001010\n11111111111111111111111111110101\n00000000000000000000000000010100\n00000000000000000000000000000101\n",
"00000000000000000000000000000000\n11111111111111111111111111111111\n00000000000000000000000000000000\n00000000000000000000000000000000\n",
"00000000000000000000000000000100\n11111111111111111111111111111011\n00000000000000000000000000001000\n00000000000000000000000000000010\n",
"11111111111111111111111111111111\n00000000000000000000000000000000\n11111111111111111111111111111110\n01111111111111111111111111111111\n"
] |
CodeContests
|
Balance strings, by definition, are the strings that contain all the characters of the alphabet, from a to z, equal no of times.
eg- abcdefghijklmnopqrstuvwxyz is a balanced string, aabb is not.
Input:
First line contains number of test cases T. Each test case contains a string S which made up of only lowercase characters.
Output:
For each test case print Yes if the string is balanced string else print No.
Constraints:
1 ≤ T ≤ 10
1 ≤ |S| ≤ 1000
SAMPLE INPUT
2
codemyca
abcdefghijklmnopqrstuvwxyz
SAMPLE OUTPUT
No
Yes
|
stdin
| null | 754 | 1 |
[
"2\ncodemyca\nabcdefghijklmnopqrstuvwxyz\n\nSAMPLE\n"
] |
[
"No\nYes\n"
] |
[
"2\ncodemyba\nabcdefghijklmnopqrstuvwxyz\n\nSAMPLE\n",
"2\ncodemyba\nabcdefghijklmnopqrstuvwxyz\n\nELPMAS\n",
"2\ncodmeyba\nabcdefghijklmnopqrstuvwxyz\n\nELPMAS\n",
"2\ncodemyaa\nabcdefghijklmnopqrstuvwxyz\n\nSAMPLE\n",
"2\ncodemyba\nzyxwvutsrqponmlkjihgfedcba\n\nELPMAS\n",
"2\ncodmeyba\nzyxwvutsrqponmlkjihgfedcba\n\nELPMAS\n",
"2\ncodemyaa\nabcdefghijklmnopqrstuvwxyz\n\nEAMPLS\n",
"2\ncodemyba\nzyxwvutsrqponmlkjihgfedcba\n\nELPMBS\n",
"2\ncodmeyba\nzyxwvutsrqponmlkjihgfedcba\n\nELQMAS\n",
"2\ncodemyba\nabcdefghijklmnopqrstuvwxyz\n\nEAMPLS\n"
] |
[
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n",
"No\nYes\n"
] |
CodeContests
|
Warp Drive
<image>
The warp drive technology is reforming air travel, making the travel times drastically shorter. Aircraft reaching above the warp fields built on the ground surface can be transferred to any desired destination in a twinkling.
With the current immature technology, however, building warp fields is quite expensive. Our budget allows building only two of them. Fortunately, the cost does not depend on the locations of the warp fields, and we can build them anywhere on the ground surface, even at an airport.
Your task is, given locations of airports and a list of one way flights among them, find the best locations to build the two warp fields that give the minimal average cost. The average cost is the root mean square of travel times of all the flights, defined as follows.
<image>
Here, m is the number of flights and tj is the shortest possible travel time of the j-th flight. Note that the value of tj depends on the locations of the warp fields.
For simplicity, we approximate the surface of the ground by a flat two dimensional plane, and approximate airports, aircraft, and warp fields by points on the plane. Different flights use different aircraft with possibly different cruising speeds. Times required for climb, acceleration, deceleration and descent are negligible. Further, when an aircraft reaches above a warp field, time required after that to its destination is zero. As is explained below, the airports have integral coordinates. Note, however, that the warp fields can have non-integer coordinates.
Input
The input consists of at most 35 datasets, each in the following format.
n m
x1 y1
...
xn yn
a1 b1 v1
...
am bm vm
n is the number of airports, and m is the number of flights (2 ≤ n ≤ 20, 2 ≤ m ≤ 40). For each i, xi and yi are the coordinates of the i-th airport. xi and yi are integers with absolute values at most 1000. For each j, aj and bj are integers between 1 and n inclusive, and are the indices of the departure and arrival airports for the j-th flight, respectively. vj is the cruising speed for the j-th flight, that is, the distance that the aircraft of the flight moves in one time unit. vj is a decimal fraction with two digits after the decimal point (1 ≤ vj ≤ 10).
The following are guaranteed.
* Two different airports have different coordinates.
* The departure and arrival airports of any of the flights are different.
* Two different flights have different departure airport and/or arrival airport.
The end of the input is indicated by a line containing two zeros.
Output
For each dataset, output the average cost when you place the two warp fields optimally. The output should not contain an absolute error greater than 10-6.
Sample Input
3 4
100 4
100 0
0 0
1 2 1.00
2 1 1.00
3 1 9.99
3 2 9.99
7 6
0 0
1 0
2 0
0 10
1 10
2 10
20 5
1 7 1.00
2 7 1.00
3 7 1.00
4 7 1.00
5 7 1.00
6 7 1.00
4 4
-1 -1
1 -1
-1 1
1 1
1 4 1.10
4 2 2.10
2 3 3.10
3 1 4.10
8 12
-91 0
-62 0
-18 0
2 0
23 0
55 0
63 0
80 0
2 7 3.96
3 2 2.25
2 4 5.48
8 7 9.74
5 6 6.70
7 6 1.51
4 1 7.41
5 8 1.11
6 3 2.98
3 4 2.75
1 8 5.89
4 5 5.37
0 0
Output for the Sample Input
1.414214
0.816497
0.356001
5.854704
Example
Input
3 4
100 4
100 0
0 0
1 2 1.00
2 1 1.00
3 1 9.99
3 2 9.99
7 6
0 0
1 0
2 0
0 10
1 10
2 10
20 5
1 7 1.00
2 7 1.00
3 7 1.00
4 7 1.00
5 7 1.00
6 7 1.00
4 4
-1 -1
1 -1
-1 1
1 1
1 4 1.10
4 2 2.10
2 3 3.10
3 1 4.10
8 12
-91 0
-62 0
-18 0
2 0
23 0
55 0
63 0
80 0
2 7 3.96
3 2 2.25
2 4 5.48
8 7 9.74
5 6 6.70
7 6 1.51
4 1 7.41
5 8 1.11
6 3 2.98
3 4 2.75
1 8 5.89
4 5 5.37
0 0
Output
1.414214
0.816497
0.356001
5.854704
|
stdin
| null | 3,488 | 1 |
[
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n3 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n1 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-91 0\n-62 0\n-18 0\n2 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n2 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 5.37\n0 0\n"
] |
[
"1.414214\n0.816497\n0.356001\n5.854704\n"
] |
[
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n1 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-91 0\n-62 0\n-18 0\n2 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n2 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 5.37\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n1 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-91 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n2 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 5.37\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n1 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n2 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 5.37\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n1 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n2 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n1 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n4 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 5\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n5 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n0 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n4 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 0\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n7 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n0 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n4 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 7.41\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 0\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n7 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n0 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n3 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n4 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 8.203166506020658\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 1 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 0\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n7 7 1.00\n6 7 1.00\n4 4\n-1 -1\n1 -1\n-1 1\n0 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n4 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n4 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 8.203166506020658\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n",
"3 4\n100 4\n100 0\n0 0\n1 2 1.00\n2 0 1.00\n3 1 9.99\n3 2 9.99\n7 6\n0 0\n1 0\n2 0\n0 10\n1 10\n2 10\n20 0\n1 7 1.00\n2 7 1.00\n4 7 1.00\n4 7 1.00\n7 7 1.00\n6 7 1.00\n4 4\n-1 0\n1 -1\n-1 1\n0 1\n1 4 1.10\n4 2 2.10\n2 3 3.10\n4 1 4.10\n8 12\n-18 0\n-62 0\n-18 0\n3 0\n23 0\n55 0\n63 0\n80 0\n2 7 3.96\n3 2 2.25\n4 4 5.48\n8 7 9.74\n5 6 6.70\n7 6 1.51\n4 1 8.203166506020658\n5 8 1.11\n6 3 2.98\n3 4 2.75\n1 8 5.89\n4 5 6.185513988737239\n0 0\n"
] |
[
"1.414213562\n0.735980072\n0.356001297\n5.854704082\n",
"1.414213562\n0.735980072\n0.356001297\n5.838380696\n",
"1.414213562\n0.735980072\n0.356001297\n5.020794874\n",
"1.414213562\n0.735980072\n0.356001297\n4.992361508\n",
"1.414213562\n0.735980072\n0.356001297\n4.618890538\n",
"1.414213562\n0.735980072\n0.322804554\n4.618890538\n",
"1.414213562\n0.726483157\n0.322804554\n4.618890538\n",
"1.414213562\n0.726483157\n0.322804554\n4.605537694\n",
"1.414213562\n0.726483157\n0.304008950\n4.605537694\n",
"1.414213562\n0.726483157\n0.308859758\n4.605537694\n"
] |
CodeContests
|
Mr. Retardo has lost his marbles. He's a professor, and absolutely loathes his students. And since going full retard, he asks them all sorts of useless questions. His latest obsession is prime numbers, and he gives all his a students random number n and asks them to check if it is prime.
Check if it is!!
Note that the permitted language list for this problem has been altered. Please check before solving.
EDIT
Maximum number of test cases - 500,
0 ≤ n ≤ 5*10^9
SAMPLE INPUT
5
2
3
4
5
6
SAMPLE OUTPUT
YES
YES
NO
YES
NO
|
stdin
| null | 3,791 | 1 |
[
"5\n\n2\n3\n4\n5\n6\n\nSAMPLE\n"
] |
[
"YES\nYES\nNO\nYES\nNO\n"
] |
[
"10\n\n9223372036854775807\n104729\n103141\n99999989\n9563494117\n8670344929\n11812315811854\n828456218949862\n0\n13536397441\n",
"5\n\n2\n3\n8\n5\n6\n\nSAMPLE\n",
"10\n\n9223372036854775807\n56688\n103141\n99999989\n9563494117\n8670344929\n11812315811854\n828456218949862\n0\n13536397441\n",
"10\n\n9223372036854775807\n56688\n7795\n99999989\n9563494117\n8670344929\n11812315811854\n828456218949862\n0\n13536397441\n",
"5\n\n2\n4\n9\n5\n10\n\nSAMPLE\n",
"10\n\n9223372036854775807\n25104\n7795\n99999989\n14233477817\n8670344929\n11812315811854\n828456218949862\n0\n2284133286\n",
"10\n\n9223372036854775807\n25104\n7795\n111652060\n14233477817\n8670344929\n11812315811854\n828456218949862\n0\n2284133286\n",
"10\n\n9223372036854775807\n28949\n7795\n43662248\n14233477817\n8670344929\n21539267824431\n828456218949862\n0\n329202230\n",
"10\n\n9223372036854775807\n28949\n7795\n43662248\n14233477817\n12349760801\n21539267824431\n828456218949862\n0\n329202230\n",
"10\n\n7627904653845779240\n14746\n7795\n30363507\n14233477817\n12349760801\n21539267824431\n828456218949862\n0\n442942614\n"
] |
[
"NO\nYES\nYES\nYES\nYES\nYES\nNO\nNO\nNO\nNO\n",
"YES\nYES\nNO\nYES\nNO\n",
"NO\nNO\nYES\nYES\nYES\nYES\nNO\nNO\nNO\nNO\n",
"NO\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nNO\n",
"YES\nNO\nNO\nYES\nNO\n",
"NO\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nNO\nNO\n",
"NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\n",
"NO\nYES\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\n",
"NO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\n",
"NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\n"
] |
CodeContests
|
Today, Vasya has decided to study about Numbers and Number Theory. One of her good friends Kolya is very good at the subject. To help her, he kept the following task in front of Vasya:
Given an array A of size N, Vasya needs to find the size of the Largest Good Subset. A Subset is considered to be good, if for any pair of elements within the subset, one of them is divisible by the other. In short, Vasya needs to find the largest subset S, where \forall i,j where i!=j and i<|S|,j<|S| either S[i]\%S[j]==0 or S[j]\%S[i]==0. The minimum size of a good subset is 2
Vasya finds this task too tricky and needs your help. Can you do it?
Input Format:
The first line contains a single integer N denoting the size of array A. The next line contains N space separated integers denoting the elements of array A.
Output Format:
Print a single integer denoting the required answer. If there is no such required good subset ,print -1.
Constraints:
1 ≤ N ≤ 10^3
1 ≤ A[i] ≤ 10^9
SAMPLE INPUT
4
4 8 2 3
SAMPLE OUTPUT
3
Explanation
Here, We consider the set (4,8,2) . On picking any 2 elements from this subset, we realize that one of them is always divisible by the other. There is no other good subset with size > 3. Thus, we print 3.
|
stdin
| null | 3,670 | 1 |
[
"4\n4 8 2 3\n\nSAMPLE\n"
] |
[
"3\n"
] |
[
"1000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n",
"4\n3 8 2 3\n\nSAMPLE\n",
"4\n4 8 2 6\n\nSAMPLE\n",
"4\n4 8 2 4\n\nSAMPLE\n",
"4\n22 4 3 7\n\nELPMAS\n",
"1000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n",
"1000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n",
"4\n3 8 2 1\n\nSAMPLE\n",
"1000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n",
"1000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"1000\n",
"2\n",
"3\n",
"4\n",
"-1\n",
"1000\n",
"1000\n",
"3\n",
"1000\n",
"1000\n"
] |
CodeContests
|
Given an array A of N integers, sort them in non-decreasing order.
Input Format
The first line of the input file contains a positive integer <N.
Then, N lines follow, each containing a single integer Ai, which is the i^th element of A.
Output Format
The output must contain exactly N lines, each line containing a single integer from the list, and sorted in non-increasing order.
Constraints
1 ≤ N ≤ 10,000
-10^6 ≤ Ai ≤ 10^6
SAMPLE INPUT
8
567
23
-10982
1000000
-999999
-3456
1729
65535
SAMPLE OUTPUT
-999999
-10982
-3456
23
567
1729
65535
1000000
|
stdin
| null | 559 | 1 |
[
"8\n567\n23\n-10982\n1000000\n-999999\n-3456\n1729\n65535\n\nSAMPLE\n"
] |
[
"-999999\n-10982\n-3456\n23\n567\n1729\n65535\n1000000\n"
] |
[
"8\n567\n40\n-10982\n1000000\n-999999\n-3456\n1729\n65535\n\nSAMPLE\n",
"8\n1133\n40\n-10982\n1000000\n-999999\n-3456\n1729\n65535\n\nSAMPLE\n",
"8\n1133\n40\n-10982\n1100000\n-999999\n-3456\n1729\n65535\n\nSAMPLE\n",
"8\n1133\n40\n-10982\n1110000\n-999999\n-3456\n1729\n65535\n\nLAMPSE\n",
"8\n1133\n40\n-10982\n1110000\n-999999\n-3456\n1729\n43214\n\nLAMPSE\n",
"8\n1133\n40\n-10982\n1110000\n-999999\n-3456\n1729\n17242\n\nLAMPSE\n",
"8\n295\n40\n-10982\n1110000\n-999999\n-3456\n1729\n17242\n\nETPMAL\n",
"8\n295\n40\n-10982\n1110000\n-999999\n-3456\n1729\n21042\n\nETPMAL\n",
"8\n295\n40\n-10982\n1110001\n-999999\n-3456\n1729\n21042\n\nETPMAL\n",
"8\n295\n40\n-10982\n1110000\n-1543398\n-3456\n1729\n21042\n\nETPMAL\n"
] |
[
"-999999\n-10982\n-3456\n40\n567\n1729\n65535\n1000000\n",
"-999999\n-10982\n-3456\n40\n1133\n1729\n65535\n1000000\n",
"-999999\n-10982\n-3456\n40\n1133\n1729\n65535\n1100000\n",
"-999999\n-10982\n-3456\n40\n1133\n1729\n65535\n1110000\n",
"-999999\n-10982\n-3456\n40\n1133\n1729\n43214\n1110000\n",
"-999999\n-10982\n-3456\n40\n1133\n1729\n17242\n1110000\n",
"-999999\n-10982\n-3456\n40\n295\n1729\n17242\n1110000\n",
"-999999\n-10982\n-3456\n40\n295\n1729\n21042\n1110000\n",
"-999999\n-10982\n-3456\n40\n295\n1729\n21042\n1110001\n",
"-1543398\n-10982\n-3456\n40\n295\n1729\n21042\n1110000\n"
] |
CodeContests
|
Fatal Eagle is trying his best to save his city, but he's failing to do so. He knows he needs some external help; some guidance, something... something out of ordinary to defeat this powerful enemy called Mr. XYZ.
"Find out the number of pairs in the list you've made, who sum up to
an even number!"
"Who are you? And what do you mean? Can you elaborate a bit?" Exclaims Fatal Eagle.
"I meant, what I said... take a look at the sample explanation of the
problem I want you to solve, you'll understand perhaps. And as for who
I am? I'm Arjit and like you, I just want to save this city, too."
Fatal Eagle is quick to respond to Arjit's task, and decides to solve it quickly. He takes out the list of integers which contains the powers of weird creatures, and starts finding out the number of pairs which sum up to an even number. Here's how he does it:
Let's say that he had a list of 4 numbers: [1, 2, 3, 4]
His answer would be: 2. How? 1+3 = 4 and 2 + 4 - that is to say, a number will NOT be added to itself and 1+3 is same as 3+1.
Input format:
On the first line of the input there is an integer, T, which denotes the number of test cases. For every test case, there is a number N, denoting the size of the list. Then, on the next line there are N numbers denoting the integers in the list.
Output format:
You need to output the number of required pairs.
Constraints:
1 ≤ Test Cases ≤ 50
1 ≤ Number of elements ≤ 10^3
1 ≤ Value of the elements - Ni ≤ 10^5
SAMPLE INPUT
4
2
1 1
4
1 2 3 4
4
2 4 6 8
3
1 3 3
SAMPLE OUTPUT
0
2
6
2
Explanation
In the first case, since the numbers are same, they will not be considered.
The second case is explained in the question itself.
In the third case, 6 pairs are: (2, 4) (2, 6) (2, 8) (4, 6) (4, 8) (6, 8).
In the fourth case, 2 pairs are: (1, with the 1st 3) (1, with the 2nd 3).
|
stdin
| null | 4,223 | 1 |
[
"4\n2\n1 1\n4\n1 2 3 4\n4\n2 4 6 8\n3\n1 3 3\n\nSAMPLE\n"
] |
[
"0\n2\n6\n2\n"
] |
[
"30\n441\n55 33 26 69 20 22 70 84 82 74 32 41 12 39 55 87 37 46 89 55 85 52 48 73 27 50 21 76 11 93 49 84 56 59 83 86 36 91 77 84 42 85 9 100 23 1 83 15 24 36 11 49 91 40 87 99 31 49 33 86 11 35 83 69 21 88 69 54 81 4 29 90 36 16 85 59 74 27 92 31 30 93 62 95 50 21 47 41 87 44 21 68 33 39 7 22 36 88 25 42 48 40 8 47 83 62 91 34 43 73 81 72 53 91 7 86 52 12 94 100 95 21 33 69 93 79 53 75 67 35 43 70 57 13 1 98 5 15 15 84 88 34 56 14 74 9 71 87 3 91 62 58 72 65 91 83 21 45 35 47 91 24 83 94 75 55 28 83 77 92 80 86 80 8 53 49 11 22 66 25 98 71 71 40 81 30 90 60 41 72 81 97 79 51 59 55 23 30 36 10 51 84 54 69 9 20 17 37 27 99 9 32 59 27 93 3 75 64 40 7 25 75 25 39 57 22 24 19 57 16 48 41 62 90 19 86 74 19 80 99 8 72 27 19 41 5 91 82 96 51 25 26 97 69 4 86 54 80 23 93 34 19 24 87 98 68 97 84 95 16 96 64 22 1 94 87 76 91 66 11 85 68 73 69 79 37 36 35 40 46 34 4 54 11 12 51 12 87 41 17 100 7 67 18 51 54 23 18 72 32 68 92 9 86 99 39 74 18 74 18 17 47 80 66 41 59 84 92 78 1 92 68 32 99 7 90 30 61 20 46 53 54 96 39 27 46 77 17 84 35 24 66 41 50 38 45 99 58 87 20 21 20 74 33 45 67 71 42 44 67 56 25 33 74 65 69 46 36 95 66 96 12 27 12 56 91 60 10 70 79 97 90 66 52 79 60 89 53 31 43 9 11 19 82 30 37 15 14 93 59 93 49 63 60 86 2 15 2 87 63 79 24 97 26 24 47 8 10 63 51 64 23 35 48 5 53 52 20 86 97 295\n586\n68 58 39 57 44 64 45 50 10 55 93 37 37 92 89 74 36 22 50 17 15 21 2 88 21 44 18 20 1 67 98 17 50 30 61 20 9 48 64 90 31 100 83 36 16 83 63 2 28 49 71 61 36 95 63 21 86 96 4 32 80 57 9 80 61 41 95 68 42 28 44 100 85 20 23 63 100 71 58 32 92 37 86 17 28 13 80 59 2 11 73 33 17 74 43 14 100 1 47 58 27 91 80 33 67 96 53 82 14 65 88 4 66 5 10 90 81 66 68 73 71 72 30 82 61 45 100 32 82 99 7 2 25 35 7 63 91 72 4 50 56 19 7 49 35 41 29 74 56 61 80 52 78 96 21 8 44 65 100 87 100 49 79 19 30 80 97 9 84 85 2 29 5 57 34 88 45 79 16 38 15 99 39 58 93 64 65 58 89 28 35 78 66 71 18 8 42 62 57 20 79 22 35 32 89 66 96 97 81 41 99 97 5 73 54 88 79 65 30 5 88 82 11 70 4 38 36 56 78 75 80 73 46 7 70 20 32 3 4 83 34 78 34 12 75 38 9 63 81 34 53 65 28 59 19 93 78 66 61 22 29 10 54 13 94 43 84 58 79 83 65 53 31 28 20 100 79 74 20 35 46 72 71 74 36 73 46 77 76 91 43 88 24 61 64 65 9 10 81 29 72 73 65 72 47 11 77 40 40 14 65 43 66 15 55 25 19 76 56 27 49 64 99 71 8 18 96 82 32 35 66 33 57 22 46 98 67 70 67 14 97 9 48 19 23 22 24 6 3 13 10 19 73 27 51 8 58 84 20 13 90 46 90 26 25 51 98 38 4 3 91 63 10 64 40 36 24 82 47 12 88 27 87 60 21 38 41 4 45 82 13 20 66 81 39 15 37 80 58 62 40 82 86 51 10 88 4 61 61 3 5 3 58 80 74 23 72 38 58 66 60 33 6 87 31 48 84 72 2 78 71 32 14 6 63 40 3 61 80 82 43 56 50 12 77 78 29 78 35 58 43 9 84 8 58 53 94 59 69 96 36 5 58 99 97 21 21 69 59 63 37 40 84 12 61 19 52 19 59 68 45 16 26 45 38 86 41 59 55 19 66 54 16 34 19 52 12 88 99 19 50 34 44 76 10 74 62 74 95 19 41 17 52 61 71 82 83 24 29 94 50 50 38 58 50 43 22 42 11 17 94 56 24 81 2 94 89 48 63 89 2 13 78 98 6 20 26 41 65 54 7 18 26 83 13 28 49 99 76 80 85 47 78 20 61 31 100 86 70 43 7 35 24 17 23 34 62 25 67 79 7 58 32 88 61 266\n487\n95 64 69 7 95 52 90 8 94 36 72 23 99 74 11 84 41 22 31 22 39 99 63 19 53 66 75 3 12 29 19 53 90 13 9 79 7 9 17 43 76 72 66 29 63 15 40 18 32 93 97 25 85 70 94 48 2 11 61 65 19 81 35 63 25 100 5 33 32 82 45 20 55 100 9 2 38 50 81 5 49 79 65 23 97 28 23 35 78 51 98 85 100 22 33 93 56 81 23 59 55 30 27 50 10 55 73 25 53 21 98 40 19 40 57 83 40 73 29 96 38 66 40 84 55 57 19 17 17 68 33 24 38 10 95 86 19 16 92 5 14 71 57 92 19 40 49 5 79 81 53 98 40 74 61 25 41 87 83 19 100 12 65 81 78 53 6 39 18 3 32 96 82 85 97 79 56 36 68 28 19 60 13 60 62 91 22 42 93 46 29 36 14 38 80 35 89 16 20 39 70 29 45 49 86 31 17 5 73 43 78 51 17 40 20 47 7 6 67 87 48 17 98 62 79 12 24 23 16 52 72 18 87 64 28 18 88 22 58 50 90 10 44 89 12 65 20 86 44 7 95 18 63 72 59 7 33 89 65 86 97 9 100 85 34 82 24 51 31 68 45 71 75 44 67 30 54 27 11 77 28 47 12 8 11 32 25 86 8 56 43 39 30 41 100 55 70 39 22 70 89 53 57 14 94 17 87 17 58 22 25 93 94 99 6 15 94 73 51 98 82 2 35 53 29 23 63 38 36 46 64 12 93 40 20 56 15 66 86 79 8 22 2 1 77 5 13 15 14 81 30 66 33 99 75 38 26 98 39 26 9 51 18 37 72 35 53 25 52 94 2 54 27 83 37 82 47 21 43 82 73 7 21 57 81 61 64 82 58 26 45 50 42 1 90 54 92 25 49 33 63 94 47 66 59 40 23 12 62 90 7 61 53 5 28 72 35 32 32 95 95 98 66 21 72 26 33 82 30 34 17 91 96 98 3 74 72 98 11 53 56 17 91 35 61 26 48 69 84 50 72 3 37 23 7 28 98 30 34 60 11 57 77 3 1 31 71 52 68 11 89 51 45 58 65 66 62 79 95 44 90 100 63 32 66 84 492\n169\n3 16 59 35 74 70 83 60 98 100 20 85 74 10 34 2 55 53 90 69 68 16 21 90 14 84 22 65 68 98 5 98 14 49 52 28 35 74 68 57 52 39 44 21 97 64 16 30 45 75 9 1 91 69 56 29 70 71 38 32 65 23 97 93 7 93 8 81 65 72 22 9 95 84 93 62 37 28 31 69 13 14 32 46 28 45 36 26 49 46 1 46 91 81 35 51 87 91 7 20 80 41 1 87 52 13 51 23 84 38 33 9 2 8 31 22 1 13 34 89 62 17 91 1 83 75 35 47 54 94 48 23 6 2 10 56 63 74 20 39 69 48 28 60 42 56 71 2 30 14 76 68 96 93 27 70 77 92 22 7 93 36 15 12 99 44 47 6 8\n133\n36 43 19 53 15 15 21 60 79 29 31 39 8 47 25 92 70 86 2 58 85 42 90 17 11 58 53 24 76 37 72 43 20 7 40 30 28 54 7 27 74 39 62 96 7 37 50 55 68 69 35 64 70 91 91 30 15 14 91 42 67 63 48 10 47 99 95 54 100 3 25 72 23 23 38 55 68 30 34 54 89 100 21 97 69 37 67 96 70 45 24 27 84 88 53 81 69 8 49 51 84 92 54 29 36 71 100 37 51 93 47 53 19 54 76 92 92 13 39 62 10 30 65 4 79 62 65 99 2 60 76 45 387\n720\n71 83 69 47 36 92 68 59 90 23 54 16 80 20 50 40 46 97 51 46 7 5 40 70 87 6 52 12 97 100 29 100 88 65 46 44 31 23 35 9 90 84 59 32 78 100 40 65 53 10 12 54 64 2 58 77 31 39 72 11 39 56 10 91 67 39 8 20 57 37 45 6 33 56 29 29 19 63 54 93 90 42 39 66 61 57 23 66 97 5 32 50 61 32 36 34 62 65 57 34 16 84 38 98 2 89 6 96 49 35 29 83 18 51 88 77 9 93 8 18 77 34 78 32 77 5 74 6 4 41 55 35 32 68 57 36 50 58 57 3 58 54 81 51 39 10 14 7 63 100 49 95 67 97 30 42 93 3 75 85 40 89 82 45 19 25 27 44 45 52 42 8 34 6 50 90 69 11 54 51 53 92 20 58 36 18 16 9 87 83 100 72 64 62 13 25 49 26 67 17 26 50 27 98 89 30 1 40 91 31 93 82 85 17 50 56 84 50 14 56 59 4 10 84 39 93 19 10 29 78 79 69 57 56 29 32 91 81 56 19 73 17 43 99 41 81 9 100 79 47 14 79 4 13 65 63 62 40 22 39 92 58 85 23 35 90 33 37 18 25 38 55 10 87 22 51 82 78 42 58 35 86 13 99 88 30 45 18 22 34 96 95 38 88 100 52 32 40 21 2 61 50 100 26 56 61 61 18 10 66 41 97 16 45 39 57 87 74 71 92 44 23 45 24 26 67 24 20 97 91 43 7 48 20 69 55 5 47 84 14 63 55 38 1 60 57 81 35 47 12 16 67 25 12 24 94 98 48 80 6 39 34 63 57 82 77 20 68 31 25 81 85 39 94 2 58 88 48 98 51 8 68 64 57 4 12 57 46 22 35 88 85 48 59 95 82 73 12 85 9 74 3 71 78 77 61 3 83 12 33 34 11 81 89 1 17 43 64 64 29 54 66 36 16 85 83 93 39 68 71 52 77 27 51 10 28 44 40 24 67 43 32 29 60 9 83 23 24 67 34 1 2 56 43 47 84 13 70 34 91 97 19 95 86 77 12 23 18 73 36 75 52 52 16 63 94 93 86 28 77 96 77 65 98 58 78 18 66 3 35 75 64 36 94 88 93 66 39 81 17 84 20 10 85 87 3 85 38 75 78 96 27 77 43 33 98 94 98 34 70 16 4 82 61 49 73 52 15 56 32 58 20 48 49 90 81 5 77 57 6 49 68 65 21 71 96 12 21 51 83 78 9 8 23 51 54 99 19 73 12 53 36 34 72 45 81 35 76 56 99 74 66 68 63 50 13 56 64 65 45 89 28 43 25 56 29 52 23 37 60 40 57 27 59 16 21 18 2 37 11 24 51 10 24 58 50 67 53 76 61 17 72 88 7 32 19 15 23 24 97 41 88 49 89 94 51 84 99 7 17 76 57 28 26 32 79 76 52 46 11 66 97 81 17 100 19 40 10 74 9 32 23 66 56 6 28 52 66 50 32 90 4 51 14 44 49 27 12 53 95 94 48 46 31 21 94 86 3 88 98 9 93 84 51 37 83 34 42 92 62 28 99 39 28 85 28 97 15 28 98 60 45 72 13 81 72 89 86 21 57 51 40 23 56 78 9 20 4 95 896\n285\n16 46 3 19 53 22 6 6 59 82 1 61 6 72 97 32 55 94 47 45 72 54 17 25 30 98 31 37 4 77 34 84 96 36 78 89 14 37 88 70 58 86 54 90 43 66 18 48 94 78 25 78 3 40 40 60 59 13 57 4 94 36 58 70 50 70 33 46 81 77 73 34 44 40 91 3 74 91 53 12 54 96 37 25 30 3 50 6 81 69 33 89 94 59 39 40 5 37 45 29 53 87 15 40 52 27 57 17 64 52 63 29 43 26 20 23 54 12 50 75 88 12 1 99 52 62 9 12 78 86 59 42 66 93 40 25 68 61 40 4 38 56 80 97 36 69 92 70 92 80 56 81 30 77 24 49 22 73 25 61 1 100 71 19 23 58 61 8 28 98 39 21 21 33 26 71 66 11 9 22 61 39 20 86 91 80 94 80 22 6 66 29 54 28 44 8 5 18 84 40 16 91 85 40 64 6 18 57 9 8 1 83 80 54 97 78 17 98 6 99 35 61 76 70 58 13 18 86 63 32 91 80 19 78 43 27 97 82 80 3 42 91 36 56 97 92 96 85 52 14 70 5 51 95 46 30 47 33 24 95 68 28 58 93 15 77 53 46 3 38 72 66 15 17 91 45 65 14 87 92 76 44 72 48 578\n495\n53 26 90 65 33 25 2 57 17 6 51 48 47 16 24 96 26 77 61 17 84 76 50 11 89 52 71 64 71 69 51 65 94 93 15 99 100 42 20 13 9 31 67 25 1 14 74 93 53 17 62 8 36 81 67 2 21 3 23 90 17 78 24 42 92 98 12 46 15 49 9 82 18 83 73 18 22 6 27 65 75 47 40 33 29 74 94 72 50 3 81 78 66 35 62 85 91 50 78 94 30 1 16 25 77 54 44 100 92 7 40 76 43 51 85 1 94 86 72 63 5 72 100 76 29 31 99 55 69 73 96 64 72 59 100 82 19 40 27 26 3 13 97 14 92 30 47 47 62 12 49 91 28 92 27 61 60 85 78 99 69 43 22 28 39 98 33 85 52 98 65 3 41 64 76 100 77 64 56 36 12 80 21 86 90 76 69 69 84 67 48 52 33 68 91 91 84 52 87 61 23 53 23 77 60 68 26 8 44 30 53 72 54 87 32 50 71 96 46 30 65 12 61 97 28 29 13 38 29 52 33 58 55 68 19 71 70 97 11 79 14 60 91 39 41 74 7 68 76 80 91 69 65 21 89 98 62 63 35 27 2 26 61 47 17 34 34 43 56 8 29 26 80 92 81 33 14 91 96 89 98 30 61 71 7 20 67 86 69 66 90 73 12 48 6 67 64 44 81 73 11 30 8 58 32 5 33 53 8 95 34 57 37 19 33 67 68 23 43 95 51 79 77 48 60 38 100 93 49 73 4 54 31 19 95 6 3 10 62 19 48 57 58 4 31 72 37 54 77 24 64 49 93 16 18 44 29 64 39 96 10 61 89 19 5 92 33 59 80 63 79 43 49 27 85 37 57 71 20 88 35 81 32 76 22 41 66 37 100 30 32 78 24 54 41 42 97 11 5 72 85 97 79 7 46 10 49 16 28 47 54 73 38 54 28 31 50 81 24 69 45 56 30 95 7 25 81 64 85 49 68 85 2 79 16 13 82 40 89 59 28 24 21 67 43 14 66 3 32 59 98 81 73 56 95 31 18 96 71 61 73 8 64 42 97 68 64 15 97 56 56 23 10 44 79 80 57 67 5 42 7 6 41 91 61 18 36 62 91 50 40 47 61 16 590\n602\n2 4 17 49 46 22 70 79 94 25 65 45 93 94 78 56 22 92 57 41 96 55 69 41 7 32 18 83 39 74 71 86 53 87 55 73 34 75 44 94 78 42 98 48 5 15 96 8 67 43 93 34 92 11 49 90 30 68 93 81 32 57 70 30 82 60 86 86 58 95 26 20 51 86 70 57 98 3 19 65 46 31 72 20 69 27 2 41 82 70 67 7 56 64 46 91 29 94 16 2 26 76 63 11 13 94 15 84 96 23 47 90 75 34 24 99 95 73 28 34 3 66 81 65 38 97 42 22 94 83 51 31 64 91 53 35 90 10 92 57 1 46 63 9 20 13 32 90 46 56 38 50 66 9 24 30 15 59 44 84 28 62 95 55 19 13 78 55 94 31 49 78 29 44 45 81 83 40 86 11 41 97 59 2 74 77 68 92 86 72 40 95 89 66 50 31 58 68 96 57 80 37 13 86 77 78 9 86 97 1 84 8 57 40 40 97 6 71 80 80 11 50 55 42 42 48 70 100 37 20 29 11 54 84 26 9 63 79 99 33 13 66 33 90 40 78 69 23 19 42 59 34 85 38 98 39 3 51 42 100 3 8 2 28 46 98 48 51 94 10 54 57 33 17 42 62 24 54 83 95 27 41 64 63 94 39 38 56 75 80 54 86 65 47 97 21 89 11 44 90 74 91 11 59 56 65 54 10 76 5 69 66 23 65 13 56 8 79 33 46 99 25 72 6 50 49 22 65 9 37 39 56 40 64 49 12 84 94 43 71 38 49 12 20 54 44 99 71 4 72 34 15 6 30 96 9 41 61 86 58 30 32 30 34 98 12 45 50 47 44 5 13 9 94 3 59 26 65 26 23 31 38 76 29 99 70 81 44 9 41 36 58 55 12 84 46 37 49 37 21 6 91 23 4 47 84 87 63 87 91 80 68 73 90 69 68 60 63 72 5 2 39 27 92 86 99 97 98 22 40 6 65 22 31 99 27 11 10 73 82 92 58 65 70 30 68 96 34 92 84 34 53 52 91 1 54 66 93 64 40 50 79 48 3 26 72 63 94 70 63 39 67 40 32 92 72 1 79 24 59 41 17 41 33 16 77 75 9 82 13 18 55 53 68 71 40 18 27 99 66 1 22 100 70 86 24 41 64 53 89 65 85 6 8 49 89 59 31 39 72 47 77 26 31 19 85 85 38 94 34 74 65 35 75 27 90 76 94 49 97 48 26 36 62 30 76 34 36 3 60 13 52 52 31 40 7 96 53 96 35 98 38 72 74 71 78 15 84 77 4 92 60 59 41 28 95 44 17 99 39 73 70 74 42 36 17 72 87 1 37 66 59 87 42 73 87 60 28 40 30 72 205\n571\n93 41 40 61 62 16 16 100 51 62 4 33 32 88 54 18 93 17 97 98 1 86 63 72 57 24 12 44 76 21 34 51 39 29 83 93 38 17 66 66 81 34 4 96 33 60 88 60 63 27 40 99 16 92 30 79 49 16 32 21 89 31 8 46 49 18 8 73 5 51 20 96 100 63 66 62 44 12 6 64 41 56 97 64 95 77 16 95 40 40 43 49 92 15 58 98 63 34 12 15 65 39 77 3 80 54 10 61 9 25 4 84 73 34 16 92 97 12 45 69 11 75 87 22 57 45 70 50 44 36 93 26 58 57 26 67 66 21 39 54 9 65 15 14 97 75 50 18 73 63 79 46 29 71 84 41 73 68 86 22 57 52 31 52 17 46 22 32 52 28 100 68 34 84 10 36 48 15 90 57 56 67 39 9 57 56 6 20 59 12 33 69 14 57 78 80 78 57 39 49 48 75 1 9 23 16 97 83 41 70 78 79 62 9 65 69 97 98 52 69 56 97 6 68 5 37 26 68 36 53 36 92 58 10 7 51 22 17 94 27 1 83 11 39 51 12 69 3 53 35 30 19 6 54 50 67 56 84 30 4 44 6 56 23 14 2 43 71 93 63 27 92 42 37 43 98 33 39 56 92 52 86 3 5 15 83 31 9 82 77 76 29 70 15 93 43 68 19 30 29 11 59 63 79 30 4 5 22 64 89 79 82 70 34 47 94 62 72 42 87 82 90 38 47 22 80 71 12 61 13 81 70 55 44 51 19 35 80 57 75 99 42 32 86 79 56 12 75 91 8 100 48 81 54 24 46 69 46 48 38 13 36 95 13 58 24 92 22 5 39 21 33 87 33 41 60 54 82 30 26 78 71 16 84 69 31 25 24 69 100 73 87 22 40 2 35 50 1 45 6 88 48 55 16 28 47 100 95 13 74 9 28 54 74 50 44 78 42 83 4 46 55 39 40 62 13 67 93 28 77 59 21 6 57 46 74 90 32 18 67 92 33 51 61 25 9 83 54 54 48 7 36 98 97 7 68 54 94 34 68 28 58 74 21 69 64 44 53 68 3 86 11 61 84 99 50 48 39 26 82 1 68 38 83 10 62 89 29 92 70 91 84 61 38 56 33 66 86 8 75 2 31 3 97 79 13 30 8 73 75 83 73 14 82 30 91 53 49 91 56 59 49 34 12 44 46 2 93 50 15 17 95 78 93 57 39 22 52 8 89 29 96 11 99 28 57 71 71 66 91 91 36 1 52 100 60 48 69 23 20 27 6 77 5 93 73 53 84 89 48 611\n408\n41 87 5 89 24 7 54 4 29 92 31 7 78 54 91 23 89 18 48 1 69 49 51 9 29 3 78 60 21 90 4 100 87 29 22 70 31 97 74 90 86 11 72 90 7 35 34 42 73 40 9 44 54 21 12 19 68 90 33 14 67 29 13 28 20 64 36 72 3 50 72 13 6 82 75 13 67 54 15 68 38 58 62 37 21 52 9 53 13 7 38 17 4 39 48 88 20 67 29 18 79 4 29 68 100 75 25 80 23 11 79 53 42 72 21 96 95 53 68 17 96 96 49 61 38 2 87 84 66 1 7 23 15 18 23 92 77 71 87 15 71 57 59 70 25 81 13 48 33 86 99 66 54 21 33 84 46 26 34 29 14 78 16 63 59 46 10 51 11 95 65 92 66 44 58 40 39 65 50 60 54 63 34 62 92 41 23 48 38 86 63 26 58 49 72 45 97 26 17 81 87 25 12 6 29 46 9 55 10 74 75 27 67 50 33 80 45 89 68 86 59 35 32 85 8 56 58 56 14 62 18 56 56 14 78 52 1 2 24 35 84 15 25 5 69 50 33 54 47 2 14 6 79 29 34 34 34 6 51 71 30 47 91 20 36 56 81 16 45 82 1 40 68 43 90 79 59 96 88 98 13 5 25 20 83 82 48 59 24 79 40 7 7 60 71 89 63 63 14 74 5 10 63 10 49 58 89 9 81 37 51 56 37 47 1 32 29 63 48 11 15 65 7 71 26 93 71 57 44 95 36 81 84 42 81 77 28 42 18 42 51 96 65 69 5 11 98 64 48 53 68 66 79 95 27 85 93 39 69 15 40 98 41 51 74 14 99 14 18 59 1 23 43 48 83 91 65 94 66 11 55 3 58 48 48 28 22 12 55 35 41 90 86 73 40 8 73 100 33 27 32 83 37 79 5 78 78 364\n587\n96 77 83 26 47 5 36 98 28 73 52 95 82 76 24 72 69 83 59 7 73 43 9 18 20 93 13 10 56 14 5 52 70 34 11 24 71 60 34 57 94 85 36 80 47 12 46 38 97 55 10 49 49 63 43 88 58 44 69 20 96 8 33 22 32 69 51 48 56 31 66 78 98 77 65 27 95 32 81 100 1 23 83 9 72 30 59 43 94 43 82 19 97 46 54 24 90 60 89 81 4 16 20 32 99 4 9 83 99 60 30 64 52 42 65 40 1 19 47 80 51 91 41 83 95 25 21 31 66 26 85 60 90 57 44 93 81 95 3 77 73 3 25 34 45 64 68 3 64 51 77 32 62 55 56 13 83 18 99 89 68 89 91 27 67 84 38 10 78 31 6 34 25 54 72 81 58 3 78 5 56 17 41 14 27 27 20 30 70 39 99 41 77 83 58 8 36 28 28 20 3 1 10 70 42 2 65 85 85 32 50 51 4 76 20 79 76 79 30 35 91 97 56 48 47 11 6 70 63 57 79 14 92 25 4 63 46 23 4 11 47 80 95 100 32 95 20 61 88 57 2 59 59 61 22 64 17 34 70 59 64 29 55 83 93 21 89 84 31 21 81 78 45 3 56 79 63 27 68 5 58 49 71 70 79 79 8 82 6 37 96 90 73 54 65 51 30 56 75 87 100 12 5 75 43 12 81 15 20 63 78 24 59 64 90 79 79 79 82 98 93 79 92 37 99 52 5 37 26 12 40 25 23 3 4 70 86 59 6 64 22 5 70 38 49 62 4 53 62 92 94 62 47 8 23 11 24 21 12 14 52 60 29 22 89 77 65 43 73 25 10 57 29 2 22 88 96 18 40 98 44 38 19 90 99 46 76 40 84 21 17 73 96 54 96 46 8 3 83 96 56 87 98 71 5 73 53 48 48 89 41 79 11 23 12 17 67 68 40 64 36 28 67 46 59 78 60 10 80 28 44 89 74 34 33 89 95 27 70 16 41 32 29 14 78 88 66 58 66 52 91 46 6 17 93 18 99 18 27 6 29 98 11 8 45 10 3 13 87 52 24 6 100 87 21 39 80 26 98 21 3 2 75 36 96 32 16 58 23 55 16 38 39 30 17 34 68 45 89 5 55 8 80 91 61 68 8 53 39 6 31 25 30 17 74 57 34 1 64 24 92 69 7 18 4 34 5 71 5 98 72 27 18 43 73 10 22 20 57 80 6 50 31 63 86 2 55 50 40 63 39 92 23 51 56 26 54 45 65 75 28 99 59 80 39 10 27 35 19 9 89 41 66 32 51 92 36 83 64 23 87 72 34 19 66 7 161\n15\n11 27 3 95 25 29 20 62 74 14 88 44 65 7 42\n320\n45 15 29 92 66 76 12 60 45 77 43 35 9 36 18 62 61 32 77 61 70 51 19 13 41 90 4 25 72 47 4 32 20 34 47 90 1 50 74 54 77 75 35 66 65 57 8 74 16 34 35 38 61 54 99 83 3 97 63 38 26 13 51 26 20 63 4 81 9 77 52 97 82 38 99 37 56 5 43 17 78 95 63 61 48 83 76 62 69 64 37 53 43 14 38 50 1 26 72 90 100 10 46 91 41 67 4 98 43 61 58 4 72 86 94 97 78 41 97 18 69 60 50 24 68 97 8 48 93 75 15 89 57 70 12 61 36 7 19 68 96 87 35 82 80 49 58 45 40 88 31 68 57 1 36 82 92 41 49 96 90 77 22 53 94 73 91 25 84 75 6 95 19 89 51 59 28 15 11 52 11 82 83 93 96 24 47 1 9 21 5 64 19 39 51 59 52 53 30 44 78 28 91 13 98 31 77 68 96 35 4 92 43 12 68 61 43 86 93 72 19 95 19 84 35 24 41 90 95 41 23 40 11 27 86 82 89 59 85 4 13 84 100 53 29 84 36 29 80 56 7 8 70 23 26 73 71 94 62 27 66 43 8 5 42 67 3 41 56 71 80 41 98 2 10 59 74 32 45 57 12 88 58 50 35 12 63 30 81 3 61 34 33 36 27 87 80 73 19 92 41 73 52 74 86 95 73 47 10 93 46 59 31 30 89 55 49 15 91 941\n511\n65 64 45 75 13 43 36 67 92 63 56 53 22 55 3 75 25 12 16 76 33 53 46 34 3 37 83 91 12 83 44 2 54 100 23 90 78 26 61 69 13 8 82 51 69 75 34 47 98 98 45 51 37 18 86 84 50 32 61 12 50 42 61 66 68 24 16 62 34 62 45 65 35 95 8 100 14 68 36 25 30 85 43 52 53 75 16 20 44 13 100 53 39 74 78 52 78 73 2 49 70 5 26 46 32 61 32 75 6 66 12 77 17 3 93 55 38 71 74 78 66 35 7 19 84 58 66 18 58 32 5 20 37 35 73 11 90 86 42 51 76 78 42 52 75 73 39 31 83 18 31 92 87 68 56 37 89 76 25 52 72 48 8 2 22 57 83 79 30 88 1 64 31 94 17 87 24 54 63 33 62 24 43 61 79 33 27 33 6 48 52 92 100 38 75 19 22 47 55 11 50 92 21 17 46 22 29 17 14 44 41 54 7 50 32 46 6 37 28 79 26 37 88 54 86 50 92 10 7 92 9 44 93 40 88 13 56 10 12 78 95 36 40 40 50 45 92 31 27 21 88 29 28 53 41 38 85 1 63 8 15 38 67 76 59 82 20 42 89 40 28 24 51 38 38 45 23 55 36 62 62 62 25 1 6 78 92 17 82 70 98 43 79 86 32 73 22 12 8 5 41 7 2 37 79 45 85 13 40 61 22 10 95 32 87 5 82 79 35 11 10 33 24 31 97 56 18 35 94 100 60 17 82 66 19 8 95 25 15 58 59 49 42 35 85 51 11 83 50 17 49 94 47 52 10 7 73 4 33 48 89 40 64 15 13 26 10 48 11 74 61 28 22 3 49 76 80 48 93 74 38 49 52 69 65 21 5 83 31 32 49 87 43 71 5 67 96 27 35 75 62 55 63 8 62 1 86 24 75 100 20 5 24 43 51 19 61 87 43 25 12 93 17 76 14 15 13 68 5 36 15 41 22 21 7 23 30 79 30 59 89 2 53 93 85 77 14 46 16 36 96 28 61 49 68 81 95 78 56 84 51 24 9 81 64 72 18 64 14 41 4 84 98 36 17 9 9 30 96 97 44 72 48 13 29 55 35 95 81 53 92 2 56 95 37 52 7 86 42 30 39 34 52 66 89 26 9 94 54 75 815\n467\n89 88 74 5 36 82 77 49 18 60 58 58 89 18 6 55 94 32 2 52 34 87 9 95 90 35 11 2 30 2 6 41 26 98 87 84 56 9 38 98 87 45 76 86 80 48 47 100 3 83 73 82 90 70 50 63 5 17 53 7 65 33 42 38 16 20 35 90 96 15 57 82 53 6 64 65 27 65 82 1 40 63 38 99 95 9 57 24 60 34 21 7 51 80 33 2 69 59 55 6 79 37 67 53 7 6 46 20 20 7 61 57 7 3 85 22 91 78 62 16 31 71 47 38 38 100 1 51 21 94 29 88 50 79 11 100 71 31 19 57 69 70 22 44 2 69 20 73 80 97 94 97 99 11 40 37 87 49 26 25 96 77 77 65 99 38 38 58 42 6 82 48 9 67 30 94 98 62 64 71 87 9 26 51 54 81 59 49 61 84 23 2 73 65 6 18 53 17 51 22 90 34 33 15 34 75 58 68 78 18 76 63 20 76 77 82 54 3 22 19 97 7 97 93 45 76 43 2 33 51 7 86 4 82 16 39 88 75 79 99 72 17 20 15 4 56 18 47 19 57 78 54 82 40 4 84 68 75 94 49 68 5 34 44 95 72 49 32 17 88 65 91 98 32 55 33 3 35 5 64 38 44 11 9 86 24 100 26 49 8 10 62 95 86 93 40 53 80 35 56 38 17 28 31 98 79 9 40 58 54 46 40 42 45 51 5 7 77 47 42 56 70 14 84 5 77 70 50 21 63 75 71 33 43 12 15 32 8 98 37 6 72 21 63 41 78 42 52 77 62 33 53 71 83 25 49 41 16 77 81 57 65 14 13 16 84 59 70 19 52 28 15 86 12 79 88 15 99 17 27 17 50 82 91 53 65 85 78 47 44 4 52 42 11 24 91 46 54 53 91 54 9 7 81 5 22 14 57 89 9 88 49 68 49 94 68 97 37 59 20 53 24 48 82 41 67 23 67 65 38 3 49 27 76 26 25 42 16 83 20 78 35 61 19 59 80 43 85 3 92 54 36 15 38 85 35 83 96 82 24 82 83 58 26 28 90 475\n707\n93 54 46 69 48 91 94 58 76 27 60 29 57 50 57 24 8 25 36 73 58 3 33 4 91 22 38 21 74 48 37 79 65 46 9 69 91 42 42 82 43 50 19 39 55 21 73 13 90 48 33 19 91 82 98 54 35 21 58 39 82 21 4 31 13 61 18 74 86 18 74 78 59 45 43 9 58 7 5 98 78 77 6 14 12 26 64 58 70 89 80 70 38 16 79 49 89 93 80 43 36 87 4 41 57 72 96 87 48 91 8 79 88 97 63 96 70 83 39 13 77 16 94 16 39 6 98 48 78 11 43 25 58 77 46 20 28 55 89 83 94 49 60 94 91 29 61 81 89 71 63 56 32 47 58 81 16 36 75 38 87 83 22 68 21 28 11 54 6 95 60 2 36 81 85 85 53 32 16 9 76 21 26 98 91 51 96 2 59 98 67 53 6 19 80 18 51 1 15 50 73 56 48 63 77 6 54 7 89 48 19 89 45 95 67 28 35 76 80 21 32 42 76 58 8 3 54 96 27 13 51 60 10 50 1 6 95 16 75 72 8 75 92 69 22 99 56 2 14 91 42 50 19 80 40 80 73 84 13 23 78 40 29 47 43 77 11 26 1 31 55 46 56 50 54 69 78 86 46 90 76 25 19 29 73 70 87 14 6 29 10 48 21 36 65 52 44 59 88 43 40 61 93 32 65 15 82 76 38 79 49 59 35 44 8 68 91 41 69 5 66 16 35 68 100 71 21 14 39 69 69 71 57 76 72 87 91 55 61 76 3 50 91 39 62 67 57 43 11 22 54 42 93 79 53 31 32 73 53 82 29 90 84 52 94 20 47 46 94 87 75 26 68 51 90 83 91 85 21 21 65 45 52 19 38 20 41 93 100 27 29 87 44 61 50 38 44 99 42 22 14 30 3 100 17 81 12 52 44 44 39 99 44 76 59 28 55 6 49 83 36 35 34 54 25 14 21 79 73 19 31 52 78 73 35 36 18 12 96 35 36 90 24 28 27 86 52 48 49 80 6 97 65 90 58 61 9 8 77 13 49 60 70 28 30 5 93 83 27 87 64 89 23 88 39 81 31 96 15 58 84 58 48 26 54 45 30 14 22 14 99 78 43 47 15 63 5 54 3 32 77 85 27 94 35 23 57 22 90 17 79 34 82 61 59 83 74 35 49 17 3 2 10 72 75 47 79 53 26 33 90 47 71 64 5 25 55 18 24 3 58 85 51 91 96 39 74 99 36 10 74 2 44 91 6 63 99 63 56 67 90 3 85 34 27 3 11 44 78 45 69 100 53 58 22 44 72 42 2 28 74 88 27 38 83 25 90 84 66 22 57 49 96 17 18 78 29 53 45 90 46 50 32 57 78 90 54 70 11 45 98 82 83 14 32 32 17 3 72 89 75 43 60 15 8 5 60 35 92 71 85 97 57 96 100 99 89 49 79 16 78 4 19 28 39 23 27 17 75 59 27 44 36 37 53 11 14 37 23 11 58 89 61 49 55 93 1 30 54 69 96 65 8 23 26 67 97 4 22 50 79 44 42 24 81 91 41 14 95 71 36 3 59 68 64 67 14 50 42 3 92 36 88 29 40 88 428\n592\n23 66 32 83 14 11 56 70 11 83 66 42 86 39 4 67 78 13 60 100 26 73 83 31 86 31 70 44 63 42 60 3 72 27 60 92 68 14 63 56 20 25 93 16 12 1 23 36 89 15 46 60 95 26 41 34 16 73 33 40 31 65 46 56 96 56 91 46 19 77 74 33 59 73 56 95 8 21 8 24 24 39 16 53 45 62 13 99 68 3 76 47 83 4 62 38 27 11 10 73 62 62 58 97 22 29 61 76 44 3 44 33 14 26 44 16 57 40 46 9 67 66 22 96 42 88 78 73 71 1 59 85 27 37 39 27 15 46 65 89 81 20 49 14 11 66 45 8 63 46 52 35 99 36 13 58 30 24 7 98 63 7 67 16 89 86 83 37 92 37 36 18 43 98 57 5 33 52 34 75 31 28 69 31 50 9 10 86 94 51 90 57 83 74 47 15 26 53 35 29 57 84 85 52 49 96 57 6 30 6 37 12 34 15 90 65 70 31 22 78 39 76 59 18 98 50 41 10 88 12 29 56 50 32 41 7 5 44 58 64 43 60 69 84 29 7 78 86 43 96 66 76 66 47 37 87 4 57 59 78 33 58 97 31 37 64 96 58 27 62 46 51 75 12 75 52 80 38 44 4 6 95 6 23 95 83 57 46 32 30 46 22 1 23 89 34 17 42 54 25 87 50 33 35 22 38 78 62 77 15 81 100 81 86 31 30 22 14 21 36 83 66 93 12 69 95 26 38 1 92 50 65 71 37 74 75 80 70 18 10 53 98 74 34 29 70 91 46 81 78 90 12 45 86 66 69 30 62 99 63 58 21 67 44 20 92 89 52 18 26 38 1 58 8 17 5 19 78 5 25 52 77 98 6 79 1 77 30 15 32 14 11 76 19 66 56 81 12 97 93 38 60 30 35 40 97 36 32 92 31 54 75 4 58 39 90 33 7 51 3 8 58 55 14 96 48 94 21 93 78 15 67 79 7 55 21 75 2 14 44 23 76 76 95 89 9 12 79 32 52 62 33 7 37 6 80 92 29 96 94 23 42 22 14 55 15 95 6 59 50 51 91 34 52 77 9 35 24 16 98 72 51 47 62 2 47 87 26 22 86 27 40 31 10 52 28 24 97 86 74 34 21 53 66 96 81 94 54 84 71 84 94 71 40 69 23 51 45 92 39 43 9 18 41 86 96 82 67 37 75 78 99 49 96 59 42 100 67 92 30 58 68 46 48 90 14 23 78 14 94 44 91 15 37 8 100 35 12 60 65 52 23 65 42 86 8 73 59 4 69 83 11 61 29 1 46 99 82 34 32 4 30 68 95 75 72 95 6 80 17 50 820\n473\n15 7 91 36 20 47 52 45 47 85 21 94 69 15 89 9 3 44 77 42 68 61 80 63 3 45 26 73 10 78 6 62 16 34 94 8 61 53 16 41 8 88 75 68 99 1 12 85 14 70 46 20 65 82 1 99 92 37 22 53 39 40 93 85 81 12 78 97 71 42 55 78 40 67 73 30 80 36 79 72 19 72 49 39 8 27 74 21 56 72 69 15 20 13 92 12 46 50 71 87 73 34 23 13 25 61 55 85 28 99 89 63 35 30 11 75 2 23 9 55 56 37 37 98 11 30 28 69 1 93 14 51 91 23 1 18 70 20 42 83 100 97 45 89 3 45 92 16 71 59 10 4 17 55 19 30 74 67 52 80 4 83 77 81 71 78 8 41 40 100 57 23 71 19 26 63 92 80 4 53 84 17 88 92 19 53 89 27 45 65 17 46 68 41 39 17 10 39 29 43 26 33 12 74 47 90 3 15 64 1 69 50 25 63 11 81 9 64 32 11 89 42 88 6 59 97 88 37 54 28 28 98 83 54 2 18 13 29 43 99 99 36 65 52 36 52 71 21 88 48 4 53 92 28 90 88 49 68 16 58 69 57 76 100 3 23 3 25 92 90 65 47 72 42 36 4 44 68 76 85 40 63 56 88 53 22 61 20 20 83 97 92 43 43 4 3 95 65 82 67 61 100 53 47 63 15 77 73 20 56 49 25 88 83 87 53 56 44 40 54 35 49 83 29 59 24 60 77 49 23 53 68 22 56 64 73 74 39 44 47 3 76 92 19 76 90 87 77 90 92 3 69 94 51 61 33 71 97 29 100 66 31 42 26 75 9 76 32 57 57 62 91 71 2 44 62 87 63 55 16 11 57 87 46 96 39 43 83 10 74 75 86 53 33 38 30 19 96 100 85 42 5 21 1 8 87 42 76 17 2 69 92 98 69 66 14 38 90 53 28 34 70 37 72 34 2 62 82 75 25 26 35 22 10 19 8 43 80 23 27 88 70 57 99 69 86 100 53 9 61 3 94 69 92 33 17 32 74 63 55 17 75 76 55 60 38 74 11 99 31 75 6 573\n783\n55 14 40 46 59 36 99 90 63 53 44 28 81 34 13 65 3 34 54 32 29 73 79 69 74 71 50 12 99 1 2 28 98 74 41 51 9 23 58 40 70 1 69 34 3 15 35 44 7 27 48 47 81 5 63 7 5 19 47 19 10 34 30 25 36 24 8 29 86 52 96 71 72 10 87 4 48 96 3 47 24 74 23 20 67 84 82 68 48 83 28 48 30 58 59 6 46 76 92 66 12 50 86 97 100 47 2 40 15 68 4 2 26 75 61 27 8 58 26 73 37 8 74 2 23 63 67 19 84 50 68 5 81 93 59 98 78 80 67 18 67 23 98 45 12 11 30 72 51 21 4 72 59 68 49 54 40 91 11 62 64 41 74 83 1 32 22 80 64 83 2 41 14 7 75 70 92 71 29 1 37 28 19 87 56 35 41 58 89 73 74 79 96 40 70 57 57 7 57 86 39 57 28 43 81 61 8 83 77 83 45 6 62 40 100 36 27 67 87 39 22 84 70 69 94 74 17 55 70 77 60 35 97 17 75 47 38 39 100 36 8 36 83 10 76 18 89 60 58 17 17 52 48 77 30 44 64 10 37 78 3 35 26 98 25 9 28 25 71 49 80 87 91 32 11 49 99 58 96 7 87 94 35 71 21 54 58 63 34 44 94 52 58 67 88 6 92 66 50 36 35 2 100 20 47 23 90 18 36 2 62 29 55 20 24 49 3 81 44 58 58 93 82 62 52 28 27 56 19 19 35 76 5 99 71 11 2 20 66 96 7 70 16 5 21 99 81 59 86 13 58 10 68 80 15 14 34 44 37 45 50 75 67 95 75 52 26 9 56 22 74 52 37 91 14 41 71 95 45 51 97 88 38 93 60 94 29 86 4 97 13 78 65 82 67 32 66 27 81 79 52 39 42 96 48 41 8 56 44 2 20 66 85 47 78 50 91 40 61 78 45 10 10 14 52 67 13 30 73 73 69 85 3 93 17 45 100 41 67 22 32 32 16 22 6 17 29 43 84 44 92 51 10 97 65 78 11 60 34 43 54 54 32 7 67 99 6 88 85 4 34 83 56 28 63 41 16 42 3 9 50 86 93 5 2 63 92 55 87 99 40 70 22 85 41 98 18 6 46 22 1 36 100 31 56 52 33 19 19 98 82 46 65 46 15 27 48 54 26 21 51 35 64 57 14 60 87 55 38 23 51 53 83 38 71 66 55 62 39 30 98 66 19 49 42 96 42 88 53 31 100 85 42 72 89 37 97 15 91 9 17 27 50 86 77 45 59 22 86 46 17 6 3 84 15 5 46 73 44 89 44 8 32 42 65 92 30 50 54 46 29 59 51 60 41 94 35 3 86 4 20 31 65 22 65 55 18 66 60 45 36 86 23 34 83 55 16 22 62 9 25 85 31 91 72 71 93 96 11 73 57 20 99 25 33 28 30 19 24 57 63 34 86 77 36 18 36 100 32 24 51 86 92 22 92 43 90 50 95 93 18 62 96 4 78 4 10 59 67 36 85 65 64 18 71 30 35 81 75 20 75 71 48 91 22 2 70 82 66 62 57 100 90 25 55 18 97 96 65 33 7 42 99 3 50 14 77 58 20 3 37 56 7 49 86 100 96 81 7 10 58 21 36 47 61 17 57 74 85 32 67 7 18 72 25 1 4 11 72 91 22 69 47 12 91 46 61 24 47 59 73 56 97 93 86 2 96 20 27 7 5 33 84 23 79 68 96 34 78 9 48 77 29 40 49 90 53 98 85 55 42 29 590\n159\n80 12 22 94 72 43 42 86 57 72 2 13 12 81 94 57 21 20 80 84 41 4 92 78 91 85 9 82 100 28 82 38 29 27 50 86 34 69 46 92 64 87 79 77 78 72 70 56 77 35 20 96 100 7 65 47 82 75 27 15 12 23 88 64 97 91 21 23 66 14 44 8 73 44 82 7 37 53 46 44 89 9 45 21 44 14 12 63 6 85 49 94 23 95 17 79 34 26 84 11 12 5 20 13 46 42 37 7 74 84 73 45 36 5 34 69 62 20 96 76 67 26 26 32 4 78 1 2 93 77 69 74 74 37 13 46 97 41 7 67 60 54 85 23 73 14 90 33 59 34 14 33 19 21 39 54 54 46 172\n643\n93 33 54 31 71 73 45 98 52 36 13 86 38 99 62 39 65 72 26 13 53 47 13 92 40 14 19 99 43 60 97 35 88 43 18 97 42 18 23 47 89 8 38 45 56 64 10 46 17 71 53 38 12 49 28 27 75 12 4 2 13 63 15 61 52 61 3 33 87 91 56 71 67 20 93 100 51 28 54 79 16 76 19 95 37 12 5 86 49 51 74 71 53 51 67 71 43 99 59 51 12 17 1 61 29 21 11 67 73 6 96 20 22 78 43 17 10 20 64 31 78 96 54 17 65 51 60 11 61 66 85 60 69 47 72 33 46 71 3 41 36 76 70 10 43 26 97 69 40 93 66 61 83 21 59 83 35 40 72 30 27 14 100 11 78 91 57 38 93 34 31 38 31 8 91 7 15 89 20 56 83 50 61 97 57 12 16 72 35 61 45 57 50 49 67 6 36 8 26 25 94 43 98 99 13 43 64 23 96 20 68 37 94 59 56 54 93 45 20 23 51 6 33 77 61 91 25 7 97 95 58 44 2 52 46 98 63 11 9 72 4 65 91 86 71 16 99 55 55 42 82 18 75 61 70 92 15 100 78 55 100 58 33 66 85 93 50 81 43 78 18 51 67 1 29 18 12 23 33 22 23 81 51 45 34 93 88 68 71 73 85 86 24 61 73 29 11 70 89 53 59 64 22 28 70 3 37 4 24 65 93 26 21 99 83 44 29 55 25 88 32 69 92 14 65 60 89 44 82 8 91 100 64 17 50 67 74 14 23 30 33 56 69 49 18 57 82 100 25 77 65 9 60 4 20 18 37 73 50 18 79 26 88 52 4 29 64 43 89 47 100 11 62 58 2 50 44 88 53 67 63 35 33 10 62 90 42 55 45 9 57 55 26 42 8 34 48 4 42 50 76 54 47 17 10 62 97 75 26 34 76 78 73 95 38 40 72 98 18 99 87 33 93 56 40 30 99 18 50 90 23 7 69 13 8 30 70 24 44 94 59 29 36 13 55 7 31 67 28 33 85 44 23 86 91 61 37 15 24 22 97 100 58 56 25 68 12 76 69 90 7 1 100 32 73 39 78 27 9 57 9 12 17 85 6 17 67 75 31 37 53 18 6 77 62 53 10 51 28 9 89 62 4 52 8 68 41 9 80 19 6 79 82 73 49 92 87 87 40 25 72 40 11 44 60 71 21 94 85 20 78 14 7 47 69 35 86 3 64 7 73 53 88 81 19 3 29 92 1 37 46 20 11 33 3 75 79 11 3 51 78 29 40 71 37 71 5 33 35 16 56 69 25 9 96 82 76 2 63 27 67 10 84 29 31 76 87 3 24 19 36 9 35 41 52 36 29 66 47 51 17 59 24 84 94 22 83 45 51 17 73 6 8 13 31 77 23 85 7 44 86 20 13 10 23 20 72 99 59 11 16 22 27 42 47 2 62 43 10 11 3 62 130\n142\n59 26 21 93 9 88 50 77 26 6 41 88 21 53 17 57 34 70 55 91 26 73 58 69 25 8 44 3 79 22 49 97 61 26 89 54 1 89 56 51 81 8 23 25 20 62 37 57 26 55 75 68 24 17 88 64 84 19 65 14 67 89 11 25 74 16 18 97 40 63 82 17 48 57 27 38 12 81 78 55 7 55 12 98 39 82 20 17 42 48 92 99 55 12 49 16 37 65 39 8 51 72 52 28 73 48 87 11 41 63 78 47 12 71 47 17 93 93 88 27 73 11 60 68 27 20 48 84 62 89 97 17 48 37 97 9 91 71 5 6 56 91\n250\n63 81 13 87 60 99 77 34 65 86 80 57 40 47 89 57 63 63 48 60 64 42 58 76 68 96 25 96 20 72 59 59 72 96 9 15 6 46 1 99 62 63 57 21 18 98 61 46 52 42 47 77 4 72 90 22 64 85 52 36 83 54 37 87 1 17 15 52 97 48 4 42 21 26 41 47 15 59 53 56 18 81 39 88 79 42 86 66 78 41 87 89 81 35 71 44 76 8 12 92 31 27 82 23 16 12 75 12 83 37 78 87 87 65 36 14 34 8 54 3 12 57 70 79 81 59 57 48 69 95 29 51 64 54 20 93 19 94 35 88 43 29 77 50 10 85 52 31 39 91 90 57 66 27 95 9 13 25 16 92 38 80 10 14 95 80 75 72 22 47 16 24 15 98 39 53 65 78 68 20 28 20 97 35 30 47 43 35 62 61 51 18 68 68 78 23 2 73 95 79 36 22 24 39 92 41 3 25 95 93 29 54 6 37 27 75 97 33 47 84 74 22 66 58 46 18 96 97 67 88 79 21 44 41 56 32 44 100 71 11 1 54 2 83 44 61 44 33 8 706\n354\n37 11 75 89 98 47 73 85 75 42 31 68 80 1 54 2 72 99 48 55 62 19 74 85 88 73 21 85 45 16 73 18 63 42 86 10 80 6 14 77 5 80 71 88 26 59 52 49 62 7 79 83 98 95 25 64 66 48 61 51 60 79 3 88 67 10 6 66 75 75 20 97 58 95 57 98 60 1 42 63 12 71 90 12 71 40 44 33 68 25 92 55 44 92 46 28 78 41 87 33 6 23 79 5 71 83 97 24 17 42 67 24 36 90 17 12 17 75 92 87 55 52 26 81 22 4 62 77 32 89 85 71 23 59 49 63 4 12 60 70 3 53 69 33 32 30 70 72 25 24 79 70 75 6 37 100 64 47 63 8 67 95 69 45 37 72 26 53 63 90 60 96 1 38 44 94 78 26 80 5 76 19 87 56 100 18 46 20 32 48 50 32 7 43 86 92 83 16 30 18 57 37 61 63 58 55 94 22 38 42 55 99 61 92 9 62 27 24 55 13 98 5 84 85 2 36 89 91 38 74 48 10 2 65 26 75 70 96 45 41 27 81 41 71 31 18 65 97 27 74 38 20 32 7 39 36 47 73 20 29 17 90 85 31 45 18 18 68 62 51 88 1 91 56 33 30 36 40 10 48 66 9 69 50 18 71 88 38 27 73 57 35 55 49 59 6 58 96 99 14 60 62 14 30 73 27 52 21 86 41 94 52 18 92 27 78 26 63 93 97 74 93 97 22 33 52 45 20 55 15 39 62 50 93 51 56 72 3 73 90 41 76 14 73 77 53 80 53 15 46 29 27 85 679\n548\n26 7 32 55 76 55 60 11 95 70 18 95 80 92 23 53 40 40 73 74 36 69 72 89 6 12 27 13 8 89 77 15 56 25 34 91 10 39 77 41 48 71 31 93 85 11 23 45 45 55 76 3 76 2 28 72 20 72 95 31 87 53 64 87 26 88 33 73 87 100 78 30 91 5 77 15 96 7 50 91 72 51 58 55 49 39 86 95 39 100 3 34 57 56 59 45 80 56 2 12 63 26 17 18 30 32 73 36 24 28 23 6 85 41 50 26 98 76 98 85 73 61 57 7 100 22 92 35 3 49 83 57 79 39 60 36 82 91 52 49 13 35 77 63 98 26 15 63 31 83 4 30 99 73 29 33 5 91 2 70 55 79 4 37 58 69 70 42 95 62 15 63 16 74 70 95 74 85 50 74 92 72 45 51 97 92 52 77 21 84 53 82 27 56 73 12 57 59 2 4 97 44 28 7 37 49 47 42 3 32 61 93 52 43 69 72 88 44 64 83 46 14 29 88 55 88 29 23 59 60 69 93 34 19 81 9 62 47 78 18 76 88 82 96 91 99 79 42 33 67 84 70 26 83 5 45 85 35 66 69 16 73 93 40 100 2 50 26 27 42 23 88 72 48 66 8 7 20 20 86 28 95 90 1 32 17 17 90 41 15 62 100 67 38 40 36 89 29 91 39 39 5 23 89 32 73 24 24 19 77 20 53 71 61 11 49 67 59 34 39 52 97 98 7 38 28 44 6 34 68 57 34 69 34 18 72 100 25 35 81 8 34 62 4 20 38 36 22 73 84 84 75 75 93 30 95 53 34 34 79 66 93 21 36 23 67 46 46 67 74 8 14 7 32 61 2 90 22 50 49 82 19 46 86 29 93 58 81 28 55 36 54 92 95 65 78 25 100 45 27 19 81 95 89 97 99 87 14 8 79 88 84 7 44 94 51 12 2 30 86 13 88 15 88 1 13 2 77 80 49 2 73 47 41 49 70 27 55 66 89 93 35 12 74 44 3 70 92 13 69 46 4 80 97 43 24 12 14 79 31 7 58 1 27 64 38 5 49 36 98 33 69 1 77 20 40 54 1 95 80 42 73 49 38 52 9 86 79 31 16 60 100 5 14 26 22 61 17 66 92 38 26 24 81 91 74 72 59 83 83 73 40 59 90 96 12 42 97 73 33 14 97 28 56 23 11 88 84 12 99 6 11 64 38 25 27 8 53 15 5 40 57 79 85 50 75 60 126\n25\n13 9 99 11 6 9 100 50 15 3 59 84 50 6 37 29 26 78 24 53 13 69 8 17 270\n149\n30 81 8 55 31 93 86 84 82 10 2 17 64 89 13 28 80 39 10 71 97 87 71 19 3 92 36 65 17 20 51 96 54 23 2 13 19 43 54 67 39 38 39 29 64 60 60 67 49 36 70 43 97 18 17 33 27 89 74 87 50 72 92 96 84 22 69 72 93 44 21 34 47 32 36 96 77 30 63 85 77 98 96 12 68 1 20 41 21 35 54 68 45 95 26 91 1 48 58 45 58 31 32 88 13 61 77 12 1 67 98 97 34 99 57 80 6 27 85 4 59 14 8 50 4 95 11 34 12 26 12 4 69 53 33 19 56 48 75 17 33 12 15 85 11 58 50 10 485\n427\n18 61 64 51 93 18 36 66 81 84 47 96 16 47 46 15 27 83 85 94 63 12 56 88 91 92 25 11 65 77 45 63 63 80 77 34 11 78 100 87 98 27 64 100 30 54 24 5 47 43 87 84 11 25 89 19 14 75 24 68 52 54 39 35 73 55 92 82 52 78 77 42 67 34 99 15 100 33 28 22 33 61 9 87 97 32 7 79 53 53 66 22 52 84 67 66 40 91 18 50 62 44 73 39 30 36 65 88 62 19 39 22 50 96 46 90 99 24 90 22 99 35 73 37 6 18 94 32 14 42 6 98 3 62 11 86 79 19 2 70 56 97 20 11 56 63 15 13 90 86 87 56 59 10 78 74 48 44 88 60 57 45 81 41 10 2 64 47 68 76 74 56 25 52 28 41 76 83 18 34 93 23 46 68 38 5 88 19 23 43 53 79 5 1 10 48 72 16 93 82 57 32 60 84 32 83 31 62 66 18 99 56 73 39 90 5 1 36 43 34 75 48 82 64 64 85 51 46 58 95 43 65 66 41 30 13 99 79 16 94 6 48 98 63 25 25 44 51 13 39 26 70 4 57 68 12 39 53 11 79 59 56 53 100 99 9 36 78 32 21 59 65 76 91 31 66 98 47 84 90 90 42 89 88 90 28 32 26 63 80 88 5 12 77 26 9 84 17 21 32 2 94 39 66 50 35 34 67 87 89 81 84 88 24 81 17 12 91 69 29 50 67 39 15 40 29 75 3 34 41 83 80 15 68 51 11 81 25 99 100 67 1 49 78 30 2 56 50 64 99 4 22 53 45 95 61 22 7 31 52 68 3 54 41 42 50 11 71 91 66 60 75 51 60 74 100 73 56 35 56 32 15 10 15 17 90 92 6 56 91 31 93 75 65 67 2 57 91 69 71 13 84 82 22 50 5 87 75 87 38 17 13 32 13 76 22 89 7 55 83 91 8 68 16 33 91 530\n99\n3 78 7 60 57 10 23 30 2 21 100 39 49 19 52 35 14 20 85 50 47 51 63 59 95 95 44 34 9 96 29 57 94 6 27 49 26 15 56 17 55 77 41 13 63 5 22 98 6 13 1 74 14 75 8 58 48 17 99 7 29 14 90 70 96 93 88 53 55 47 21 19 65 61 17 77 28 71 15 75 41 81 18 49 88 78 79 37 73 54 71 99 52 84 29 91 31 24 555\n",
"4\n2\n1 1\n4\n1 2 3 4\n4\n2 4 11 8\n3\n1 3 3\n\nSAMPLE\n",
"30\n441\n55 33 26 69 20 22 70 84 82 74 32 41 12 39 55 87 37 46 89 55 85 52 48 73 27 50 21 76 11 93 49 84 56 59 83 86 36 91 77 84 42 85 9 100 23 1 83 15 24 36 11 49 91 40 87 99 31 49 33 86 11 35 83 69 21 88 69 54 81 4 29 90 36 16 85 59 74 27 92 31 30 93 62 95 50 21 47 41 87 44 21 68 33 39 7 22 36 88 25 42 48 40 8 47 83 62 91 34 43 73 81 72 53 91 7 86 52 12 94 100 95 21 33 69 93 79 53 75 67 35 43 70 57 13 1 98 5 15 15 84 88 34 56 14 74 9 71 87 3 91 62 58 72 65 91 83 21 45 35 47 91 24 83 94 75 55 28 83 77 92 80 86 80 8 53 49 11 22 66 25 98 71 71 40 81 30 90 60 41 72 81 97 79 51 59 55 23 30 36 10 51 84 54 69 9 20 17 37 27 99 9 32 59 27 93 3 75 64 40 7 25 75 25 39 57 22 24 19 57 16 48 41 62 90 19 86 74 19 80 99 8 72 27 19 41 5 91 82 96 51 25 26 97 69 4 86 54 80 23 93 34 19 24 87 98 68 97 84 95 16 96 64 22 1 94 87 76 91 66 11 85 68 73 69 79 37 36 35 40 46 34 4 54 11 12 51 12 87 41 17 100 7 67 18 51 54 23 18 72 32 68 92 9 86 99 39 74 18 74 18 17 47 80 66 41 59 84 92 78 1 92 68 32 99 7 90 30 61 20 46 53 54 96 39 27 46 77 17 84 35 24 66 41 50 38 45 99 58 87 20 21 20 74 33 45 67 71 42 44 67 56 25 33 74 65 69 46 36 95 66 96 12 27 12 56 91 60 10 70 79 97 90 66 52 79 60 89 53 31 43 9 11 19 82 30 37 15 14 93 59 93 49 63 60 86 2 15 2 87 63 79 24 97 26 24 47 8 10 63 51 64 23 35 48 5 53 52 20 86 97 295\n586\n68 58 39 57 44 64 45 50 10 55 93 37 37 92 89 74 36 22 50 17 15 21 2 88 21 44 18 20 1 67 98 17 50 30 61 20 9 48 64 90 31 100 83 36 16 83 63 2 28 49 71 61 36 95 63 21 86 96 4 32 80 57 9 80 61 41 95 68 42 28 44 100 85 20 23 63 100 71 58 32 92 37 86 17 28 13 80 59 2 11 73 33 17 74 43 14 100 1 47 58 27 91 80 33 67 96 53 82 14 65 88 4 66 5 10 90 81 66 68 73 71 72 30 82 61 45 100 32 82 99 7 2 25 35 7 63 91 72 4 50 56 19 7 49 35 41 29 74 56 61 80 52 78 96 21 8 44 65 100 87 100 49 79 19 30 80 97 9 84 85 2 29 5 57 34 88 45 79 16 38 15 99 39 58 93 64 65 58 89 28 35 78 66 71 18 8 42 62 57 20 79 22 35 32 89 66 96 97 81 41 99 97 5 73 54 88 79 65 30 5 88 82 11 70 4 38 36 56 78 75 80 73 46 7 70 20 32 3 4 83 34 78 34 12 75 38 9 63 81 34 53 65 28 59 19 93 78 66 61 22 29 10 54 13 94 43 84 58 79 83 65 53 31 28 20 100 79 74 20 35 46 72 71 74 36 73 46 77 76 91 43 88 24 61 64 65 9 10 81 29 72 73 65 72 47 11 77 40 40 14 65 43 66 15 55 25 19 76 56 27 49 64 99 71 8 18 96 82 32 35 66 33 57 22 46 98 67 70 67 14 97 9 48 19 23 22 24 6 3 13 10 19 73 27 51 8 58 84 20 13 90 46 90 26 25 51 98 38 4 3 91 63 10 64 40 36 24 82 47 12 88 27 87 60 21 38 41 4 45 82 13 20 66 81 39 15 37 80 58 62 40 82 86 51 10 88 4 61 61 3 5 3 58 80 74 23 72 38 58 66 60 33 6 87 31 48 84 72 2 78 71 32 14 6 63 40 3 61 80 82 43 56 50 12 77 78 29 78 35 58 43 9 84 8 58 53 94 59 69 96 36 5 58 99 97 21 21 69 59 63 37 40 84 12 61 19 52 19 59 68 45 16 26 45 38 86 41 59 55 19 66 54 16 34 19 52 12 88 99 19 50 34 44 76 10 74 62 74 95 19 41 17 52 61 71 82 83 24 29 94 50 50 38 58 50 43 22 42 11 17 94 56 24 81 2 94 89 48 63 89 2 13 78 98 6 20 26 41 65 54 7 18 26 83 13 28 49 99 76 80 85 47 78 20 61 31 100 86 70 43 7 35 24 17 23 34 62 25 67 79 7 58 32 88 61 266\n487\n95 64 69 7 95 52 90 8 94 36 72 23 99 74 11 84 41 22 31 22 39 99 63 19 53 66 75 3 12 29 19 53 90 13 9 79 7 9 17 43 76 72 66 29 63 15 40 18 32 93 97 25 85 70 94 48 2 11 61 65 19 81 35 63 25 100 5 33 32 82 45 20 55 100 9 2 38 50 81 5 49 79 65 23 97 28 23 35 78 51 98 85 100 22 33 93 56 81 23 59 55 30 27 50 10 55 73 25 53 21 98 40 19 40 57 83 40 73 29 96 38 66 40 84 55 57 19 17 17 68 33 24 38 10 95 86 19 16 92 5 14 71 57 92 19 40 49 5 79 81 53 98 40 74 61 25 41 87 83 19 100 12 65 81 78 53 6 39 18 3 32 96 82 85 97 79 56 36 68 28 19 60 13 60 62 91 22 42 93 46 29 36 14 38 80 35 89 16 20 39 70 29 45 49 86 31 17 5 73 43 78 51 17 40 20 47 7 6 67 87 48 17 98 62 79 12 24 23 16 52 72 18 87 64 28 18 88 22 58 50 90 10 44 89 12 65 20 86 44 7 95 18 63 72 59 7 33 89 65 86 97 9 100 85 34 82 24 51 31 68 45 71 75 44 67 30 54 27 11 77 28 47 12 8 11 32 25 86 8 56 43 39 30 41 100 55 70 39 22 70 89 53 57 14 94 17 87 17 58 22 25 93 94 99 6 15 94 73 51 98 82 2 35 53 29 23 63 38 36 46 64 12 93 40 20 56 15 66 86 79 8 22 2 1 77 5 13 15 14 81 30 66 33 99 75 38 26 98 39 26 9 51 18 37 72 35 53 25 52 94 2 54 27 83 37 82 47 21 43 82 73 7 21 57 81 61 64 82 58 26 45 50 42 1 90 54 92 25 49 33 63 94 47 66 59 40 23 12 62 90 7 61 53 5 28 72 35 32 32 95 95 98 66 21 72 26 33 82 30 34 17 91 96 98 3 74 72 98 11 53 56 17 91 35 61 26 48 69 84 50 72 3 37 23 7 28 98 30 34 60 11 57 77 3 1 31 71 52 68 11 89 51 45 58 65 66 62 79 95 44 90 100 63 32 66 84 492\n169\n3 16 59 35 74 70 83 60 98 100 20 85 74 10 34 2 55 53 90 69 68 16 21 90 14 84 22 65 68 98 5 98 14 49 52 28 35 74 68 57 52 39 44 21 97 64 16 30 45 75 9 1 91 69 56 29 70 71 38 32 65 23 97 93 7 93 8 81 65 72 22 9 95 84 93 62 37 28 31 69 13 14 32 46 28 45 36 26 49 46 1 46 91 81 35 51 87 91 7 20 80 41 1 87 52 13 51 23 84 38 33 9 2 8 31 22 1 13 34 89 62 17 91 1 83 75 35 47 54 94 48 23 6 2 10 56 63 74 20 39 69 48 28 60 42 56 71 2 30 14 76 68 96 93 27 70 77 92 22 7 93 36 15 12 99 44 47 6 8\n133\n36 43 19 53 15 15 21 60 79 29 31 39 8 47 25 92 70 86 2 58 85 42 90 17 11 58 53 24 76 37 72 43 20 7 40 30 28 54 7 27 74 39 62 96 7 37 50 55 68 69 35 64 70 91 91 30 15 14 91 42 67 63 48 10 47 99 95 54 100 3 25 72 23 23 38 55 68 30 34 54 89 100 21 97 69 37 67 96 70 45 24 27 84 88 53 81 69 8 49 51 84 92 54 29 36 71 100 37 51 93 47 53 19 54 76 92 92 13 39 62 10 30 65 4 79 62 65 99 2 60 76 45 387\n720\n71 83 69 47 36 92 68 59 90 23 54 16 80 20 50 40 46 97 51 46 7 5 40 70 87 6 52 12 97 100 29 100 88 65 46 44 31 23 35 9 90 84 59 32 78 100 40 65 53 10 12 54 64 2 58 77 31 39 72 11 39 56 10 91 67 39 8 20 57 37 45 6 33 56 29 29 19 63 54 93 90 42 39 66 61 57 23 66 97 5 32 50 61 32 36 34 62 65 57 34 16 84 38 98 2 89 6 96 49 35 29 83 18 51 88 77 9 93 8 18 77 34 78 32 77 5 74 6 4 41 55 35 32 68 57 36 50 58 57 3 58 54 81 51 39 10 14 7 63 100 49 95 67 97 30 42 93 3 75 85 40 89 82 45 19 25 27 44 45 52 42 8 34 6 50 90 69 11 54 51 53 92 20 58 36 18 16 9 87 83 100 72 64 62 13 25 49 26 67 17 26 50 27 98 89 30 1 40 91 31 93 82 85 17 50 56 84 50 14 56 59 4 10 84 39 93 19 10 29 78 79 69 57 56 29 32 91 81 56 19 73 17 43 99 41 81 9 100 79 47 14 79 4 13 65 63 62 40 22 39 92 58 85 23 35 90 33 37 18 25 38 55 10 87 22 51 82 78 42 58 35 86 13 99 88 30 45 18 22 34 96 95 38 88 100 52 32 40 21 2 61 50 100 26 56 61 61 18 10 66 41 97 16 45 39 57 87 74 71 92 44 23 45 24 26 67 24 20 97 91 43 7 48 20 69 55 5 47 84 14 63 55 38 1 60 57 81 35 47 12 16 67 25 12 24 94 98 48 80 6 39 34 63 57 82 77 20 68 31 25 81 85 39 94 2 58 88 48 98 51 8 68 64 57 4 12 57 46 22 35 88 85 48 59 95 82 73 12 85 9 74 3 71 78 77 61 3 83 12 33 34 11 81 89 1 17 43 64 64 29 54 66 36 16 85 83 93 39 68 71 52 77 27 51 10 28 44 40 24 67 43 32 29 60 9 83 23 24 67 34 1 2 56 43 47 84 13 70 34 91 97 19 95 86 77 12 23 18 73 36 75 52 52 16 63 94 93 86 28 77 96 77 65 98 58 78 18 66 3 35 75 64 36 94 88 93 66 39 81 17 84 20 10 85 87 3 85 38 75 78 96 27 77 43 33 98 94 98 34 70 16 4 82 61 49 73 52 15 56 32 58 20 48 49 90 81 5 77 57 6 49 68 65 21 71 96 12 21 51 83 78 9 8 23 51 54 99 19 73 12 53 36 34 72 45 81 35 76 56 99 74 66 68 63 50 13 56 64 65 45 89 28 43 25 56 29 52 23 37 60 40 57 27 59 16 21 18 2 37 11 24 51 10 24 58 50 67 53 76 61 17 72 88 7 32 19 15 23 24 97 41 88 49 89 94 51 84 99 7 17 76 57 28 26 32 79 76 52 46 11 66 97 81 17 100 19 40 10 74 9 32 23 66 56 6 28 52 66 50 32 90 4 51 14 44 49 27 12 53 95 94 48 46 31 21 94 86 3 88 98 9 93 84 51 37 83 34 42 92 62 28 99 39 28 85 28 97 15 28 98 60 45 72 13 81 72 89 86 21 57 51 40 23 56 78 9 20 4 95 896\n285\n16 46 3 19 53 22 6 6 59 82 1 61 6 72 97 32 55 94 47 45 72 54 17 25 30 98 31 37 4 77 34 84 96 36 78 89 14 37 88 70 58 86 54 90 43 66 18 48 94 78 25 78 3 40 40 60 59 13 57 4 94 36 58 70 50 70 33 46 81 77 73 34 44 40 91 3 74 91 53 12 54 96 37 25 30 3 50 6 81 69 33 89 94 59 39 40 5 37 45 29 53 87 15 40 52 27 57 17 64 52 63 29 43 26 20 23 54 12 50 75 88 12 1 99 52 62 9 12 78 86 59 42 66 93 40 25 68 61 40 4 38 56 80 97 36 69 92 70 92 80 56 81 30 77 24 49 22 73 25 61 1 100 71 19 23 58 61 8 28 98 39 21 21 33 26 71 66 11 9 22 61 39 20 86 91 80 94 80 22 6 66 29 54 28 44 8 5 18 84 40 16 91 85 40 64 6 18 57 9 8 1 83 80 54 97 78 17 98 6 99 35 61 76 70 58 13 18 86 63 32 91 80 19 78 43 27 97 82 80 3 42 91 36 56 97 92 96 85 52 14 70 5 51 95 46 30 47 33 24 95 68 28 58 93 15 77 53 46 3 38 72 66 15 17 91 45 65 14 87 92 76 44 72 48 578\n495\n53 26 90 65 33 25 2 57 17 6 51 48 47 16 24 96 26 77 61 17 84 76 50 11 89 52 71 64 71 69 51 65 94 93 15 99 100 42 20 13 9 31 67 25 1 14 74 93 53 17 62 8 36 81 67 2 21 3 23 90 17 78 24 42 92 98 12 46 15 49 9 82 18 83 73 18 22 6 27 65 75 47 40 33 29 74 94 72 50 3 81 78 66 35 62 85 91 50 78 94 30 1 16 25 77 54 44 100 92 7 40 76 43 51 85 1 94 86 72 63 5 72 100 76 29 31 99 55 69 73 96 64 72 59 100 82 19 40 27 26 3 13 97 14 92 30 47 47 62 12 49 91 28 92 27 61 60 85 78 99 69 43 22 28 39 98 33 85 52 98 65 3 41 64 76 100 77 64 56 36 12 80 21 86 90 76 69 69 84 67 48 52 33 68 91 91 84 52 87 61 23 53 23 77 60 68 26 8 44 30 53 72 54 87 32 50 71 96 46 30 65 12 61 97 28 29 13 38 29 52 33 58 55 68 19 71 70 97 11 79 14 60 91 39 41 74 7 68 76 80 91 69 65 21 89 98 62 63 35 27 2 26 61 47 17 34 34 43 56 8 29 26 80 92 81 33 14 91 96 89 98 30 61 71 7 20 67 86 69 66 90 73 12 48 6 67 64 44 81 73 11 30 8 58 32 5 33 53 8 95 34 57 37 19 33 67 68 23 43 95 51 79 77 48 60 38 100 93 49 73 4 54 31 19 95 6 3 10 62 19 48 57 58 4 31 72 37 54 77 24 64 49 93 16 18 44 29 64 39 96 10 61 89 19 5 92 33 59 80 63 79 43 49 27 85 37 57 71 20 88 35 81 32 76 22 41 66 37 100 30 32 78 24 54 41 42 97 11 5 72 85 97 79 7 46 10 49 16 28 47 54 73 38 54 28 31 50 81 24 69 45 56 30 95 7 25 81 64 85 49 68 85 2 79 16 13 82 40 89 59 28 24 21 67 43 14 66 3 32 59 98 81 73 56 95 31 18 96 71 61 73 8 64 42 97 68 64 15 97 56 56 23 10 44 79 80 57 67 5 42 7 6 41 91 61 18 36 62 91 50 40 47 61 16 590\n602\n2 4 17 49 46 22 70 79 94 25 65 45 93 94 78 56 22 92 57 41 96 55 69 41 7 32 18 83 39 74 71 86 53 87 55 73 34 75 44 94 78 42 98 48 5 15 96 8 67 43 93 34 92 11 49 90 30 68 93 81 32 57 70 30 82 60 86 86 58 95 26 20 51 86 70 57 98 3 19 65 46 31 72 20 69 27 2 41 82 70 67 7 56 64 46 91 29 94 16 2 26 76 63 11 13 94 15 84 96 23 47 90 75 34 24 99 95 73 28 34 3 66 81 65 38 97 42 22 94 83 51 31 64 91 53 35 90 10 92 57 1 46 63 9 20 13 32 90 46 56 38 50 66 9 24 30 15 59 44 84 28 62 95 55 19 13 78 55 94 31 49 78 29 44 45 81 83 40 86 11 41 97 59 2 74 77 68 92 86 72 40 95 89 66 50 31 58 68 96 57 80 37 13 86 77 78 9 86 97 1 84 8 57 40 40 97 6 71 80 80 11 50 55 42 42 48 70 100 37 20 29 11 54 84 26 9 63 79 99 33 13 66 33 90 40 78 69 23 19 42 59 34 85 38 98 39 3 51 42 100 3 8 2 28 46 98 48 51 94 10 54 57 33 17 42 62 24 54 83 95 27 41 64 63 94 39 38 56 75 80 54 86 65 47 97 21 89 11 44 90 74 91 11 59 56 65 54 10 76 5 69 66 23 65 13 56 8 79 33 46 99 25 72 6 50 49 22 65 9 37 39 56 40 64 49 12 84 94 43 71 38 49 12 20 54 44 99 71 4 72 34 15 6 30 96 9 41 61 86 58 30 32 30 34 98 12 45 50 47 44 5 13 9 94 3 59 26 65 26 23 31 38 76 29 99 70 81 44 9 41 36 58 55 12 84 46 37 49 37 21 6 91 23 4 47 84 87 63 87 91 80 68 73 90 69 68 60 63 72 5 2 39 27 92 86 99 97 98 22 40 6 65 22 31 99 27 11 10 73 82 92 58 65 70 30 68 96 34 92 84 34 53 52 91 1 54 66 93 64 40 50 79 48 3 26 72 63 94 70 63 39 67 40 32 92 72 1 79 24 59 41 17 41 33 16 77 75 9 82 13 18 55 53 68 71 40 18 27 99 66 1 22 100 70 86 24 41 64 53 89 65 85 6 8 49 89 59 31 39 72 47 77 26 31 19 85 85 38 94 34 74 65 35 75 27 90 76 94 49 97 48 26 36 62 30 76 34 36 3 60 13 52 52 31 40 7 96 53 96 35 98 38 72 74 71 78 15 84 77 4 92 60 59 41 28 95 44 17 99 39 73 70 74 42 36 17 72 87 1 37 66 59 87 42 73 87 60 28 40 30 72 205\n571\n93 41 40 61 62 16 16 100 51 62 4 33 32 88 54 18 93 17 97 98 1 86 63 72 57 24 12 44 76 21 34 51 39 29 83 93 38 17 66 66 81 34 4 96 33 60 88 60 63 27 40 99 16 92 30 79 49 16 32 21 89 31 8 46 49 18 8 73 5 51 20 96 100 63 66 62 44 12 6 64 41 56 97 64 95 77 16 95 40 40 43 49 92 15 58 98 63 34 12 15 65 39 77 3 80 54 10 61 9 25 4 84 73 34 16 92 97 12 45 69 11 75 87 22 57 45 70 50 44 36 93 26 58 57 26 67 66 21 39 54 9 65 15 14 97 75 50 18 73 63 79 46 29 71 84 41 73 68 86 22 57 52 31 52 17 46 22 32 52 28 100 68 34 84 10 36 48 15 90 57 56 67 39 9 57 56 6 20 59 12 33 69 14 57 78 80 78 57 39 49 48 75 1 9 23 16 97 83 41 70 78 79 62 9 65 69 97 98 52 69 56 97 6 68 5 37 26 68 36 53 36 92 58 10 7 51 22 17 94 27 1 83 11 39 51 12 69 3 53 35 30 19 6 54 50 67 56 84 30 4 44 6 56 23 14 2 43 71 93 63 27 92 42 37 43 98 33 39 56 92 52 86 3 5 15 83 31 9 82 77 76 29 70 15 93 43 68 19 30 29 11 59 63 79 30 4 5 22 64 89 79 82 70 34 47 94 62 72 42 87 82 90 38 47 22 80 71 12 61 13 81 70 55 44 51 19 35 80 57 75 99 42 32 86 79 56 12 75 91 8 100 48 81 54 24 46 69 46 48 38 13 36 95 13 58 24 92 22 5 39 21 33 87 33 41 60 54 82 30 26 78 71 16 84 69 31 25 24 69 100 73 87 22 40 2 35 50 1 45 6 88 48 55 16 28 47 100 95 13 74 9 28 54 74 50 44 78 42 83 4 46 55 39 40 62 13 67 93 28 77 59 21 6 57 46 74 90 32 18 67 92 33 51 61 25 9 83 54 54 48 7 36 98 97 7 68 54 94 34 68 28 58 74 21 69 64 44 53 68 3 86 11 61 84 99 50 48 39 26 82 1 68 38 83 10 62 89 29 92 70 91 84 61 38 56 33 66 86 8 75 2 31 3 97 79 13 30 8 73 75 83 73 14 82 30 91 53 49 91 56 59 49 34 12 44 46 2 93 50 15 17 95 78 93 57 39 22 52 8 89 29 96 11 99 28 57 71 71 66 91 91 36 1 52 100 60 48 69 23 20 27 6 77 5 93 73 53 84 89 48 611\n408\n41 87 5 89 24 7 54 4 29 92 31 7 78 54 91 23 89 18 48 1 69 49 51 9 29 3 78 60 21 90 4 100 87 29 22 70 31 97 74 90 86 11 72 90 7 35 34 42 73 40 9 44 54 21 12 19 68 90 33 14 67 29 13 28 20 64 36 72 3 50 72 13 6 82 75 13 67 54 15 68 38 58 62 37 21 52 9 53 13 7 38 17 4 39 48 88 20 67 29 18 79 4 29 68 100 75 25 80 23 11 79 53 42 72 21 96 95 53 68 17 96 96 49 61 38 2 87 84 66 1 7 23 15 18 23 92 77 71 87 15 71 57 59 70 25 81 13 48 33 86 99 66 54 21 33 84 46 26 34 29 14 78 16 63 59 46 10 51 11 95 65 92 66 44 58 40 39 65 50 60 54 63 34 62 92 41 23 48 38 86 63 26 58 49 72 45 97 26 17 81 87 25 12 6 29 46 9 55 10 74 75 27 67 50 33 80 45 89 68 86 59 35 32 85 8 56 58 56 14 62 18 56 56 14 78 52 1 2 24 35 84 15 25 5 69 50 33 54 47 2 14 6 79 29 34 34 34 6 51 71 30 47 91 20 36 56 81 16 45 82 1 40 68 43 90 79 59 96 88 98 13 5 25 20 83 82 48 59 24 79 40 7 7 60 71 89 63 63 14 74 5 10 63 10 49 58 89 9 81 37 51 56 37 47 1 32 29 63 48 11 15 65 7 71 26 93 71 57 44 95 36 81 84 42 81 77 28 42 18 42 51 96 65 69 5 11 98 64 48 53 68 66 79 95 27 85 93 39 69 15 40 98 41 51 74 14 99 14 18 59 1 23 43 48 83 91 65 94 66 11 55 3 58 48 48 28 22 12 55 35 41 90 86 73 40 8 73 100 33 27 32 83 37 79 5 78 78 364\n587\n96 77 83 26 47 5 36 98 28 73 52 95 82 76 24 72 69 83 59 7 73 43 9 18 20 93 13 10 56 14 5 52 70 34 11 24 71 60 34 57 94 85 36 80 47 12 46 38 97 55 10 49 49 63 43 88 58 44 69 20 96 8 33 22 32 69 51 48 56 31 66 78 98 77 65 27 95 32 81 100 1 23 83 9 72 30 59 43 94 43 82 19 97 46 54 24 90 60 89 81 4 16 20 32 99 4 9 83 99 60 30 64 52 42 65 40 1 19 47 80 51 91 41 83 95 25 21 31 66 26 85 60 90 57 44 93 81 95 3 77 73 3 25 34 45 64 68 3 64 51 77 32 62 55 56 13 83 18 99 89 68 89 91 27 67 84 38 10 78 31 6 34 25 54 72 81 58 3 78 5 56 17 41 14 27 27 20 30 70 39 99 41 77 83 58 8 36 28 28 20 3 1 10 70 42 2 65 85 85 32 50 51 4 76 20 79 76 79 30 35 91 97 56 48 47 11 6 70 63 57 79 14 92 25 4 63 46 23 4 11 47 80 95 100 32 95 20 61 88 57 2 59 59 61 22 64 17 34 70 59 64 29 55 83 93 21 89 84 31 21 81 78 45 3 56 79 63 27 68 5 58 49 71 70 79 79 8 82 6 37 96 90 73 54 65 51 30 56 75 87 100 12 5 75 43 12 81 15 20 63 78 24 59 64 90 79 79 79 82 98 93 79 92 37 99 52 5 37 26 12 40 25 23 3 4 70 86 59 6 64 22 5 70 38 49 62 4 53 62 92 94 62 47 8 23 11 24 21 12 14 52 60 29 22 89 77 65 43 73 25 10 57 29 2 22 88 96 18 40 98 44 38 19 90 99 46 76 40 84 21 17 73 96 54 96 46 8 3 83 96 56 87 98 71 5 73 53 48 48 89 41 79 11 23 12 17 67 68 40 64 36 28 67 46 59 78 60 10 80 28 44 89 74 34 33 89 95 27 70 16 41 32 29 14 78 88 66 58 66 52 91 46 6 17 93 18 99 18 27 6 29 98 11 8 45 10 3 13 87 52 24 6 100 87 21 39 80 26 98 21 3 2 75 36 96 32 16 58 23 55 16 38 39 30 17 34 68 45 89 5 55 8 80 91 61 68 8 53 39 6 31 25 30 17 74 57 34 1 64 24 92 69 7 18 4 34 5 71 5 98 72 27 18 43 73 10 22 20 57 80 6 50 31 63 86 2 55 50 40 63 39 92 23 51 56 26 54 45 65 75 28 99 59 80 39 10 27 35 19 9 89 41 66 32 51 92 36 83 64 23 87 72 34 19 66 7 161\n15\n11 27 3 95 25 29 20 62 74 14 88 44 65 7 42\n320\n45 15 29 92 66 76 12 60 45 77 43 35 9 36 18 62 61 32 77 61 70 51 19 13 41 90 4 25 72 47 4 32 20 34 47 90 1 50 74 54 77 75 35 66 65 57 8 74 16 34 35 38 61 54 99 83 3 97 63 38 26 13 51 26 20 63 4 81 9 77 52 97 82 38 99 37 56 5 43 17 78 95 63 61 48 83 76 62 69 64 37 53 43 14 38 50 1 26 72 90 100 10 46 91 41 67 4 98 43 61 58 4 72 86 94 97 78 41 97 18 69 60 50 24 68 97 8 48 93 75 15 89 57 70 12 61 36 7 19 68 96 87 35 82 80 49 58 45 40 88 31 68 57 1 36 82 92 41 49 96 90 77 22 53 94 73 91 25 84 75 6 95 19 89 51 59 28 15 11 52 11 82 83 93 96 24 47 1 9 21 5 64 19 39 51 59 52 53 30 44 78 28 91 13 98 31 77 68 96 35 4 92 43 12 68 61 43 86 93 72 19 95 19 84 35 24 41 90 95 41 23 40 11 27 86 82 89 59 85 4 13 84 100 53 29 84 36 29 80 56 7 8 70 23 26 73 71 94 62 27 66 43 8 5 42 67 3 41 56 71 80 41 98 2 10 59 74 32 45 57 12 88 58 50 35 12 63 30 81 3 61 34 33 36 27 87 80 73 19 92 41 73 52 74 86 95 73 47 10 93 46 59 31 30 89 55 49 15 91 941\n511\n65 64 45 75 13 43 36 67 92 63 56 53 22 55 3 75 25 12 16 76 33 53 46 34 3 37 83 91 12 83 44 2 54 100 23 90 78 26 61 69 13 8 82 51 69 75 34 47 98 98 45 51 37 18 86 84 50 32 61 12 50 42 61 66 68 24 16 62 34 62 45 65 35 95 8 100 14 68 36 25 30 85 43 52 53 75 16 20 44 13 100 53 39 74 78 52 78 73 2 49 70 5 26 46 32 61 32 75 6 66 12 77 17 3 93 55 38 71 74 78 66 35 7 19 84 58 66 18 58 32 5 20 37 35 73 11 90 86 42 51 76 78 42 52 75 73 39 31 83 18 31 92 87 68 56 37 89 76 25 52 72 48 8 2 22 57 83 79 30 88 1 64 31 94 17 87 24 54 63 33 62 24 43 61 79 33 27 33 6 48 52 92 100 38 75 19 22 47 55 11 50 92 21 17 46 22 29 17 14 44 41 54 7 50 32 46 6 37 28 79 26 37 88 54 86 50 92 10 4 92 9 44 93 40 88 13 56 10 12 78 95 36 40 40 50 45 92 31 27 21 88 29 28 53 41 38 85 1 63 8 15 38 67 76 59 82 20 42 89 40 28 24 51 38 38 45 23 55 36 62 62 62 25 1 6 78 92 17 82 70 98 43 79 86 32 73 22 12 8 5 41 7 2 37 79 45 85 13 40 61 22 10 95 32 87 5 82 79 35 11 10 33 24 31 97 56 18 35 94 100 60 17 82 66 19 8 95 25 15 58 59 49 42 35 85 51 11 83 50 17 49 94 47 52 10 7 73 4 33 48 89 40 64 15 13 26 10 48 11 74 61 28 22 3 49 76 80 48 93 74 38 49 52 69 65 21 5 83 31 32 49 87 43 71 5 67 96 27 35 75 62 55 63 8 62 1 86 24 75 100 20 5 24 43 51 19 61 87 43 25 12 93 17 76 14 15 13 68 5 36 15 41 22 21 7 23 30 79 30 59 89 2 53 93 85 77 14 46 16 36 96 28 61 49 68 81 95 78 56 84 51 24 9 81 64 72 18 64 14 41 4 84 98 36 17 9 9 30 96 97 44 72 48 13 29 55 35 95 81 53 92 2 56 95 37 52 7 86 42 30 39 34 52 66 89 26 9 94 54 75 815\n467\n89 88 74 5 36 82 77 49 18 60 58 58 89 18 6 55 94 32 2 52 34 87 9 95 90 35 11 2 30 2 6 41 26 98 87 84 56 9 38 98 87 45 76 86 80 48 47 100 3 83 73 82 90 70 50 63 5 17 53 7 65 33 42 38 16 20 35 90 96 15 57 82 53 6 64 65 27 65 82 1 40 63 38 99 95 9 57 24 60 34 21 7 51 80 33 2 69 59 55 6 79 37 67 53 7 6 46 20 20 7 61 57 7 3 85 22 91 78 62 16 31 71 47 38 38 100 1 51 21 94 29 88 50 79 11 100 71 31 19 57 69 70 22 44 2 69 20 73 80 97 94 97 99 11 40 37 87 49 26 25 96 77 77 65 99 38 38 58 42 6 82 48 9 67 30 94 98 62 64 71 87 9 26 51 54 81 59 49 61 84 23 2 73 65 6 18 53 17 51 22 90 34 33 15 34 75 58 68 78 18 76 63 20 76 77 82 54 3 22 19 97 7 97 93 45 76 43 2 33 51 7 86 4 82 16 39 88 75 79 99 72 17 20 15 4 56 18 47 19 57 78 54 82 40 4 84 68 75 94 49 68 5 34 44 95 72 49 32 17 88 65 91 98 32 55 33 3 35 5 64 38 44 11 9 86 24 100 26 49 8 10 62 95 86 93 40 53 80 35 56 38 17 28 31 98 79 9 40 58 54 46 40 42 45 51 5 7 77 47 42 56 70 14 84 5 77 70 50 21 63 75 71 33 43 12 15 32 8 98 37 6 72 21 63 41 78 42 52 77 62 33 53 71 83 25 49 41 16 77 81 57 65 14 13 16 84 59 70 19 52 28 15 86 12 79 88 15 99 17 27 17 50 82 91 53 65 85 78 47 44 4 52 42 11 24 91 46 54 53 91 54 9 7 81 5 22 14 57 89 9 88 49 68 49 94 68 97 37 59 20 53 24 48 82 41 67 23 67 65 38 3 49 27 76 26 25 42 16 83 20 78 35 61 19 59 80 43 85 3 92 54 36 15 38 85 35 83 96 82 24 82 83 58 26 28 90 475\n707\n93 54 46 69 48 91 94 58 76 27 60 29 57 50 57 24 8 25 36 73 58 3 33 4 91 22 38 21 74 48 37 79 65 46 9 69 91 42 42 82 43 50 19 39 55 21 73 13 90 48 33 19 91 82 98 54 35 21 58 39 82 21 4 31 13 61 18 74 86 18 74 78 59 45 43 9 58 7 5 98 78 77 6 14 12 26 64 58 70 89 80 70 38 16 79 49 89 93 80 43 36 87 4 41 57 72 96 87 48 91 8 79 88 97 63 96 70 83 39 13 77 16 94 16 39 6 98 48 78 11 43 25 58 77 46 20 28 55 89 83 94 49 60 94 91 29 61 81 89 71 63 56 32 47 58 81 16 36 75 38 87 83 22 68 21 28 11 54 6 95 60 2 36 81 85 85 53 32 16 9 76 21 26 98 91 51 96 2 59 98 67 53 6 19 80 18 51 1 15 50 73 56 48 63 77 6 54 7 89 48 19 89 45 95 67 28 35 76 80 21 32 42 76 58 8 3 54 96 27 13 51 60 10 50 1 6 95 16 75 72 8 75 92 69 22 99 56 2 14 91 42 50 19 80 40 80 73 84 13 23 78 40 29 47 43 77 11 26 1 31 55 46 56 50 54 69 78 86 46 90 76 25 19 29 73 70 87 14 6 29 10 48 21 36 65 52 44 59 88 43 40 61 93 32 65 15 82 76 38 79 49 59 35 44 8 68 91 41 69 5 66 16 35 68 100 71 21 14 39 69 69 71 57 76 72 87 91 55 61 76 3 50 91 39 62 67 57 43 11 22 54 42 93 79 53 31 32 73 53 82 29 90 84 52 94 20 47 46 94 87 75 26 68 51 90 83 91 85 21 21 65 45 52 19 38 20 41 93 100 27 29 87 44 61 50 38 44 99 42 22 14 30 3 100 17 81 12 52 44 44 39 99 44 76 59 28 55 6 49 83 36 35 34 54 25 14 21 79 73 19 31 52 78 73 35 36 18 12 96 35 36 90 24 28 27 86 52 48 49 80 6 97 65 90 58 61 9 8 77 13 49 60 70 28 30 5 93 83 27 87 64 89 23 88 39 81 31 96 15 58 84 58 48 26 54 45 30 14 22 14 99 78 43 47 15 63 5 54 3 32 77 85 27 94 35 23 57 22 90 17 79 34 82 61 59 83 74 35 49 17 3 2 10 72 75 47 79 53 26 33 90 47 71 64 5 25 55 18 24 3 58 85 51 91 96 39 74 99 36 10 74 2 44 91 6 63 99 63 56 67 90 3 85 34 27 3 11 44 78 45 69 100 53 58 22 44 72 42 2 28 74 88 27 38 83 25 90 84 66 22 57 49 96 17 18 78 29 53 45 90 46 50 32 57 78 90 54 70 11 45 98 82 83 14 32 32 17 3 72 89 75 43 60 15 8 5 60 35 92 71 85 97 57 96 100 99 89 49 79 16 78 4 19 28 39 23 27 17 75 59 27 44 36 37 53 11 14 37 23 11 58 89 61 49 55 93 1 30 54 69 96 65 8 23 26 67 97 4 22 50 79 44 42 24 81 91 41 14 95 71 36 3 59 68 64 67 14 50 42 3 92 36 88 29 40 88 428\n592\n23 66 32 83 14 11 56 70 11 83 66 42 86 39 4 67 78 13 60 100 26 73 83 31 86 31 70 44 63 42 60 3 72 27 60 92 68 14 63 56 20 25 93 16 12 1 23 36 89 15 46 60 95 26 41 34 16 73 33 40 31 65 46 56 96 56 91 46 19 77 74 33 59 73 56 95 8 21 8 24 24 39 16 53 45 62 13 99 68 3 76 47 83 4 62 38 27 11 10 73 62 62 58 97 22 29 61 76 44 3 44 33 14 26 44 16 57 40 46 9 67 66 22 96 42 88 78 73 71 1 59 85 27 37 39 27 15 46 65 89 81 20 49 14 11 66 45 8 63 46 52 35 99 36 13 58 30 24 7 98 63 7 67 16 89 86 83 37 92 37 36 18 43 98 57 5 33 52 34 75 31 28 69 31 50 9 10 86 94 51 90 57 83 74 47 15 26 53 35 29 57 84 85 52 49 96 57 6 30 6 37 12 34 15 90 65 70 31 22 78 39 76 59 18 98 50 41 10 88 12 29 56 50 32 41 7 5 44 58 64 43 60 69 84 29 7 78 86 43 96 66 76 66 47 37 87 4 57 59 78 33 58 97 31 37 64 96 58 27 62 46 51 75 12 75 52 80 38 44 4 6 95 6 23 95 83 57 46 32 30 46 22 1 23 89 34 17 42 54 25 87 50 33 35 22 38 78 62 77 15 81 100 81 86 31 30 22 14 21 36 83 66 93 12 69 95 26 38 1 92 50 65 71 37 74 75 80 70 18 10 53 98 74 34 29 70 91 46 81 78 90 12 45 86 66 69 30 62 99 63 58 21 67 44 20 92 89 52 18 26 38 1 58 8 17 5 19 78 5 25 52 77 98 6 79 1 77 30 15 32 14 11 76 19 66 56 81 12 97 93 38 60 30 35 40 97 36 32 92 31 54 75 4 58 39 90 33 7 51 3 8 58 55 14 96 48 94 21 93 78 15 67 79 7 55 21 75 2 14 44 23 76 76 95 89 9 12 79 32 52 62 33 7 37 6 80 92 29 96 94 23 42 22 14 55 15 95 6 59 50 51 91 34 52 77 9 35 24 16 98 72 51 47 62 2 47 87 26 22 86 27 40 31 10 52 28 24 97 86 74 34 21 53 66 96 81 94 54 84 71 84 94 71 40 69 23 51 45 92 39 43 9 18 41 86 96 82 67 37 75 78 99 49 96 59 42 100 67 92 30 58 68 46 48 90 14 23 78 14 94 44 91 15 37 8 100 35 12 60 65 52 23 65 42 86 8 73 59 4 69 83 11 61 29 1 46 99 82 34 32 4 30 68 95 75 72 95 6 80 17 50 820\n473\n15 7 91 36 20 47 52 45 47 85 21 94 69 15 89 9 3 44 77 42 68 61 80 63 3 45 26 73 10 78 6 62 16 34 94 8 61 53 16 41 8 88 75 68 99 1 12 85 14 70 46 20 65 82 1 99 92 37 22 53 39 40 93 85 81 12 78 97 71 42 55 78 40 67 73 30 80 36 79 72 19 72 49 39 8 27 74 21 56 72 69 15 20 13 92 12 46 50 71 87 73 34 23 13 25 61 55 85 28 99 89 63 35 30 11 75 2 23 9 55 56 37 37 98 11 30 28 69 1 93 14 51 91 23 1 18 70 20 42 83 100 97 45 89 3 45 92 16 71 59 10 4 17 55 19 30 74 67 52 80 4 83 77 81 71 78 8 41 40 100 57 23 71 19 26 63 92 80 4 53 84 17 88 92 19 53 89 27 45 65 17 46 68 41 39 17 10 39 29 43 26 33 12 74 47 90 3 15 64 1 69 50 25 63 11 81 9 64 32 11 89 42 88 6 59 97 88 37 54 28 28 98 83 54 2 18 13 29 43 99 99 36 65 52 36 52 71 21 88 48 4 53 92 28 90 88 49 68 16 58 69 57 76 100 3 23 3 25 92 90 65 47 72 42 36 4 44 68 76 85 40 63 56 88 53 22 61 20 20 83 97 92 43 43 4 3 95 65 82 67 61 100 53 47 63 15 77 73 20 56 49 25 88 83 87 53 56 44 40 54 35 49 83 29 59 24 60 77 49 23 53 68 22 56 64 73 74 39 44 47 3 76 92 19 76 90 87 77 90 92 3 69 94 51 61 33 71 97 29 100 66 31 42 26 75 9 76 32 57 57 62 91 71 2 44 62 87 63 55 16 11 57 87 46 96 39 43 83 10 74 75 86 53 33 38 30 19 96 100 85 42 5 21 1 8 87 42 76 17 2 69 92 98 69 66 14 38 90 53 28 34 70 37 72 34 2 62 82 75 25 26 35 22 10 19 8 43 80 23 27 88 70 57 99 69 86 100 53 9 61 3 94 69 92 33 17 32 74 63 55 17 75 76 55 60 38 74 11 99 31 75 6 573\n783\n55 14 40 46 59 36 99 90 63 53 44 28 81 34 13 65 3 34 54 32 29 73 79 69 74 71 50 12 99 1 2 28 98 74 41 51 9 23 58 40 70 1 69 34 3 15 35 44 7 27 48 47 81 5 63 7 5 19 47 19 10 34 30 25 36 24 8 29 86 52 96 71 72 10 87 4 48 96 3 47 24 74 23 20 67 84 82 68 48 83 28 48 30 58 59 6 46 76 92 66 12 50 86 97 100 47 2 40 15 68 4 2 26 75 61 27 8 58 26 73 37 8 74 2 23 63 67 19 84 50 68 5 81 93 59 98 78 80 67 18 67 23 98 45 12 11 30 72 51 21 4 72 59 68 49 54 40 91 11 62 64 41 74 83 1 32 22 80 64 83 2 41 14 7 75 70 92 71 29 1 37 28 19 87 56 35 41 58 89 73 74 79 96 40 70 57 57 7 57 86 39 57 28 43 81 61 8 83 77 83 45 6 62 40 100 36 27 67 87 39 22 84 70 69 94 74 17 55 70 77 60 35 97 17 75 47 38 39 100 36 8 36 83 10 76 18 89 60 58 17 17 52 48 77 30 44 64 10 37 78 3 35 26 98 25 9 28 25 71 49 80 87 91 32 11 49 99 58 96 7 87 94 35 71 21 54 58 63 34 44 94 52 58 67 88 6 92 66 50 36 35 2 100 20 47 23 90 18 36 2 62 29 55 20 24 49 3 81 44 58 58 93 82 62 52 28 27 56 19 19 35 76 5 99 71 11 2 20 66 96 7 70 16 5 21 99 81 59 86 13 58 10 68 80 15 14 34 44 37 45 50 75 67 95 75 52 26 9 56 22 74 52 37 91 14 41 71 95 45 51 97 88 38 93 60 94 29 86 4 97 13 78 65 82 67 32 66 27 81 79 52 39 42 96 48 41 8 56 44 2 20 66 85 47 78 50 91 40 61 78 45 10 10 14 52 67 13 30 73 73 69 85 3 93 17 45 100 41 67 22 32 32 16 22 6 17 29 43 84 44 92 51 10 97 65 78 11 60 34 43 54 54 32 7 67 99 6 88 85 4 34 83 56 28 63 41 16 42 3 9 50 86 93 5 2 63 92 55 87 99 40 70 22 85 41 98 18 6 46 22 1 36 100 31 56 52 33 19 19 98 82 46 65 46 15 27 48 54 26 21 51 35 64 57 14 60 87 55 38 23 51 53 83 38 71 66 55 62 39 30 98 66 19 49 42 96 42 88 53 31 100 85 42 72 89 37 97 15 91 9 17 27 50 86 77 45 59 22 86 46 17 6 3 84 15 5 46 73 44 89 44 8 32 42 65 92 30 50 54 46 29 59 51 60 41 94 35 3 86 4 20 31 65 22 65 55 18 66 60 45 36 86 23 34 83 55 16 22 62 9 25 85 31 91 72 71 93 96 11 73 57 20 99 25 33 28 30 19 24 57 63 34 86 77 36 18 36 100 32 24 51 86 92 22 92 43 90 50 95 93 18 62 96 4 78 4 10 59 67 36 85 65 64 18 71 30 35 81 75 20 75 71 48 91 22 2 70 82 66 62 57 100 90 25 55 18 97 96 65 33 7 42 99 3 50 14 77 58 20 3 37 56 7 49 86 100 96 81 7 10 58 21 36 47 61 17 57 74 85 32 67 7 18 72 25 1 4 11 72 91 22 69 47 12 91 46 61 24 47 59 73 56 97 93 86 2 96 20 27 7 5 33 84 23 79 68 96 34 78 9 48 77 29 40 49 90 53 98 85 55 42 29 590\n159\n80 12 22 94 72 43 42 86 57 72 2 13 12 81 94 57 21 20 80 84 41 4 92 78 91 85 9 82 100 28 82 38 29 27 50 86 34 69 46 92 64 87 79 77 78 72 70 56 77 35 20 96 100 7 65 47 82 75 27 15 12 23 88 64 97 91 21 23 66 14 44 8 73 44 82 7 37 53 46 44 89 9 45 21 44 14 12 63 6 85 49 94 23 95 17 79 34 26 84 11 12 5 20 13 46 42 37 7 74 84 73 45 36 5 34 69 62 20 96 76 67 26 26 32 4 78 1 2 93 77 69 74 74 37 13 46 97 41 7 67 60 54 85 23 73 14 90 33 59 34 14 33 19 21 39 54 54 46 172\n643\n93 33 54 31 71 73 45 98 52 36 13 86 38 99 62 39 65 72 26 13 53 47 13 92 40 14 19 99 43 60 97 35 88 43 18 97 42 18 23 47 89 8 38 45 56 64 10 46 17 71 53 38 12 49 28 27 75 12 4 2 13 63 15 61 52 61 3 33 87 91 56 71 67 20 93 100 51 28 54 79 16 76 19 95 37 12 5 86 49 51 74 71 53 51 67 71 43 99 59 51 12 17 1 61 29 21 11 67 73 6 96 20 22 78 43 17 10 20 64 31 78 96 54 17 65 51 60 11 61 66 85 60 69 47 72 33 46 71 3 41 36 76 70 10 43 26 97 69 40 93 66 61 83 21 59 83 35 40 72 30 27 14 100 11 78 91 57 38 93 34 31 38 31 8 91 7 15 89 20 56 83 50 61 97 57 12 16 72 35 61 45 57 50 49 67 6 36 8 26 25 94 43 98 99 13 43 64 23 96 20 68 37 94 59 56 54 93 45 20 23 51 6 33 77 61 91 25 7 97 95 58 44 2 52 46 98 63 11 9 72 4 65 91 86 71 16 99 55 55 42 82 18 75 61 70 92 15 100 78 55 100 58 33 66 85 93 50 81 43 78 18 51 67 1 29 18 12 23 33 22 23 81 51 45 34 93 88 68 71 73 85 86 24 61 73 29 11 70 89 53 59 64 22 28 70 3 37 4 24 65 93 26 21 99 83 44 29 55 25 88 32 69 92 14 65 60 89 44 82 8 91 100 64 17 50 67 74 14 23 30 33 56 69 49 18 57 82 100 25 77 65 9 60 4 20 18 37 73 50 18 79 26 88 52 4 29 64 43 89 47 100 11 62 58 2 50 44 88 53 67 63 35 33 10 62 90 42 55 45 9 57 55 26 42 8 34 48 4 42 50 76 54 47 17 10 62 97 75 26 34 76 78 73 95 38 40 72 98 18 99 87 33 93 56 40 30 99 18 50 90 23 7 69 13 8 30 70 24 44 94 59 29 36 13 55 7 31 67 28 33 85 44 23 86 91 61 37 15 24 22 97 100 58 56 25 68 12 76 69 90 7 1 100 32 73 39 78 27 9 57 9 12 17 85 6 17 67 75 31 37 53 18 6 77 62 53 10 51 28 9 89 62 4 52 8 68 41 9 80 19 6 79 82 73 49 92 87 87 40 25 72 40 11 44 60 71 21 94 85 20 78 14 7 47 69 35 86 3 64 7 73 53 88 81 19 3 29 92 1 37 46 20 11 33 3 75 79 11 3 51 78 29 40 71 37 71 5 33 35 16 56 69 25 9 96 82 76 2 63 27 67 10 84 29 31 76 87 3 24 19 36 9 35 41 52 36 29 66 47 51 17 59 24 84 94 22 83 45 51 17 73 6 8 13 31 77 23 85 7 44 86 20 13 10 23 20 72 99 59 11 16 22 27 42 47 2 62 43 10 11 3 62 130\n142\n59 26 21 93 9 88 50 77 26 6 41 88 21 53 17 57 34 70 55 91 26 73 58 69 25 8 44 3 79 22 49 97 61 26 89 54 1 89 56 51 81 8 23 25 20 62 37 57 26 55 75 68 24 17 88 64 84 19 65 14 67 89 11 25 74 16 18 97 40 63 82 17 48 57 27 38 12 81 78 55 7 55 12 98 39 82 20 17 42 48 92 99 55 12 49 16 37 65 39 8 51 72 52 28 73 48 87 11 41 63 78 47 12 71 47 17 93 93 88 27 73 11 60 68 27 20 48 84 62 89 97 17 48 37 97 9 91 71 5 6 56 91\n250\n63 81 13 87 60 99 77 34 65 86 80 57 40 47 89 57 63 63 48 60 64 42 58 76 68 96 25 96 20 72 59 59 72 96 9 15 6 46 1 99 62 63 57 21 18 98 61 46 52 42 47 77 4 72 90 22 64 85 52 36 83 54 37 87 1 17 15 52 97 48 4 42 21 26 41 47 15 59 53 56 18 81 39 88 79 42 86 66 78 41 87 89 81 35 71 44 76 8 12 92 31 27 82 23 16 12 75 12 83 37 78 87 87 65 36 14 34 8 54 3 12 57 70 79 81 59 57 48 69 95 29 51 64 54 20 93 19 94 35 88 43 29 77 50 10 85 52 31 39 91 90 57 66 27 95 9 13 25 16 92 38 80 10 14 95 80 75 72 22 47 16 24 15 98 39 53 65 78 68 20 28 20 97 35 30 47 43 35 62 61 51 18 68 68 78 23 2 73 95 79 36 22 24 39 92 41 3 25 95 93 29 54 6 37 27 75 97 33 47 84 74 22 66 58 46 18 96 97 67 88 79 21 44 41 56 32 44 100 71 11 1 54 2 83 44 61 44 33 8 706\n354\n37 11 75 89 98 47 73 85 75 42 31 68 80 1 54 2 72 99 48 55 62 19 74 85 88 73 21 85 45 16 73 18 63 42 86 10 80 6 14 77 5 80 71 88 26 59 52 49 62 7 79 83 98 95 25 64 66 48 61 51 60 79 3 88 67 10 6 66 75 75 20 97 58 95 57 98 60 1 42 63 12 71 90 12 71 40 44 33 68 25 92 55 44 92 46 28 78 41 87 33 6 23 79 5 71 83 97 24 17 42 67 24 36 90 17 12 17 75 92 87 55 52 26 81 22 4 62 77 32 89 85 71 23 59 49 63 4 12 60 70 3 53 69 33 32 30 70 72 25 24 79 70 75 6 37 100 64 47 63 8 67 95 69 45 37 72 26 53 63 90 60 96 1 38 44 94 78 26 80 5 76 19 87 56 100 18 46 20 32 48 50 32 7 43 86 92 83 16 30 18 57 37 61 63 58 55 94 22 38 42 55 99 61 92 9 62 27 24 55 13 98 5 84 85 2 36 89 91 38 74 48 10 2 65 26 75 70 96 45 41 27 81 41 71 31 18 65 97 27 74 38 20 32 7 39 36 47 73 20 29 17 90 85 31 45 18 18 68 62 51 88 1 91 56 33 30 36 40 10 48 66 9 69 50 18 71 88 38 27 73 57 35 55 49 59 6 58 96 99 14 60 62 14 30 73 27 52 21 86 41 94 52 18 92 27 78 26 63 93 97 74 93 97 22 33 52 45 20 55 15 39 62 50 93 51 56 72 3 73 90 41 76 14 73 77 53 80 53 15 46 29 27 85 679\n548\n26 7 32 55 76 55 60 11 95 70 18 95 80 92 23 53 40 40 73 74 36 69 72 89 6 12 27 13 8 89 77 15 56 25 34 91 10 39 77 41 48 71 31 93 85 11 23 45 45 55 76 3 76 2 28 72 20 72 95 31 87 53 64 87 26 88 33 73 87 100 78 30 91 5 77 15 96 7 50 91 72 51 58 55 49 39 86 95 39 100 3 34 57 56 59 45 80 56 2 12 63 26 17 18 30 32 73 36 24 28 23 6 85 41 50 26 98 76 98 85 73 61 57 7 100 22 92 35 3 49 83 57 79 39 60 36 82 91 52 49 13 35 77 63 98 26 15 63 31 83 4 30 99 73 29 33 5 91 2 70 55 79 4 37 58 69 70 42 95 62 15 63 16 74 70 95 74 85 50 74 92 72 45 51 97 92 52 77 21 84 53 82 27 56 73 12 57 59 2 4 97 44 28 7 37 49 47 42 3 32 61 93 52 43 69 72 88 44 64 83 46 14 29 88 55 88 29 23 59 60 69 93 34 19 81 9 62 47 78 18 76 88 82 96 91 99 79 42 33 67 84 70 26 83 5 45 85 35 66 69 16 73 93 40 100 2 50 26 27 42 23 88 72 48 66 8 7 20 20 86 28 95 90 1 32 17 17 90 41 15 62 100 67 38 40 36 89 29 91 39 39 5 23 89 32 73 24 24 19 77 20 53 71 61 11 49 67 59 34 39 52 97 98 7 38 28 44 6 34 68 57 34 69 34 18 72 100 25 35 81 8 34 62 4 20 38 36 22 73 84 84 75 75 93 30 95 53 34 34 79 66 93 21 36 23 67 46 46 67 74 8 14 7 32 61 2 90 22 50 49 82 19 46 86 29 93 58 81 28 55 36 54 92 95 65 78 25 100 45 27 19 81 95 89 97 99 87 14 8 79 88 84 7 44 94 51 12 2 30 86 13 88 15 88 1 13 2 77 80 49 2 73 47 41 49 70 27 55 66 89 93 35 12 74 44 3 70 92 13 69 46 4 80 97 43 24 12 14 79 31 7 58 1 27 64 38 5 49 36 98 33 69 1 77 20 40 54 1 95 80 42 73 49 38 52 9 86 79 31 16 60 100 5 14 26 22 61 17 66 92 38 26 24 81 91 74 72 59 83 83 73 40 59 90 96 12 42 97 73 33 14 97 28 56 23 11 88 84 12 99 6 11 64 38 25 27 8 53 15 5 40 57 79 85 50 75 60 126\n25\n13 9 99 11 6 9 100 50 15 3 59 84 50 6 37 29 26 78 24 53 13 69 8 17 270\n149\n30 81 8 55 31 93 86 84 82 10 2 17 64 89 13 28 80 39 10 71 97 87 71 19 3 92 36 65 17 20 51 96 54 23 2 13 19 43 54 67 39 38 39 29 64 60 60 67 49 36 70 43 97 18 17 33 27 89 74 87 50 72 92 96 84 22 69 72 93 44 21 34 47 32 36 96 77 30 63 85 77 98 96 12 68 1 20 41 21 35 54 68 45 95 26 91 1 48 58 45 58 31 32 88 13 61 77 12 1 67 98 97 34 99 57 80 6 27 85 4 59 14 8 50 4 95 11 34 12 26 12 4 69 53 33 19 56 48 75 17 33 12 15 85 11 58 50 10 485\n427\n18 61 64 51 93 18 36 66 81 84 47 96 16 47 46 15 27 83 85 94 63 12 56 88 91 92 25 11 65 77 45 63 63 80 77 34 11 78 100 87 98 27 64 100 30 54 24 5 47 43 87 84 11 25 89 19 14 75 24 68 52 54 39 35 73 55 92 82 52 78 77 42 67 34 99 15 100 33 28 22 33 61 9 87 97 32 7 79 53 53 66 22 52 84 67 66 40 91 18 50 62 44 73 39 30 36 65 88 62 19 39 22 50 96 46 90 99 24 90 22 99 35 73 37 6 18 94 32 14 42 6 98 3 62 11 86 79 19 2 70 56 97 20 11 56 63 15 13 90 86 87 56 59 10 78 74 48 44 88 60 57 45 81 41 10 2 64 47 68 76 74 56 25 52 28 41 76 83 18 34 93 23 46 68 38 5 88 19 23 43 53 79 5 1 10 48 72 16 93 82 57 32 60 84 32 83 31 62 66 18 99 56 73 39 90 5 1 36 43 34 75 48 82 64 64 85 51 46 58 95 43 65 66 41 30 13 99 79 16 94 6 48 98 63 25 25 44 51 13 39 26 70 4 57 68 12 39 53 11 79 59 56 53 100 99 9 36 78 32 21 59 65 76 91 31 66 98 47 84 90 90 42 89 88 90 28 32 26 63 80 88 5 12 77 26 9 84 17 21 32 2 94 39 66 50 35 34 67 87 89 81 84 88 24 81 17 12 91 69 29 50 67 39 15 40 29 75 3 34 41 83 80 15 68 51 11 81 25 99 100 67 1 49 78 30 2 56 50 64 99 4 22 53 45 95 61 22 7 31 52 68 3 54 41 42 50 11 71 91 66 60 75 51 60 74 100 73 56 35 56 32 15 10 15 17 90 92 6 56 91 31 93 75 65 67 2 57 91 69 71 13 84 82 22 50 5 87 75 87 38 17 13 32 13 76 22 89 7 55 83 91 8 68 16 33 91 530\n99\n3 78 7 60 57 10 23 30 2 21 100 39 49 19 52 35 14 20 85 50 47 51 63 59 95 95 44 34 9 96 29 57 94 6 27 49 26 15 56 17 55 77 41 13 63 5 22 98 6 13 1 74 14 75 8 58 48 17 99 7 29 14 90 70 96 93 88 53 55 47 21 19 65 61 17 77 28 71 15 75 41 81 18 49 88 78 79 37 73 54 71 99 52 84 29 91 31 24 555\n",
"30\n441\n55 33 26 69 20 22 70 84 82 74 32 41 12 39 55 87 37 46 89 55 85 52 48 73 27 50 21 76 11 93 49 84 56 59 83 86 36 91 77 84 42 85 9 100 23 1 83 15 24 36 11 49 91 40 87 99 31 49 33 86 11 35 83 69 21 88 69 54 81 4 29 90 36 16 85 59 74 27 92 31 30 93 62 95 50 21 47 41 87 44 21 68 33 39 7 22 36 88 25 42 48 40 8 47 83 62 91 34 43 73 81 72 53 91 7 86 52 12 94 100 95 21 33 69 93 79 53 75 67 35 43 70 57 13 1 98 5 15 15 84 88 34 56 14 74 9 71 87 3 91 62 58 72 65 91 83 21 45 35 47 91 24 83 94 75 55 28 83 77 92 80 86 80 8 53 49 11 22 66 25 98 71 71 40 81 30 90 60 41 72 81 97 79 51 59 55 23 30 36 10 51 84 54 69 9 20 17 37 27 99 9 32 59 27 93 3 75 64 40 7 25 75 25 39 57 22 24 19 57 16 48 41 62 90 19 86 74 19 80 99 8 72 27 19 41 5 91 82 96 51 25 26 97 69 4 86 54 80 23 93 34 19 24 87 98 68 97 84 95 16 96 64 22 1 94 87 76 91 66 11 85 68 73 69 79 37 36 35 40 46 34 4 54 11 12 51 12 87 41 17 100 7 67 18 51 54 23 18 72 32 68 92 9 86 99 39 74 18 74 18 17 47 80 66 41 59 84 92 78 1 92 68 32 99 7 90 30 61 20 46 53 54 96 39 27 46 77 17 84 35 24 66 41 50 38 45 99 58 87 20 21 20 74 33 45 67 71 42 44 67 56 25 33 74 65 69 46 36 95 66 96 12 27 12 56 91 60 10 70 79 97 90 66 52 79 60 89 53 31 43 9 11 19 82 30 37 15 14 93 59 93 49 63 60 86 2 15 2 87 63 79 24 97 26 24 47 8 10 63 51 64 23 35 48 5 53 52 20 86 97 295\n586\n68 58 39 57 44 64 45 50 10 55 93 37 37 92 89 74 36 22 50 17 15 21 2 88 21 44 18 20 1 67 98 17 50 30 61 20 9 48 64 90 31 100 83 36 16 83 63 2 28 49 71 61 36 95 63 21 86 96 4 32 80 57 9 80 61 41 95 68 42 28 44 100 85 20 23 63 100 71 58 32 92 37 86 17 28 13 80 59 2 11 73 33 17 74 43 14 100 1 47 58 27 91 80 33 67 96 53 82 14 65 88 4 66 5 10 90 81 66 68 73 71 72 30 82 61 45 100 32 82 99 7 2 25 35 7 63 91 72 4 50 56 19 7 49 35 41 29 74 56 61 80 52 78 96 21 8 44 65 100 87 100 49 79 19 30 80 97 9 84 85 2 29 0 57 34 88 45 79 16 38 15 99 39 58 93 64 65 58 89 28 35 78 66 71 18 8 42 62 57 20 79 22 35 32 89 66 96 97 81 41 99 97 5 73 54 88 79 65 30 5 88 82 11 70 4 38 36 56 78 75 80 73 46 7 70 20 32 3 4 83 34 78 34 12 75 38 9 63 81 34 53 65 28 59 19 93 78 66 61 22 29 10 54 13 94 43 84 58 79 83 65 53 31 28 20 100 79 74 20 35 46 72 71 74 36 73 46 77 76 91 43 88 24 61 64 65 9 10 81 29 72 73 65 72 47 11 77 40 40 14 65 43 66 15 55 25 19 76 56 27 49 64 99 71 8 18 96 82 32 35 66 33 57 22 46 98 67 70 67 14 97 9 48 19 23 22 24 6 3 13 10 19 73 27 51 8 58 84 20 13 90 46 90 26 25 51 98 38 4 3 91 63 10 64 40 36 24 82 47 12 88 27 87 60 21 38 41 4 45 82 13 20 66 81 39 15 37 80 58 62 40 82 86 51 10 88 4 61 61 3 5 3 58 80 74 23 72 38 58 66 60 33 6 87 31 48 84 72 2 78 71 32 14 6 63 40 3 61 80 82 43 56 50 12 77 78 29 78 35 58 43 9 84 8 58 53 94 59 69 96 36 5 58 99 97 21 21 69 59 63 37 40 84 12 61 19 52 19 59 68 45 16 26 45 38 86 41 59 55 19 66 54 16 34 19 52 12 88 99 19 50 34 44 76 10 74 62 74 95 19 41 17 52 61 71 82 83 24 29 94 50 50 38 58 50 43 22 42 11 17 94 56 24 81 2 94 89 48 63 89 2 13 78 98 6 20 26 41 65 54 7 18 26 83 13 28 49 99 76 80 85 47 78 20 61 31 100 86 70 43 7 35 24 17 23 34 62 25 67 79 7 58 32 88 61 266\n487\n95 64 69 7 95 52 90 8 94 36 72 23 99 74 11 84 41 22 31 22 39 99 63 19 53 66 75 3 12 29 19 53 90 13 9 79 7 9 17 43 76 72 66 29 63 15 40 18 32 93 97 25 85 70 94 48 2 11 61 65 19 81 35 63 25 100 5 33 32 82 45 20 55 100 9 2 38 50 81 5 49 79 65 23 97 28 23 35 78 51 98 85 100 22 33 93 56 81 23 59 55 30 27 50 10 55 73 25 53 21 98 40 19 40 57 83 40 73 29 96 38 66 40 84 55 57 19 17 17 68 33 24 38 10 95 86 19 16 92 5 14 71 57 92 19 40 49 5 79 81 53 98 40 74 61 25 41 87 83 19 100 12 65 81 78 53 6 39 18 3 32 96 82 85 97 79 56 36 68 28 19 60 13 60 62 91 22 42 93 46 29 36 14 38 80 35 89 16 20 39 70 29 45 49 86 31 17 5 73 43 78 51 17 40 20 47 7 6 67 87 48 17 98 62 79 12 24 23 16 52 72 18 87 64 28 18 88 22 58 50 90 10 44 89 12 65 20 86 44 7 95 18 63 72 59 7 33 89 65 86 97 9 100 85 34 82 24 51 31 68 45 71 75 44 67 30 54 27 11 77 28 47 12 8 11 32 25 86 8 56 43 39 30 41 100 55 70 39 22 70 89 53 57 14 94 17 87 17 58 22 25 93 94 99 6 15 94 73 51 98 82 2 35 53 29 23 63 38 36 46 64 12 93 40 20 56 15 66 86 79 8 22 2 1 77 5 13 15 14 81 30 66 33 99 75 38 26 98 39 26 9 51 18 37 72 35 53 25 52 94 2 54 27 83 37 82 47 21 43 82 73 7 21 57 81 61 64 82 58 26 45 50 42 1 90 54 92 25 49 33 63 94 47 66 59 40 23 12 62 90 7 61 53 5 28 72 35 32 32 95 95 98 66 21 72 26 33 82 30 34 17 91 96 98 3 74 72 98 11 53 56 17 91 35 61 26 48 69 84 50 72 3 37 23 7 28 98 30 34 60 11 57 77 3 1 31 71 52 68 11 89 51 45 58 65 66 62 79 95 44 90 100 63 32 66 84 492\n169\n3 16 59 35 74 70 83 60 98 100 20 85 74 10 34 2 55 53 90 69 68 16 21 90 14 84 22 65 68 98 5 98 14 49 52 28 35 74 68 57 52 39 44 21 97 64 16 30 45 75 9 1 91 69 56 29 70 71 38 32 65 23 97 93 7 93 8 81 65 72 22 9 95 84 93 62 37 28 31 69 13 14 32 46 28 45 36 26 49 46 1 46 91 81 35 51 87 91 7 20 80 41 1 87 52 13 51 23 84 38 33 9 2 8 31 22 1 13 34 89 62 17 91 1 83 75 35 47 54 94 48 23 6 2 10 56 63 74 20 39 69 48 28 60 42 56 71 2 30 14 76 68 96 93 27 70 77 92 22 7 93 36 15 12 99 44 47 6 8\n133\n36 43 19 53 15 15 21 60 79 29 31 39 8 47 25 92 70 86 2 58 85 42 90 17 11 58 53 24 76 37 72 43 20 7 40 30 28 54 7 27 74 39 62 96 7 37 50 55 68 69 35 64 70 91 91 30 15 14 91 42 67 63 48 10 47 99 95 54 100 3 25 72 23 23 38 55 68 30 34 54 89 100 21 97 69 37 67 96 70 45 24 27 84 88 53 81 69 8 49 51 84 92 54 29 36 71 100 37 51 93 47 53 19 54 76 92 92 13 39 62 10 30 65 4 79 62 65 99 2 60 76 45 387\n720\n71 83 69 47 36 92 68 59 90 23 54 16 80 20 50 40 46 97 51 46 7 5 40 70 87 6 52 12 97 100 29 100 88 65 46 44 31 23 35 9 90 84 59 32 78 100 40 65 53 10 12 54 64 2 58 77 31 39 72 11 39 56 10 91 67 39 8 20 57 37 45 6 33 56 29 29 19 63 54 93 90 42 39 66 61 57 23 66 97 5 32 50 61 32 36 34 62 65 57 34 16 84 38 98 2 89 6 96 49 35 29 83 18 51 88 77 9 93 8 18 77 34 78 32 77 5 74 6 4 41 55 35 32 68 57 36 50 58 57 3 58 54 81 51 39 10 14 7 63 100 49 95 67 97 30 42 93 3 75 85 40 89 82 45 19 25 27 44 45 52 42 8 34 6 50 90 69 11 54 51 53 92 20 58 36 18 16 9 87 83 100 72 64 62 13 25 49 26 67 17 26 50 27 98 89 30 1 40 91 31 93 82 85 17 50 56 84 50 14 56 59 4 10 84 39 93 19 10 29 78 79 69 57 56 29 32 91 81 56 19 73 17 43 99 41 81 9 100 79 47 14 79 4 13 65 63 62 40 22 39 92 58 85 23 35 90 33 37 18 25 38 55 10 87 22 51 82 78 42 58 35 86 13 99 88 30 45 18 22 34 96 95 38 88 100 52 32 40 21 2 61 50 100 26 56 61 61 18 10 66 41 97 16 45 39 57 87 74 71 92 44 23 45 24 26 67 24 20 97 91 43 7 48 20 69 55 5 47 84 14 63 55 38 1 60 57 81 35 47 12 16 67 25 12 24 94 98 48 80 6 39 34 63 57 82 77 20 68 31 25 81 85 39 94 2 58 88 48 98 51 8 68 64 57 4 12 57 46 22 35 88 85 48 59 95 82 73 12 85 9 74 3 71 78 77 61 3 83 12 33 34 11 81 89 1 17 43 64 64 29 54 66 36 16 85 83 93 39 68 71 52 77 27 51 10 28 44 40 24 67 43 32 29 60 9 83 23 24 67 34 1 2 56 43 47 84 13 70 34 91 97 19 95 86 77 12 23 18 73 36 75 52 52 16 63 94 93 86 28 77 96 77 65 98 58 78 18 66 3 35 75 64 36 94 88 93 66 39 81 17 84 20 10 85 87 3 85 38 75 78 96 27 77 43 33 98 94 98 34 70 16 4 82 61 49 73 52 15 56 32 58 20 48 49 90 81 5 77 57 6 49 68 65 21 71 96 12 21 51 83 78 9 8 23 51 54 99 19 73 12 53 36 34 72 45 81 35 76 56 99 74 66 68 63 50 13 56 64 65 45 89 28 43 25 56 29 52 23 37 60 40 57 27 59 16 21 18 2 37 11 24 51 10 24 58 50 67 53 76 61 17 72 88 7 32 19 15 23 24 97 41 88 49 89 94 51 84 99 7 17 76 57 28 26 32 79 76 52 46 11 66 97 81 17 100 19 40 10 74 9 32 23 66 56 6 28 52 66 50 32 90 4 51 14 44 49 27 12 53 95 94 48 46 31 21 94 86 3 88 98 9 93 84 51 37 83 34 42 92 62 28 99 39 28 85 28 97 15 28 98 60 45 72 13 81 72 89 86 21 57 51 40 23 56 78 9 20 4 95 896\n285\n16 46 3 19 53 22 6 6 59 82 1 61 6 72 97 32 55 94 47 45 72 54 17 25 30 98 31 37 4 77 34 84 96 36 78 89 14 37 88 70 58 86 54 90 43 66 18 48 94 78 25 78 3 40 40 60 59 13 57 4 94 36 58 70 50 70 33 46 81 77 73 34 44 40 91 3 74 91 53 12 54 96 37 25 30 3 50 6 81 69 33 89 94 59 39 40 5 37 45 29 53 87 15 40 52 27 57 17 64 52 63 29 43 26 20 23 54 12 50 75 88 12 1 99 52 62 9 12 78 86 59 42 66 93 40 25 68 61 40 4 38 56 80 97 36 69 92 70 92 80 56 81 30 77 24 49 22 73 25 61 1 100 71 19 23 58 61 8 28 98 39 21 21 33 26 71 66 11 9 22 61 39 20 86 91 80 94 80 22 6 66 29 54 28 44 8 5 18 84 40 16 91 85 40 64 6 18 57 9 8 1 83 80 54 97 78 17 98 6 99 35 61 76 70 58 13 18 86 63 32 91 80 19 78 43 27 97 82 80 3 42 91 36 56 97 92 96 85 52 14 70 5 51 95 46 30 47 33 24 95 68 28 58 93 15 77 53 46 3 38 72 66 15 17 91 45 65 14 87 92 76 44 72 48 578\n495\n53 26 90 65 33 25 2 57 17 6 51 48 47 16 24 96 26 77 61 17 84 76 50 11 89 52 71 64 71 69 51 65 94 93 15 99 100 42 20 13 9 31 67 25 1 14 74 93 53 17 62 8 36 81 67 2 21 3 23 90 17 78 24 42 92 98 12 46 15 49 9 82 18 83 73 18 22 6 27 65 75 47 40 33 29 74 94 72 50 3 81 78 66 35 62 85 91 50 78 94 30 1 16 25 77 54 44 100 92 7 40 76 43 51 85 1 94 86 72 63 5 72 100 76 29 31 99 55 69 73 96 64 72 59 100 82 19 40 27 26 3 13 97 14 92 30 47 47 62 12 49 91 28 92 27 61 60 85 78 99 69 43 22 28 39 98 33 85 52 98 65 3 41 64 76 100 77 64 56 36 12 80 21 86 90 76 69 69 84 67 48 52 33 68 91 91 84 52 87 61 23 53 23 77 60 68 26 8 44 30 53 72 54 87 32 50 71 96 46 30 65 12 61 97 28 29 13 38 29 52 33 58 55 68 19 71 70 97 11 79 14 60 91 39 41 74 7 68 76 80 91 69 65 21 89 98 62 63 35 27 2 26 61 47 17 34 34 43 56 8 29 26 80 92 81 33 14 91 96 89 98 30 61 71 7 20 67 86 69 66 90 73 12 48 6 67 64 44 81 73 11 30 8 58 32 5 33 53 8 95 34 57 37 19 33 67 68 23 43 95 51 79 77 48 60 38 100 93 49 73 4 54 31 19 95 6 3 10 62 19 48 57 58 4 31 72 37 54 77 24 64 49 93 16 18 44 29 64 39 96 10 61 89 19 5 92 33 59 80 63 79 43 49 27 85 37 57 71 20 88 35 81 32 76 22 41 66 37 100 30 32 78 24 54 41 42 97 11 5 72 85 97 79 7 46 10 49 16 28 47 54 73 38 54 28 31 50 81 24 69 45 56 30 95 7 25 81 64 85 49 68 85 2 79 16 13 82 40 89 59 28 24 21 67 43 14 66 3 32 59 98 81 73 56 95 31 18 96 71 61 73 8 64 42 97 68 64 15 97 56 56 23 10 44 79 80 57 67 5 42 7 6 41 91 61 18 36 62 91 50 40 47 61 16 590\n602\n2 4 17 49 46 22 70 79 94 25 65 45 93 94 78 56 22 92 57 41 96 55 69 41 7 32 18 83 39 74 71 86 53 87 55 73 34 75 44 94 78 42 98 48 5 15 96 8 67 43 93 34 92 11 49 90 30 68 93 81 32 57 70 30 82 60 86 86 58 95 26 20 51 86 70 57 98 3 19 65 46 31 72 20 69 27 2 41 82 70 67 7 56 64 46 91 29 94 16 2 26 76 63 11 13 94 15 84 96 23 47 90 75 34 24 99 95 73 28 34 3 66 81 65 38 97 42 22 94 83 51 31 64 91 53 35 90 10 92 57 1 46 63 9 20 13 32 90 46 56 38 50 66 9 24 30 15 59 44 84 28 62 95 55 19 13 78 55 94 31 49 78 29 44 45 81 83 40 86 11 41 97 59 2 74 77 68 92 86 72 40 95 89 66 50 31 58 68 96 57 80 37 13 86 77 78 9 86 97 1 84 8 57 40 40 97 6 71 80 80 11 50 55 42 42 48 70 100 37 20 29 11 54 84 26 9 63 79 99 33 13 66 33 90 40 78 69 23 19 42 59 34 85 38 98 39 3 51 42 100 3 8 2 28 46 98 48 51 94 10 54 57 33 17 42 62 24 54 83 95 27 41 64 63 94 39 38 56 75 80 54 86 65 47 97 21 89 11 44 90 74 91 11 59 56 65 54 10 76 5 69 66 23 65 13 56 8 79 33 46 99 25 72 6 50 49 22 65 9 37 39 56 40 64 49 12 84 94 43 71 38 49 12 20 54 44 99 71 4 72 34 15 6 30 96 9 41 61 86 58 30 32 30 34 98 12 45 50 47 44 5 13 9 94 3 59 26 65 26 23 31 38 76 29 99 70 81 44 9 41 36 58 55 12 84 46 37 49 37 21 6 91 23 4 47 84 87 63 87 91 80 68 73 90 69 68 60 63 72 5 2 39 27 92 86 99 97 98 22 40 6 65 22 31 99 27 11 10 73 82 92 58 65 70 30 68 96 34 92 84 34 53 52 91 1 54 66 93 64 40 50 79 48 3 26 72 63 94 70 63 39 67 40 32 92 72 1 79 24 59 41 17 41 33 16 77 75 9 82 13 18 55 53 68 71 40 18 27 99 66 1 22 100 70 86 24 41 64 53 89 65 85 6 8 49 89 59 31 39 72 47 77 26 31 19 85 85 38 94 34 74 65 35 75 27 90 76 94 49 97 48 26 36 62 30 76 34 36 3 60 13 52 52 31 40 7 96 53 96 35 98 38 72 74 71 78 15 84 77 4 92 60 59 41 28 95 44 17 99 39 73 70 74 42 36 17 72 87 1 37 66 59 87 42 73 87 60 28 40 30 72 205\n571\n93 41 40 61 62 16 16 100 51 62 4 33 32 88 54 18 93 17 97 98 1 86 63 72 57 24 12 44 76 21 34 51 39 29 83 93 38 17 66 66 81 34 4 96 33 60 88 60 63 27 40 99 16 92 30 79 49 16 32 21 89 31 8 46 49 18 8 73 5 51 20 96 100 63 66 62 44 12 6 64 41 56 97 64 95 77 16 95 40 40 43 49 92 15 58 98 63 34 12 15 65 39 77 3 80 54 10 61 9 25 4 84 73 34 16 92 97 12 45 69 11 75 87 22 57 45 70 50 44 36 93 26 58 57 26 67 66 21 39 54 9 65 15 14 97 75 50 18 73 63 79 46 29 71 84 41 73 68 86 22 57 52 31 52 17 46 22 32 52 28 100 68 34 84 10 36 48 15 90 57 56 67 39 9 57 56 6 20 59 12 33 69 14 57 78 80 78 57 39 49 48 75 1 9 23 16 97 83 41 70 78 79 62 9 65 69 97 98 52 69 56 97 6 68 5 37 26 68 36 53 36 92 58 10 7 51 22 17 94 27 1 83 11 39 51 12 69 3 53 35 30 19 6 54 50 67 56 84 30 4 44 6 56 23 14 2 43 71 93 63 27 92 42 37 43 98 33 39 56 92 52 86 3 5 15 83 31 9 82 77 76 29 70 15 93 43 68 19 30 29 11 59 63 79 30 4 5 22 64 89 79 82 70 34 47 94 62 72 42 87 82 90 38 47 22 80 71 12 61 13 81 70 55 44 51 19 35 80 57 75 99 42 32 86 79 56 12 75 91 8 100 48 81 54 24 46 69 46 48 38 13 36 95 13 58 24 92 22 5 39 21 33 87 33 41 60 54 82 30 26 78 71 16 84 69 31 25 24 69 100 73 87 22 40 2 35 50 1 45 6 88 48 55 16 28 47 100 95 13 74 9 28 54 74 50 44 78 42 83 4 46 55 39 40 62 13 67 93 28 77 59 21 6 57 46 74 90 32 18 67 92 33 51 61 25 9 83 54 54 48 7 36 98 97 7 68 54 94 34 68 28 58 74 21 69 64 44 53 68 3 86 11 61 84 99 50 48 39 26 82 1 68 38 83 10 62 89 29 92 70 91 84 61 38 56 33 66 86 8 75 2 31 3 97 79 13 30 8 73 75 83 73 14 82 30 91 53 49 91 56 59 49 34 12 44 46 2 93 50 15 17 95 78 93 57 39 22 52 8 89 29 96 11 99 28 57 71 71 66 91 91 36 1 52 100 60 48 69 23 20 27 6 77 5 93 73 53 84 89 48 611\n408\n41 87 5 89 24 7 54 4 29 92 31 7 78 54 91 23 89 18 48 1 69 49 51 9 29 3 78 60 21 90 4 100 87 29 22 70 31 97 74 90 86 11 72 90 7 35 34 42 73 40 9 44 54 21 12 19 68 90 33 14 67 29 13 28 20 64 36 72 3 50 72 13 6 82 75 13 67 54 15 68 38 58 62 37 21 52 9 53 13 7 38 17 4 39 48 88 20 67 29 18 79 4 29 68 100 75 25 80 23 11 79 53 42 72 21 96 95 53 68 17 96 96 49 61 38 2 87 84 66 1 7 23 15 18 23 92 77 71 87 15 71 57 59 70 25 81 13 48 33 86 99 66 54 21 33 84 46 26 34 29 14 78 16 63 59 46 10 51 11 95 65 92 66 44 58 40 39 65 50 60 54 63 34 62 92 41 23 48 38 86 63 26 58 49 72 45 97 26 17 81 87 25 12 6 29 46 9 55 10 74 75 27 67 50 33 80 45 89 68 86 59 35 32 85 8 56 58 56 14 62 18 56 56 14 78 52 1 2 24 35 84 15 25 5 69 50 33 54 47 2 14 6 79 29 34 34 34 6 51 71 30 47 91 20 36 56 81 16 45 82 1 40 68 43 90 79 59 96 88 98 13 5 25 20 83 82 48 59 24 79 40 7 7 60 71 89 63 63 14 74 5 10 63 10 49 58 89 9 81 37 51 56 37 47 1 32 29 63 48 11 15 65 7 71 26 93 71 57 44 95 36 81 84 42 81 77 28 42 18 42 51 96 65 69 5 11 98 64 48 53 68 66 79 95 27 85 93 39 69 15 40 98 41 51 74 14 99 14 18 59 1 23 43 48 83 91 65 94 66 11 55 3 58 48 48 28 22 12 55 35 41 90 86 73 40 8 73 100 33 27 32 83 37 79 5 78 78 364\n587\n96 77 83 26 47 5 36 98 28 73 52 95 82 76 24 72 69 83 59 7 73 43 9 18 20 93 13 10 56 14 5 52 70 34 11 24 71 60 34 57 94 85 36 80 47 12 46 38 97 55 10 49 49 63 43 88 58 44 69 20 96 8 33 22 32 69 51 48 56 31 66 78 98 77 65 27 95 32 81 100 1 23 83 9 72 30 59 43 94 43 82 19 97 46 54 24 90 60 89 81 4 16 20 32 99 4 9 83 99 60 30 64 52 42 65 40 1 19 47 80 51 91 41 83 95 25 21 31 66 26 85 60 90 57 44 93 81 95 3 77 73 3 25 34 45 64 68 3 64 51 77 32 62 55 56 13 83 18 99 89 68 89 91 27 67 84 38 10 78 31 6 34 25 54 72 81 58 3 78 5 56 17 41 14 27 27 20 30 70 39 99 41 77 83 58 8 36 28 28 20 3 1 10 70 42 2 65 85 85 32 50 51 4 76 20 79 76 79 30 35 91 97 56 48 47 11 6 70 63 57 79 14 92 25 4 63 46 23 4 11 47 80 95 100 32 95 20 61 88 57 2 59 59 61 22 64 17 34 70 59 64 29 55 83 93 21 89 84 31 21 81 78 45 3 56 79 63 27 68 5 58 49 71 70 79 79 8 82 6 37 96 90 73 54 65 51 30 56 75 87 100 12 5 75 43 12 81 15 20 63 78 24 59 64 90 79 79 79 82 98 93 79 92 37 99 52 5 37 26 12 40 25 23 3 4 70 86 59 6 64 22 5 70 38 49 62 4 53 62 92 94 62 47 8 23 11 24 21 12 14 52 60 29 22 89 77 65 43 73 25 10 57 29 2 22 88 96 18 40 98 44 38 19 90 99 46 76 40 84 21 17 73 96 54 96 46 8 3 83 96 56 87 98 71 5 73 53 48 48 89 41 79 11 23 12 17 67 68 40 64 36 28 67 46 59 78 60 10 80 28 44 89 74 34 33 89 95 27 70 16 41 32 29 14 78 88 66 58 66 52 91 46 6 17 93 18 99 18 27 6 29 98 11 8 45 10 3 13 87 52 24 6 100 87 21 39 80 26 98 21 3 2 75 36 96 32 16 58 23 55 16 38 39 30 17 34 68 45 89 5 55 8 80 91 61 68 8 53 39 6 31 25 30 17 74 57 34 1 64 24 92 69 7 18 4 34 5 71 5 98 72 27 18 43 73 10 22 20 57 80 6 50 31 63 86 2 55 50 40 63 39 92 23 51 56 26 54 45 65 75 28 99 59 80 39 10 27 35 19 9 89 41 66 32 51 92 36 83 64 23 87 72 34 19 66 7 161\n15\n11 27 3 95 25 29 20 62 74 14 88 44 65 7 42\n320\n45 15 29 92 66 76 12 60 45 77 43 35 9 36 18 62 61 32 77 61 70 51 19 13 41 90 4 25 72 47 4 32 20 34 47 90 1 50 74 54 77 75 35 66 65 57 8 74 16 34 35 38 61 54 99 83 3 97 63 38 26 13 51 26 20 63 4 81 9 77 52 97 82 38 99 37 56 5 43 17 78 95 63 61 48 83 76 62 69 64 37 53 43 14 38 50 1 26 72 90 100 10 46 91 41 67 4 98 43 61 58 4 72 86 94 97 78 41 97 18 69 60 50 24 68 97 8 48 93 75 15 89 57 70 12 61 36 7 19 68 96 87 35 82 80 49 58 45 40 88 31 68 57 1 36 82 92 41 49 96 90 77 22 53 94 73 91 25 84 75 6 95 19 89 51 59 28 15 11 52 11 82 83 93 96 24 47 1 9 21 5 64 19 39 51 59 52 53 30 44 78 28 91 13 98 31 77 68 96 35 4 92 43 12 68 61 43 86 93 72 19 95 19 84 35 24 41 90 95 41 23 40 11 27 86 82 89 59 85 4 13 84 100 53 29 84 36 29 80 56 7 8 70 23 26 73 71 94 62 27 66 43 8 5 42 67 3 41 56 71 80 41 98 2 10 59 74 32 45 57 12 88 58 50 35 12 63 30 81 3 61 34 33 36 27 87 80 73 19 92 41 73 52 74 86 95 73 47 10 93 46 59 31 30 89 55 49 15 91 941\n511\n65 64 45 75 13 43 36 67 92 63 56 53 22 55 3 75 25 12 16 76 33 53 46 34 3 37 83 91 12 83 44 2 54 100 23 90 78 26 61 69 13 8 82 51 69 75 34 47 98 98 45 51 37 18 86 84 50 32 61 12 50 42 61 66 68 24 16 62 34 62 45 65 35 95 8 100 14 68 36 25 30 85 43 52 53 75 16 20 44 13 100 53 39 74 78 52 78 73 2 49 70 5 26 46 32 61 32 75 6 66 12 77 17 3 93 55 38 71 74 78 66 35 7 19 84 58 66 18 58 32 5 20 37 35 73 11 90 86 42 51 76 78 42 52 75 73 39 31 83 18 31 92 87 68 56 37 89 76 25 52 72 48 8 2 22 57 83 79 30 88 1 64 31 94 17 87 24 54 63 33 62 24 43 61 79 33 27 33 6 48 52 92 100 38 75 19 22 47 55 11 50 92 21 17 46 22 29 17 14 44 41 54 7 50 32 46 6 37 28 79 26 37 88 54 86 50 92 10 4 92 9 44 93 40 88 13 56 10 12 78 95 36 40 40 50 45 92 31 27 21 88 29 28 53 41 38 85 1 63 8 15 38 67 76 59 82 20 42 89 40 28 24 51 38 38 45 23 55 36 62 62 62 25 1 6 78 92 17 82 70 98 43 79 86 32 73 22 12 8 5 41 7 2 37 79 45 85 13 40 61 22 10 95 32 87 5 82 79 35 11 10 33 24 31 97 56 18 35 94 100 60 17 82 66 19 8 95 25 15 58 59 49 42 35 85 51 11 83 50 17 49 94 47 52 10 7 73 4 33 48 89 40 64 15 13 26 10 48 11 74 61 28 22 3 49 76 80 48 93 74 38 49 52 69 65 21 5 83 31 32 49 87 43 71 5 67 96 27 35 75 62 55 63 8 62 1 86 24 75 100 20 5 24 43 51 19 61 87 43 25 12 93 17 76 14 15 13 68 5 36 15 41 22 21 7 23 30 79 30 59 89 2 53 93 85 77 14 46 16 36 96 28 61 49 68 81 95 78 56 84 51 24 9 81 64 72 18 64 14 41 4 84 98 36 17 9 9 30 96 97 44 72 48 13 29 55 35 95 81 53 92 2 56 95 37 52 7 86 42 30 39 34 52 66 89 26 9 94 54 75 815\n467\n89 88 74 5 36 82 77 49 18 60 58 58 89 18 6 55 94 32 2 52 34 87 9 95 90 35 11 2 30 2 6 41 26 98 87 84 56 9 38 98 87 45 76 86 80 48 47 100 3 83 73 82 90 70 50 63 5 17 53 7 65 33 42 38 16 20 35 90 96 15 57 82 53 6 64 65 27 65 82 1 40 63 38 99 95 9 57 24 60 34 21 7 51 80 33 2 69 59 55 6 79 37 67 53 7 6 46 20 20 7 61 57 7 3 85 22 91 78 62 16 31 71 47 38 38 100 1 51 21 94 29 88 50 79 11 100 71 31 19 57 69 70 22 44 2 69 20 73 80 97 94 97 99 11 40 37 87 49 26 25 96 77 77 65 99 38 38 58 42 6 82 48 9 67 30 94 98 62 64 71 87 9 26 51 54 81 59 49 61 84 23 2 73 65 6 18 53 17 51 22 90 34 33 15 34 75 58 68 78 18 76 63 20 76 77 82 54 3 22 19 97 7 97 93 45 76 43 2 33 51 7 86 4 82 16 39 88 75 79 99 72 17 20 15 4 56 18 47 19 57 78 54 82 40 4 84 68 75 94 49 68 5 34 44 95 72 49 32 17 88 65 91 98 32 55 33 3 35 5 64 38 44 11 9 86 24 100 26 49 8 10 62 95 86 93 40 53 80 35 56 38 17 28 31 98 79 9 40 58 54 46 40 42 45 51 5 7 77 47 42 56 70 14 84 5 77 70 50 21 63 75 71 33 43 12 15 32 8 98 37 6 72 21 63 41 78 42 52 77 62 33 53 71 83 25 49 41 16 77 81 57 65 14 13 16 84 59 70 19 52 28 15 86 12 79 88 15 99 17 27 17 50 82 91 53 65 85 78 47 44 4 52 42 11 24 91 46 54 53 91 54 9 7 81 5 22 14 57 89 9 88 49 68 49 94 68 97 37 59 20 53 24 48 82 41 67 23 67 65 38 3 49 27 76 26 25 42 16 83 20 78 35 61 19 59 80 43 85 3 92 54 36 15 38 85 35 83 96 82 24 82 83 58 26 28 90 475\n707\n93 54 46 69 48 91 94 58 76 27 60 29 57 50 57 24 8 25 36 73 58 3 33 4 91 22 38 21 74 48 37 79 65 46 9 69 91 42 42 82 43 50 19 39 55 21 73 13 90 48 33 19 91 82 98 54 35 21 58 39 82 21 4 31 13 61 18 74 86 18 74 78 59 45 43 9 58 7 5 98 78 77 6 14 12 26 64 58 70 89 80 70 38 16 79 49 89 93 80 43 36 87 4 41 57 72 96 87 48 91 8 79 88 97 63 96 70 83 39 13 77 16 94 16 39 6 98 48 78 11 43 25 58 77 46 20 28 55 89 83 94 49 60 94 91 29 61 81 89 71 63 56 32 47 58 81 16 36 75 38 87 83 22 68 21 28 11 54 6 95 60 2 36 81 85 85 53 32 16 9 76 21 26 98 91 51 96 2 59 98 67 53 6 19 80 18 51 1 15 50 73 56 48 63 77 6 54 7 89 48 19 89 45 95 67 28 35 76 80 21 32 42 76 58 8 3 54 96 27 13 51 60 10 50 1 6 95 16 75 72 8 75 92 69 22 99 56 2 14 91 42 50 19 80 40 80 73 84 13 23 78 40 29 47 43 77 11 26 1 31 55 46 56 50 54 69 78 86 46 90 76 25 19 29 73 70 87 14 6 29 10 48 21 36 65 52 44 59 88 43 40 61 93 32 65 15 82 76 38 79 49 59 35 44 8 68 91 41 69 5 66 16 35 68 100 71 21 14 39 69 69 71 57 76 72 87 91 55 61 76 3 50 91 39 62 67 57 43 11 22 54 42 93 79 53 31 32 73 53 82 29 90 84 52 94 20 47 46 94 87 75 26 68 51 90 83 91 85 21 21 65 45 52 19 38 20 41 93 100 27 29 87 44 61 50 38 44 99 42 22 14 30 3 100 17 81 12 52 44 44 39 99 44 76 59 28 55 6 49 83 36 35 34 54 25 14 21 79 73 19 31 52 78 73 35 36 18 12 96 35 36 90 24 28 27 86 52 48 49 80 6 97 65 90 58 61 9 8 77 13 49 60 70 28 30 5 93 83 27 87 64 89 23 88 39 81 31 96 15 58 84 58 48 26 54 45 30 14 22 14 99 78 43 47 15 63 5 54 3 32 77 85 27 94 35 23 57 22 90 17 79 34 82 61 59 83 74 35 49 17 3 2 10 72 75 47 79 53 26 33 90 47 71 64 5 25 55 18 24 3 58 85 51 91 96 39 74 99 36 10 74 2 44 91 6 63 99 63 56 67 90 3 85 34 27 3 11 44 78 45 69 100 53 58 22 44 72 42 2 28 74 88 27 38 83 25 90 84 66 22 57 49 96 17 18 78 29 53 45 90 46 50 32 57 78 90 54 70 11 45 98 82 83 14 32 32 17 3 72 89 75 43 60 15 8 5 60 35 92 71 85 97 57 96 100 99 89 49 79 16 78 4 19 28 39 23 27 17 75 59 27 44 36 37 53 11 14 37 23 11 58 89 61 49 55 93 1 30 54 69 96 65 8 23 26 67 97 4 22 50 79 44 42 24 81 91 41 14 95 71 36 3 59 68 64 67 14 50 42 3 92 36 88 29 40 88 428\n592\n23 66 32 83 14 11 56 70 11 83 66 42 86 39 4 67 78 13 60 100 26 73 83 31 86 31 70 44 63 42 60 3 72 27 60 92 68 14 63 56 20 25 93 16 12 1 23 36 89 15 46 60 95 26 41 34 16 73 33 40 31 65 46 56 96 56 91 46 19 77 74 33 59 73 56 95 8 21 8 24 24 39 16 53 45 62 13 99 68 3 76 47 83 4 62 38 27 11 10 73 62 62 58 97 22 29 61 76 44 3 44 33 14 26 44 16 57 40 46 9 67 66 22 96 42 88 78 73 71 1 59 85 27 37 39 27 15 46 65 89 81 20 49 14 11 66 45 8 63 46 52 35 99 36 13 58 30 24 7 98 63 7 67 16 89 86 83 37 92 37 36 18 43 98 57 5 33 52 34 75 31 28 69 31 50 9 10 86 94 51 90 57 83 74 47 15 26 53 35 29 57 84 85 52 49 96 57 6 30 6 37 12 34 15 90 65 70 31 22 78 39 76 59 18 98 50 41 10 88 12 29 56 50 32 41 7 5 44 58 64 43 60 69 84 29 7 78 86 43 96 66 76 66 47 37 87 4 57 59 78 33 58 97 31 37 64 96 58 27 62 46 51 75 12 75 52 80 38 44 4 6 95 6 23 95 83 57 46 32 30 46 22 1 23 89 34 17 42 54 25 87 50 33 35 22 38 78 62 77 15 81 100 81 86 31 30 22 14 21 36 83 66 93 12 69 95 26 38 1 92 50 65 71 37 74 75 80 70 18 10 53 98 74 34 29 70 91 46 81 78 90 12 45 86 66 69 30 62 99 63 58 21 67 44 20 92 89 52 18 26 38 1 58 8 17 5 19 78 5 25 52 77 98 6 79 1 77 30 15 32 14 11 76 19 66 56 81 12 97 93 38 60 30 35 40 97 36 32 92 31 54 75 4 58 39 90 33 7 51 3 8 58 55 14 96 48 94 21 93 78 15 67 79 7 55 21 75 2 14 44 23 76 76 95 89 9 12 79 32 52 62 33 7 37 6 80 92 29 96 94 23 42 22 14 55 15 95 6 59 50 51 91 34 52 77 9 35 24 16 98 72 51 47 62 2 47 87 26 22 86 27 40 31 10 52 28 24 97 86 74 34 21 53 66 96 81 94 54 84 71 84 94 71 40 69 23 51 45 92 39 43 9 18 41 86 96 82 67 37 75 78 99 49 96 59 42 100 67 92 30 58 68 46 48 90 14 23 78 14 94 44 91 15 37 8 100 35 12 60 65 52 23 65 42 86 8 73 59 4 69 83 11 61 29 1 46 99 82 34 32 4 30 68 95 75 72 95 6 80 17 50 820\n473\n15 7 91 36 20 47 52 45 47 85 21 94 69 15 89 9 3 44 77 42 68 61 80 63 3 45 26 73 10 78 6 62 16 34 94 8 61 53 16 41 8 88 75 68 99 1 12 85 14 70 46 20 65 82 1 99 92 37 22 53 39 40 93 85 81 12 78 97 71 42 55 78 40 67 73 30 80 36 79 72 19 72 49 39 8 27 74 21 56 72 69 15 20 13 92 12 46 50 71 87 73 34 23 13 25 61 55 85 28 99 89 63 35 30 11 75 2 23 9 55 56 37 37 98 11 30 28 69 1 93 14 51 91 23 1 18 70 20 42 83 100 97 45 89 3 45 92 16 71 59 10 4 17 55 19 30 74 67 52 80 4 83 77 81 71 78 8 41 40 100 57 23 71 19 26 63 92 80 4 53 84 17 88 92 19 53 89 27 45 65 17 46 68 41 39 17 10 39 29 43 26 33 12 74 47 90 3 15 64 1 69 50 25 63 11 81 9 64 32 11 89 42 88 6 59 97 88 37 54 28 28 98 83 54 2 18 13 29 43 99 99 36 65 52 36 52 71 21 88 48 4 53 92 28 90 88 49 68 16 58 69 57 76 100 3 23 3 25 92 90 65 47 72 42 36 4 44 68 76 85 40 63 56 88 53 22 61 20 20 83 97 92 43 43 4 3 95 65 82 67 61 100 53 47 63 15 77 73 20 56 49 25 88 83 87 53 56 44 40 54 35 49 83 29 59 24 60 77 49 23 53 68 22 56 64 73 74 39 44 47 3 76 92 19 76 90 87 77 90 92 3 69 94 51 61 33 71 97 29 100 66 31 42 26 75 9 76 32 57 57 62 91 71 2 44 62 87 63 55 16 11 57 87 46 96 39 43 83 10 74 75 86 53 33 38 30 19 96 100 85 42 5 21 1 8 87 42 76 17 2 69 92 98 69 66 14 38 90 53 28 34 70 37 72 34 2 62 82 75 25 26 35 22 10 19 8 43 80 23 27 88 70 57 99 69 86 100 53 9 61 3 94 69 92 33 17 32 74 63 55 17 75 76 55 60 38 74 11 99 31 75 6 573\n783\n55 14 40 46 59 36 99 90 63 53 44 28 81 34 13 65 3 34 54 32 29 73 79 69 74 71 50 12 99 1 2 28 98 74 41 51 9 23 58 40 70 1 69 34 3 15 35 44 7 27 48 47 81 5 63 7 5 19 47 19 10 34 30 25 36 24 8 29 86 52 96 71 72 10 87 4 48 96 3 47 24 74 23 20 67 84 82 68 48 83 28 48 30 58 59 6 46 76 92 66 12 50 86 97 100 47 2 40 15 68 4 2 26 75 61 27 8 58 26 73 37 8 74 2 23 63 67 19 84 50 68 5 81 93 59 98 78 80 67 18 67 23 98 45 12 11 30 72 51 21 4 72 59 68 49 54 40 91 11 62 64 41 74 83 1 32 22 80 64 83 2 41 14 7 75 70 92 71 29 1 37 28 19 87 56 35 41 58 89 73 74 79 96 40 70 57 57 7 57 86 39 57 28 43 81 61 8 83 77 83 45 6 62 40 100 36 27 67 87 39 22 84 70 69 94 74 17 55 70 77 60 35 97 17 75 47 38 39 100 36 8 36 83 10 76 18 89 60 58 17 17 52 48 77 30 44 64 10 37 78 3 35 26 98 25 9 28 25 71 49 80 87 91 32 11 49 99 58 96 7 87 94 35 71 21 54 58 63 34 44 94 52 58 67 88 6 92 66 50 36 35 2 100 20 47 23 90 18 36 2 62 29 55 20 24 49 3 81 44 58 58 93 82 62 52 28 27 56 19 19 35 76 5 99 71 11 2 20 66 96 7 70 16 5 21 99 81 59 86 13 58 10 68 80 15 14 34 44 37 45 50 75 67 95 75 52 26 9 56 22 74 52 37 91 14 41 71 95 45 51 97 88 38 93 60 94 29 86 4 97 13 78 65 82 67 32 66 27 81 79 52 39 42 96 48 41 8 56 44 2 20 66 85 47 78 50 91 40 61 78 45 10 10 14 52 67 13 30 73 73 69 85 3 93 17 45 100 41 67 22 32 32 16 22 6 17 29 43 84 44 92 51 10 97 65 78 11 60 34 43 54 54 32 7 67 99 6 88 85 4 34 83 56 28 63 41 16 42 3 9 50 86 93 5 2 63 92 55 87 99 40 70 22 85 41 98 18 6 46 22 1 36 100 31 56 52 33 19 19 98 82 46 65 46 15 27 48 54 26 21 51 35 64 57 14 60 87 55 38 23 51 53 83 38 71 66 55 62 39 30 98 66 19 49 42 96 42 88 53 31 100 85 42 72 89 37 97 15 91 9 17 27 50 86 77 45 59 22 86 46 17 6 3 84 15 5 46 73 44 89 44 8 32 42 65 92 30 50 54 46 29 59 51 60 41 94 35 3 86 4 20 31 65 22 65 55 18 66 60 45 36 86 23 34 83 55 16 22 62 9 25 85 31 91 72 71 93 96 11 73 57 20 99 25 33 28 30 19 24 57 63 34 86 77 36 18 36 100 32 24 51 86 92 22 92 43 90 50 95 93 18 62 96 4 78 4 10 59 67 36 85 65 64 18 71 30 35 81 75 20 75 71 48 91 22 2 70 82 66 62 57 100 90 25 55 18 97 96 65 33 7 42 99 3 50 14 77 58 20 3 37 56 7 49 86 100 96 81 7 10 58 21 36 47 61 17 57 74 85 32 67 7 18 72 25 1 4 11 72 91 22 69 47 12 91 46 61 24 47 59 73 56 97 93 86 2 96 20 27 7 5 33 84 23 79 68 96 34 78 9 48 77 29 40 49 90 53 98 85 55 42 29 590\n159\n80 12 22 94 72 43 42 86 57 72 2 13 12 81 94 57 21 20 80 84 41 4 92 78 91 85 9 82 100 28 82 38 29 27 50 86 34 69 46 92 64 87 79 77 78 72 70 56 77 35 20 96 100 7 65 47 82 75 27 15 12 23 88 64 97 91 21 23 66 14 44 8 73 44 82 7 37 53 46 44 89 9 45 21 44 14 12 63 6 85 49 94 23 95 17 79 34 26 84 11 12 5 20 13 46 42 37 7 74 84 73 45 36 5 34 69 62 20 96 76 67 26 26 32 4 78 1 2 93 77 69 74 74 37 13 46 97 41 7 67 60 54 85 23 73 14 90 33 59 34 14 33 19 21 39 54 54 46 172\n643\n93 33 54 31 71 73 45 98 52 36 13 86 38 99 62 39 65 72 26 13 53 47 13 92 40 14 19 99 43 60 97 35 88 43 18 97 42 18 23 47 89 8 38 45 56 64 10 46 17 71 53 38 12 49 28 27 75 12 4 2 13 63 15 61 52 61 3 33 87 91 56 71 67 20 93 100 51 28 54 79 16 76 19 95 37 12 5 86 49 51 74 71 53 51 67 71 43 99 59 51 12 17 1 61 29 21 11 67 73 6 96 20 22 78 43 17 10 20 64 31 78 96 54 17 65 51 60 11 61 66 85 60 69 47 72 33 46 71 3 41 36 76 70 10 43 26 97 69 40 93 66 61 83 21 59 83 35 40 72 30 27 14 100 11 78 91 57 38 93 34 31 38 31 8 91 7 15 89 20 56 83 50 61 97 57 12 16 72 35 61 45 57 50 49 67 6 36 8 26 25 94 43 98 99 13 43 64 23 96 20 68 37 94 59 56 54 93 45 20 23 51 6 33 77 61 91 25 7 97 95 58 44 2 52 46 98 63 11 9 72 4 65 91 86 71 16 99 55 55 42 82 18 75 61 70 92 15 100 78 55 100 58 33 66 85 93 50 81 43 78 18 51 67 1 29 18 12 23 33 22 23 81 51 45 34 93 88 68 71 73 85 86 24 61 73 29 11 70 89 53 59 64 22 28 70 3 37 4 24 65 93 26 21 99 83 44 29 55 25 88 32 69 92 14 65 60 89 44 82 8 91 100 64 17 50 67 74 14 23 30 33 56 69 49 18 57 82 100 25 77 65 9 60 4 20 18 37 73 50 18 79 26 88 52 4 29 64 43 89 47 100 11 62 58 2 50 44 88 53 67 63 35 33 10 62 90 42 55 45 9 57 55 26 42 8 34 48 4 42 50 76 54 47 17 10 62 97 75 26 34 76 78 73 95 38 40 72 98 18 99 87 33 93 56 40 30 99 18 50 90 23 7 69 13 8 30 70 24 44 94 59 29 36 13 55 7 31 67 28 33 85 44 23 86 91 61 37 15 24 22 97 100 58 56 25 68 12 76 69 90 7 1 100 32 73 39 78 27 9 57 9 12 17 85 6 17 67 75 31 37 53 18 6 77 62 53 10 51 28 9 89 62 4 52 8 68 41 9 80 19 6 79 82 73 49 92 87 87 40 25 72 40 11 44 60 71 21 94 85 20 78 14 7 47 69 35 86 3 64 7 73 53 88 81 19 3 29 92 1 37 46 20 11 33 3 75 79 11 3 51 78 29 40 71 37 71 5 33 35 16 56 69 25 9 96 82 76 2 63 27 67 10 84 29 31 76 87 3 24 19 36 9 35 41 52 36 29 66 47 51 17 59 24 84 94 22 83 45 51 17 73 6 8 13 31 77 23 85 7 44 86 20 13 10 23 20 72 99 59 11 16 22 27 42 47 2 62 43 10 11 3 62 130\n142\n59 26 21 93 9 88 50 77 26 6 41 88 21 53 17 57 34 70 55 91 26 73 58 69 25 8 44 3 79 22 49 97 61 26 89 54 1 89 56 51 81 8 23 25 20 62 37 57 26 55 75 68 24 17 88 64 84 19 65 14 67 89 11 25 74 16 18 97 40 63 82 17 48 57 27 38 12 81 78 55 7 55 12 98 39 82 20 17 42 48 92 99 55 12 49 16 37 65 39 8 51 72 52 28 73 48 87 11 41 63 78 47 12 71 47 17 93 93 88 27 73 11 60 68 27 20 48 84 62 89 97 17 48 37 97 9 91 71 5 6 56 91\n250\n63 81 13 87 60 99 77 34 65 86 80 57 40 47 89 57 63 63 48 60 64 42 58 76 68 96 25 96 20 72 59 59 72 96 9 15 6 46 1 99 62 63 57 21 18 98 61 46 52 42 47 77 4 72 90 22 64 85 52 36 83 54 37 87 1 17 15 52 97 48 4 42 21 26 41 47 15 59 53 56 18 81 39 88 79 42 86 66 78 41 87 89 81 35 71 44 76 8 12 92 31 27 82 23 16 12 75 12 83 37 78 87 87 65 36 14 34 8 54 3 12 57 70 79 81 59 57 48 69 95 29 51 64 54 20 93 19 94 35 88 43 29 77 50 10 85 52 31 39 91 90 57 66 27 95 9 13 25 16 92 38 80 10 14 95 80 75 72 22 47 16 24 15 98 39 53 65 78 68 20 28 20 97 35 30 47 43 35 62 61 51 18 68 68 78 23 2 73 95 79 36 22 24 39 92 41 3 25 95 93 29 54 6 37 27 75 97 33 47 84 74 22 66 58 46 18 96 97 67 88 79 21 44 41 56 32 44 100 71 11 1 54 2 83 44 61 44 33 8 706\n354\n37 11 75 89 98 47 73 85 75 42 31 68 80 1 54 2 72 99 48 55 62 19 74 85 88 73 21 85 45 16 73 18 63 42 86 10 80 6 14 77 5 80 71 88 26 59 52 49 62 7 79 83 98 95 25 64 66 48 61 51 60 79 3 88 67 10 6 66 75 75 20 97 58 95 57 98 60 1 42 63 12 71 90 12 71 40 44 33 68 25 92 55 44 92 46 28 78 41 87 33 6 23 79 5 71 83 97 24 17 42 67 24 36 90 17 12 17 75 92 87 55 52 26 81 22 4 62 77 32 89 85 71 23 59 49 63 4 12 60 70 3 53 69 33 32 30 70 72 25 24 79 70 75 6 37 100 64 47 63 8 67 95 69 45 37 72 26 53 63 90 60 96 1 38 44 94 78 26 80 5 76 19 87 56 100 18 46 20 32 48 50 32 7 43 86 92 83 16 30 18 57 37 61 63 58 55 94 22 38 42 55 99 61 92 9 62 27 24 55 13 98 5 84 85 2 36 89 91 38 74 48 10 2 65 26 75 70 96 45 41 27 81 41 71 31 18 65 97 27 74 38 20 32 7 39 36 47 73 20 29 17 90 85 31 45 18 18 68 62 51 88 1 91 56 33 30 36 40 10 48 66 9 69 50 18 71 88 38 27 73 57 35 55 49 59 6 58 96 99 14 60 62 14 30 73 27 52 21 86 41 94 52 18 92 27 78 26 63 93 97 74 93 97 22 33 52 45 20 55 15 39 62 50 93 51 56 72 3 73 90 41 76 14 73 77 53 80 53 15 46 29 27 85 679\n548\n26 7 32 55 76 55 60 11 95 70 18 95 80 92 23 53 40 40 73 74 36 69 72 89 6 12 27 13 8 89 77 15 56 25 34 91 10 39 77 41 48 71 31 93 85 11 23 45 45 55 76 3 76 2 28 72 20 72 95 31 87 53 64 87 26 88 33 73 87 100 78 30 91 5 77 15 96 7 50 91 72 51 58 55 49 39 86 95 39 100 3 34 57 56 59 45 80 56 2 12 63 26 17 18 30 32 73 36 24 28 23 6 85 41 50 26 98 76 98 85 73 61 57 7 100 22 92 35 3 49 83 57 79 39 60 36 82 91 52 49 13 35 77 63 98 26 15 63 31 83 4 30 99 73 29 33 5 91 2 70 55 79 4 37 58 69 70 42 95 62 15 63 16 74 70 95 74 85 50 74 92 72 45 51 97 92 52 77 21 84 53 82 27 56 73 12 57 59 2 4 97 44 28 7 37 49 47 42 3 32 61 93 52 43 69 72 88 44 64 83 46 14 29 88 55 88 29 23 59 60 69 93 34 19 81 9 62 47 78 18 76 88 82 96 91 99 79 42 33 67 84 70 26 83 5 45 85 35 66 69 16 73 93 40 100 2 50 26 27 42 23 88 72 48 66 8 7 20 20 86 28 95 90 1 32 17 17 90 41 15 62 100 67 38 40 36 89 29 91 39 39 5 23 89 32 73 24 24 19 77 20 53 71 61 11 49 67 59 34 39 52 97 98 7 38 28 44 6 34 68 57 34 69 34 18 72 100 25 35 81 8 34 62 4 20 38 36 22 73 84 84 75 75 93 30 95 53 34 34 79 66 93 21 36 23 67 46 46 67 74 8 14 7 32 61 2 90 22 50 49 82 19 46 86 29 93 58 81 28 55 36 54 92 95 65 78 25 100 45 27 19 81 95 89 97 99 87 14 8 79 88 84 7 44 94 51 12 2 30 86 13 88 15 88 1 13 2 77 80 49 2 73 47 41 49 70 27 55 66 89 93 35 12 74 44 3 70 92 13 69 46 4 80 97 43 24 12 14 79 31 7 58 1 27 64 38 5 49 36 98 33 69 1 77 20 40 54 1 95 80 42 73 49 38 52 9 86 79 31 16 60 100 5 14 26 22 61 17 66 92 38 26 24 81 91 74 72 59 83 83 73 40 59 90 96 12 42 97 73 33 14 97 28 56 23 11 88 84 12 99 6 11 64 38 25 27 8 53 15 5 40 57 79 85 50 75 60 126\n25\n13 9 99 11 6 9 100 50 15 3 59 84 50 6 37 29 26 78 24 53 13 69 8 17 270\n149\n30 81 8 55 31 93 86 84 82 10 2 17 64 89 13 28 80 39 10 71 97 87 71 19 3 92 36 65 17 20 51 96 54 23 2 13 19 43 54 67 39 38 39 29 64 60 60 67 49 36 70 43 97 18 17 33 27 89 74 87 50 72 92 96 84 22 69 72 93 44 21 34 47 32 36 96 77 30 63 85 77 98 96 12 68 1 20 41 21 35 54 68 45 95 26 91 1 48 58 45 58 31 32 88 13 61 77 12 1 67 98 97 34 99 57 80 6 27 85 4 59 14 8 50 4 95 11 34 12 26 12 4 69 53 33 19 56 48 75 17 33 12 15 85 11 58 50 10 485\n427\n18 61 64 51 93 18 36 66 81 84 47 96 16 47 46 15 27 83 85 94 63 12 56 88 91 92 25 11 65 77 45 63 63 80 77 34 11 78 100 87 98 27 64 100 30 54 24 5 47 43 87 84 11 25 89 19 14 75 24 68 52 54 39 35 73 55 92 82 52 78 77 42 67 34 99 15 100 33 28 22 33 61 9 87 97 32 7 79 53 53 66 22 52 84 67 66 40 91 18 50 62 44 73 39 30 36 65 88 62 19 39 22 50 96 46 90 99 24 90 22 99 35 73 37 6 18 94 32 14 42 6 98 3 62 11 86 79 19 2 70 56 97 20 11 56 63 15 13 90 86 87 56 59 10 78 74 48 44 88 60 57 45 81 41 10 2 64 47 68 76 74 56 25 52 28 41 76 83 18 34 93 23 46 68 38 5 88 19 23 43 53 79 5 1 10 48 72 16 93 82 57 32 60 84 32 83 31 62 66 18 99 56 73 39 90 5 1 36 43 34 75 48 82 64 64 85 51 46 58 95 43 65 66 41 30 13 99 79 16 94 6 48 98 63 25 25 44 51 13 39 26 70 4 57 68 12 39 53 11 79 59 56 53 100 99 9 36 78 32 21 59 65 76 91 31 66 98 47 84 90 90 42 89 88 90 28 32 26 63 80 88 5 12 77 26 9 84 17 21 32 2 94 39 66 50 35 34 67 87 89 81 84 88 24 81 17 12 91 69 29 50 67 39 15 40 29 75 3 34 41 83 80 15 68 51 11 81 25 99 100 67 1 49 78 30 2 56 50 64 99 4 22 53 45 95 61 22 7 31 52 68 3 54 41 42 50 11 71 91 66 60 75 51 60 74 100 73 56 35 56 32 15 10 15 17 90 92 6 56 91 31 93 75 65 67 2 57 91 69 71 13 84 82 22 50 5 87 75 87 38 17 13 32 13 76 22 89 7 55 83 91 8 68 16 33 91 530\n99\n3 78 7 60 57 10 23 30 2 21 100 39 49 19 52 35 14 20 85 50 47 51 63 59 95 95 44 34 9 96 29 57 94 6 27 49 26 15 56 17 55 77 41 13 63 5 22 98 6 13 1 74 14 75 8 58 48 17 99 7 29 14 90 70 96 93 88 53 55 47 21 19 65 61 17 77 28 71 15 75 41 81 18 49 88 78 79 37 73 54 71 99 52 84 29 91 31 24 555\n",
"4\n0\n1 1\n4\n1 2 6 4\n4\n2 4 11 8\n3\n1 3 3\n\nSAMPLE\n",
"30\n441\n55 33 26 69 20 22 70 84 82 74 32 41 12 39 55 87 37 46 89 55 85 52 48 73 27 50 21 76 11 93 49 84 56 59 83 86 36 91 77 84 42 85 9 100 23 1 83 15 24 36 11 49 91 40 87 99 31 49 33 86 11 35 83 69 21 88 69 54 81 4 29 90 36 16 85 59 74 27 92 31 30 93 62 95 50 21 47 41 87 44 21 68 33 39 7 22 36 88 25 42 48 40 8 47 83 62 91 34 43 73 81 72 53 91 7 86 52 12 94 100 95 21 33 69 93 79 53 75 67 35 43 70 57 13 1 98 5 15 15 84 88 34 56 14 74 9 71 87 3 91 62 58 72 65 91 83 21 45 35 47 91 24 83 94 75 55 28 83 77 92 80 86 80 8 53 49 11 22 66 25 98 71 71 40 81 30 90 60 41 72 81 97 79 51 59 55 23 30 36 10 51 84 54 69 9 20 17 37 27 99 9 32 59 27 93 3 75 64 40 7 25 75 25 39 57 22 24 19 57 16 48 41 62 90 19 86 74 19 80 99 8 72 27 19 41 5 91 82 96 51 25 26 97 69 4 86 54 80 23 93 34 19 24 87 98 68 97 84 95 16 96 64 22 1 94 87 76 91 66 11 85 68 73 69 79 37 36 35 40 46 34 4 54 11 12 51 12 87 41 17 100 7 67 18 51 54 23 18 72 32 68 92 9 86 99 39 74 18 74 18 17 47 80 66 41 59 84 92 78 1 92 68 32 99 7 90 30 61 20 46 53 54 96 39 27 46 77 17 84 35 24 66 41 50 38 45 99 58 87 20 21 20 74 33 45 67 71 42 44 67 56 25 33 74 65 69 46 36 95 66 96 12 27 12 56 91 60 10 70 79 97 90 66 52 79 60 89 53 31 43 9 11 19 82 30 37 15 14 93 59 93 49 63 60 86 2 15 2 87 63 79 24 97 26 24 47 8 10 63 51 64 23 35 48 5 53 52 20 86 97 295\n586\n68 58 39 57 44 64 45 50 10 55 93 37 37 92 89 74 36 22 50 17 15 21 2 88 21 44 18 20 1 67 98 17 50 30 61 20 9 48 64 90 31 100 83 36 16 83 63 2 28 49 71 61 36 95 63 21 86 96 4 32 80 57 9 80 61 41 95 68 42 28 44 100 85 20 23 63 100 71 58 32 92 37 86 17 28 13 80 59 2 11 73 33 17 74 43 14 100 1 47 58 27 91 80 33 67 96 53 82 14 65 88 4 66 5 10 90 81 66 68 73 71 72 30 82 61 45 100 32 82 99 7 2 25 35 7 63 91 72 4 50 56 19 7 49 35 41 29 74 56 61 80 52 78 96 21 8 44 65 100 87 100 49 79 19 30 80 97 9 84 85 2 29 0 57 34 88 45 79 16 38 15 99 39 58 93 64 65 58 89 28 35 78 66 71 18 8 42 62 57 20 79 22 35 32 89 66 96 97 81 41 99 97 5 73 54 88 79 65 30 5 88 82 11 70 4 38 36 56 78 75 80 73 46 7 70 20 32 3 4 83 34 78 34 12 75 38 9 63 81 34 53 65 28 59 19 93 78 66 61 22 29 10 54 13 94 43 84 58 79 83 65 53 31 28 20 100 79 74 20 35 46 72 71 74 36 73 46 77 76 91 43 88 24 61 64 65 9 10 81 29 72 73 65 72 47 11 77 40 40 14 65 43 66 15 55 25 19 76 56 27 49 64 99 71 8 18 96 82 32 35 66 33 57 22 46 98 67 70 67 14 97 9 48 19 23 22 24 6 3 13 10 19 73 27 51 8 58 84 20 13 90 46 90 26 25 51 98 38 4 3 91 63 10 64 40 36 24 82 47 12 88 27 87 60 21 38 41 4 45 82 13 20 66 81 39 15 37 80 58 62 40 82 86 51 10 88 4 61 61 3 5 3 58 80 74 23 72 38 58 66 60 33 6 87 31 48 84 72 2 78 71 32 14 6 63 40 3 61 80 82 43 56 50 12 77 78 29 78 35 58 43 9 84 8 58 53 94 59 69 96 36 5 58 99 97 21 21 69 59 63 37 40 84 12 61 19 52 19 59 68 45 16 26 45 38 86 41 59 55 19 66 54 16 34 19 52 12 88 99 19 50 34 44 76 10 74 62 74 95 19 41 17 52 61 71 82 83 24 29 94 50 50 38 58 50 43 22 42 11 17 94 56 24 81 2 94 89 48 63 89 2 13 78 98 6 20 26 41 65 54 7 18 26 83 13 28 49 99 76 80 85 47 78 20 61 31 100 86 70 43 7 35 24 17 23 34 62 25 67 79 7 58 32 88 61 266\n487\n95 64 69 7 95 52 90 8 94 36 72 23 99 74 11 84 41 22 31 22 39 99 63 19 53 66 75 3 12 29 19 53 90 13 9 79 7 9 17 43 76 72 66 29 63 15 40 18 32 93 97 25 85 70 94 48 2 11 61 65 19 81 35 63 25 100 5 33 32 82 45 20 55 100 9 2 38 50 81 5 49 79 65 23 97 28 23 35 78 51 98 85 100 22 33 93 56 81 23 59 55 30 27 50 10 55 73 25 53 21 98 40 19 40 57 83 40 73 29 96 38 66 40 84 55 57 19 17 17 68 33 24 38 10 95 86 19 16 92 5 14 71 57 92 19 40 49 5 79 81 53 98 40 74 61 25 41 87 83 19 100 12 65 81 78 53 6 39 18 3 32 96 82 85 97 79 56 36 68 28 19 60 13 60 62 91 22 42 93 46 29 36 14 38 80 35 89 16 20 39 70 29 45 49 86 31 17 5 73 43 78 51 17 40 20 47 7 6 67 87 48 17 98 62 79 12 24 23 16 52 72 18 87 64 28 18 88 22 58 50 90 10 44 89 12 65 20 86 44 7 95 18 63 72 59 7 33 89 65 86 97 9 100 85 34 82 24 51 31 68 45 71 75 44 67 30 54 27 11 77 28 47 12 8 11 32 25 86 8 56 43 39 30 41 100 55 70 39 22 70 89 53 57 14 94 17 87 17 58 22 25 93 94 99 6 15 94 73 51 98 82 2 35 53 29 23 63 38 36 46 64 12 93 40 20 56 15 66 86 79 8 22 2 1 77 5 13 15 14 81 30 66 33 99 75 38 26 98 39 26 9 51 18 37 72 35 53 25 52 94 2 54 27 83 37 82 47 21 43 82 73 7 21 57 81 61 64 82 58 26 45 50 42 1 90 54 92 25 49 33 63 94 47 66 59 40 23 12 62 90 7 61 53 5 28 72 35 32 32 95 95 98 66 21 72 26 33 82 30 34 17 91 96 98 3 74 72 98 11 53 56 17 91 35 61 26 48 69 84 50 72 3 37 23 7 28 98 30 34 60 11 57 77 3 1 31 71 52 68 11 89 51 45 58 65 66 62 79 95 44 90 100 63 32 66 84 492\n169\n3 16 59 35 74 70 83 60 98 100 20 85 74 10 34 2 55 53 90 69 68 16 21 90 14 84 22 65 68 98 5 98 14 49 52 28 35 74 68 57 52 39 44 21 97 64 16 30 45 75 9 1 91 69 56 29 70 71 38 32 65 23 97 93 7 93 8 81 65 72 22 9 95 84 93 62 37 28 31 69 13 14 32 46 28 45 36 26 49 46 1 46 91 81 35 51 87 91 7 20 80 41 1 87 52 13 51 23 84 38 33 9 2 8 31 22 1 13 34 89 62 17 91 1 83 75 35 47 54 94 48 23 6 2 10 56 63 74 20 39 69 48 28 60 42 56 71 2 30 14 76 68 96 93 27 70 77 92 22 7 93 36 15 12 99 44 47 6 8\n133\n36 43 19 53 15 15 21 60 79 29 31 39 8 47 25 92 70 86 2 58 85 42 90 17 11 58 53 24 76 37 72 43 20 7 40 30 28 54 7 27 74 39 62 96 7 37 50 55 68 69 35 64 70 91 91 30 15 14 91 42 67 63 48 10 47 99 95 54 100 3 25 72 23 23 38 55 68 30 34 54 89 100 21 97 69 37 67 96 70 45 24 27 84 88 53 81 69 8 49 51 84 92 54 29 36 71 100 37 51 93 47 53 19 54 76 92 92 13 39 62 10 30 65 4 79 62 65 99 2 60 76 45 387\n720\n71 83 69 47 36 92 68 59 90 23 54 16 80 20 50 40 46 97 51 46 7 5 40 70 87 6 52 12 97 100 29 100 88 65 46 44 31 23 35 9 90 84 59 32 78 100 40 65 53 10 12 54 64 2 58 77 31 39 72 11 39 56 10 91 67 39 8 20 57 37 45 6 33 56 29 29 19 63 54 93 90 42 39 66 61 57 23 66 97 5 32 50 61 32 36 34 62 65 57 34 16 84 38 98 2 89 6 96 49 35 29 83 18 51 88 77 9 93 8 18 77 34 78 32 77 5 74 6 4 41 55 35 32 68 57 36 50 58 57 3 58 54 81 51 39 10 14 7 63 100 49 95 67 97 30 42 93 3 75 85 40 89 82 45 19 25 27 44 45 52 42 8 34 6 50 90 69 11 54 51 53 92 20 58 36 18 16 9 87 83 100 72 64 62 13 25 49 26 67 17 26 50 27 98 89 30 1 40 91 31 93 82 85 17 50 56 84 50 14 56 59 4 10 84 39 93 19 10 29 78 79 69 57 56 29 32 91 81 56 19 73 17 43 99 41 81 9 100 79 47 14 79 4 13 65 63 62 40 22 39 92 58 85 23 35 90 33 37 18 25 38 55 10 87 22 51 82 78 42 58 35 86 13 99 88 30 45 18 22 34 96 95 38 88 100 52 32 40 21 2 61 50 100 26 56 61 61 18 10 66 41 97 16 45 39 57 87 74 71 92 44 23 45 24 26 67 24 20 97 91 43 7 48 20 69 55 5 47 84 14 63 55 38 1 60 57 81 35 47 12 16 67 25 12 24 94 98 48 80 6 39 34 63 57 82 77 20 68 31 25 81 85 39 94 2 58 88 48 98 51 8 68 64 57 4 12 57 46 22 35 88 85 48 59 95 82 73 12 85 9 74 3 71 78 77 61 3 83 12 33 34 11 81 89 1 17 43 64 64 29 54 66 36 16 85 83 93 39 68 71 52 77 27 51 10 28 44 40 24 67 43 32 29 60 9 83 23 24 67 34 1 2 56 43 47 84 13 70 34 91 97 19 95 86 77 12 23 18 73 36 75 52 52 16 63 94 93 86 28 77 96 77 65 98 58 78 18 66 3 35 75 64 36 94 88 93 66 39 81 17 84 20 10 85 87 3 85 38 75 78 96 27 77 43 33 98 94 98 34 70 16 4 82 61 49 73 52 15 56 32 58 20 48 49 90 81 5 77 57 6 49 68 65 21 71 96 12 21 51 83 78 9 8 23 51 54 99 19 73 12 53 36 34 72 45 81 35 76 56 99 74 66 68 63 50 13 56 64 65 45 89 28 43 25 56 29 52 23 37 60 40 57 27 59 16 21 18 2 37 11 24 51 10 24 58 50 67 53 76 61 17 72 88 7 32 19 15 23 24 97 41 88 49 89 94 51 84 99 7 17 76 57 28 26 32 79 76 52 46 11 66 97 81 17 100 19 40 10 74 9 32 23 66 56 6 28 52 66 50 32 90 4 51 14 44 49 27 12 53 95 94 48 46 31 21 94 86 3 88 98 9 93 84 51 37 83 34 42 92 62 28 99 39 28 85 28 97 15 28 98 60 45 72 13 81 72 89 86 21 57 51 40 23 56 78 9 20 4 95 896\n285\n16 46 3 19 53 22 6 6 59 82 1 61 6 72 97 32 55 94 47 45 72 54 17 25 30 98 31 37 4 77 34 84 96 36 78 89 14 37 88 70 58 86 54 90 43 66 18 48 94 78 25 78 3 40 40 60 59 13 57 4 94 36 58 70 50 70 33 46 81 77 73 34 44 40 91 3 74 91 53 12 54 96 37 25 30 3 50 6 81 69 33 89 94 59 39 40 5 37 45 29 53 87 15 40 52 27 57 17 64 52 63 29 43 26 20 23 54 12 50 75 88 12 1 99 52 62 9 12 78 86 59 42 66 93 40 25 68 61 40 4 38 56 80 97 36 69 92 70 92 80 56 81 30 77 24 49 22 73 25 61 1 100 71 19 23 58 61 8 28 98 39 21 21 33 26 71 66 11 9 22 61 39 20 86 91 80 94 80 22 6 66 29 54 28 44 8 5 18 84 40 16 91 85 40 64 6 18 57 9 8 1 83 80 54 97 78 17 98 6 99 35 61 76 70 58 13 18 86 63 32 91 80 19 78 43 27 97 82 80 3 42 91 36 56 97 92 96 85 52 14 70 5 51 95 46 30 47 33 24 95 68 28 58 93 15 77 53 46 3 38 72 66 15 17 91 45 65 14 87 92 76 44 72 48 578\n495\n53 26 90 65 33 25 2 57 17 6 51 48 47 16 24 96 26 77 61 17 84 76 50 11 89 52 71 64 71 69 51 65 94 93 15 99 100 42 20 13 9 31 67 25 1 14 74 93 53 17 62 8 36 81 67 2 21 3 23 90 17 78 24 42 92 98 12 46 15 49 9 82 18 83 73 18 22 6 27 65 75 47 40 33 29 74 94 72 50 3 81 78 66 35 62 85 91 50 78 94 30 1 16 25 77 54 44 100 92 7 40 76 43 51 85 1 94 86 72 63 5 72 100 76 29 31 99 55 69 73 96 64 72 59 100 82 19 40 27 26 3 13 97 14 92 30 47 47 62 12 49 91 28 92 27 61 60 85 78 99 69 43 22 28 39 98 33 85 52 98 65 3 41 64 76 100 77 64 56 36 12 80 21 86 90 76 69 69 84 67 48 52 33 68 91 91 84 52 87 61 23 53 23 77 60 68 26 8 44 30 53 72 54 87 32 50 71 96 46 30 65 12 61 97 28 29 13 38 29 52 33 58 55 68 19 71 70 97 11 79 14 60 91 39 41 74 7 68 76 80 91 69 65 21 89 98 62 63 35 27 2 26 61 47 17 34 34 43 56 8 29 26 80 92 81 33 14 91 96 89 98 30 61 71 7 20 67 86 69 66 90 73 12 48 6 67 64 44 81 73 11 30 8 58 32 5 33 53 8 95 34 57 37 19 33 67 68 23 43 95 51 79 77 48 60 38 100 93 49 73 4 54 31 19 95 6 3 10 62 19 48 57 58 4 31 72 37 54 77 24 64 49 93 16 18 44 29 64 39 96 10 61 89 19 5 92 33 59 80 63 79 43 49 27 85 37 57 71 20 88 35 81 32 76 22 41 66 37 100 30 32 78 24 54 41 42 97 11 5 72 85 97 79 7 46 10 49 16 28 47 54 73 38 54 28 31 50 81 24 69 45 56 30 95 7 25 81 64 85 49 68 85 2 79 16 13 82 40 89 59 28 24 21 67 43 14 66 3 32 59 98 81 73 56 95 31 18 96 71 61 73 8 64 42 97 68 64 15 97 56 56 23 10 44 79 80 57 67 5 42 7 6 41 91 61 18 36 62 91 50 40 47 61 16 590\n602\n2 4 17 49 46 22 70 79 94 25 65 45 93 94 78 56 22 92 57 41 96 55 69 41 7 32 18 83 39 74 71 86 53 87 55 73 34 75 44 94 78 42 98 48 5 15 96 8 67 43 93 34 92 11 49 90 30 68 93 81 32 57 70 30 82 60 86 86 58 95 26 20 51 86 70 57 98 3 19 65 46 31 72 20 69 27 2 41 82 70 67 7 56 64 46 91 29 94 16 2 26 76 63 11 13 94 15 84 96 23 47 90 75 34 24 99 95 73 28 34 3 66 81 65 38 97 42 22 94 83 51 31 64 91 53 35 90 10 92 57 1 46 63 9 20 13 32 90 46 56 38 50 66 9 24 30 15 59 44 84 28 62 95 55 19 13 78 55 94 31 49 78 29 44 45 81 83 40 86 11 41 97 59 2 74 77 68 92 86 72 40 95 89 66 50 31 58 68 96 57 80 37 13 86 77 78 9 86 97 1 84 8 57 40 40 97 6 71 80 80 11 50 55 42 42 48 70 100 37 20 29 11 54 84 26 9 63 79 99 33 13 66 33 90 40 78 69 23 19 42 59 34 85 38 98 39 3 51 42 100 3 8 2 28 46 98 48 51 94 10 54 57 33 17 42 62 24 54 83 95 27 41 64 63 94 39 38 56 75 80 54 86 65 47 97 21 89 11 44 90 74 91 11 59 56 65 54 10 76 5 69 66 23 65 13 56 8 79 33 46 99 25 72 6 50 49 22 65 9 37 39 56 40 64 49 12 84 94 43 71 38 49 12 20 54 44 99 71 4 72 34 15 6 30 96 9 41 61 86 58 30 32 30 34 98 12 45 50 47 44 5 13 9 94 3 59 26 65 26 23 31 38 76 29 99 70 81 44 9 41 36 58 55 12 84 46 37 49 37 21 6 91 23 4 47 84 87 63 87 91 80 68 73 90 69 68 60 63 72 5 2 39 27 92 86 99 97 98 22 40 6 65 22 31 99 27 11 10 73 82 92 58 65 70 30 68 96 34 92 84 34 53 52 91 1 54 66 93 64 40 50 79 48 3 26 72 63 94 70 63 39 67 40 32 92 72 1 79 24 59 41 17 41 33 16 77 75 9 82 13 18 55 53 68 71 40 18 27 99 66 1 22 100 70 86 24 41 64 53 89 65 85 6 8 49 89 59 31 39 72 47 77 26 31 19 85 85 38 94 34 74 65 35 75 27 90 76 94 49 97 48 26 36 62 30 76 34 36 3 60 13 52 52 31 40 7 96 53 96 56 98 38 72 74 71 78 15 84 77 4 92 60 59 41 28 95 44 17 99 39 73 70 74 42 36 17 72 87 1 37 66 59 87 42 73 87 60 28 40 30 72 205\n571\n93 41 40 61 62 16 16 100 51 62 4 33 32 88 54 18 93 17 97 98 1 86 63 72 57 24 12 44 76 21 34 51 39 29 83 93 38 17 66 66 81 34 4 96 33 60 88 60 63 27 40 99 16 92 30 79 49 16 32 21 89 31 8 46 49 18 8 73 5 51 20 96 100 63 66 62 44 12 6 64 41 56 97 64 95 77 16 95 40 40 43 49 92 15 58 98 63 34 12 15 65 39 77 3 80 54 10 61 9 25 4 84 73 34 16 92 97 12 45 69 11 75 87 22 57 45 70 50 44 36 93 26 58 57 26 67 66 21 39 54 9 65 15 14 97 75 50 18 73 63 79 46 29 71 84 41 73 68 86 22 57 52 31 52 17 46 22 32 52 28 100 68 34 84 10 36 48 15 90 57 56 67 39 9 57 56 6 20 59 12 33 69 14 57 78 80 78 57 39 49 48 75 1 9 23 16 97 83 41 70 78 79 62 9 65 69 97 98 52 69 56 97 6 68 5 37 26 68 36 53 36 92 58 10 7 51 22 17 94 27 1 83 11 39 51 12 69 3 53 35 30 19 6 54 50 67 56 84 30 4 44 6 56 23 14 2 43 71 93 63 27 92 42 37 43 98 33 39 56 92 52 86 3 5 15 83 31 9 82 77 76 29 70 15 93 43 68 19 30 29 11 59 63 79 30 4 5 22 64 89 79 82 70 34 47 94 62 72 42 87 82 90 38 47 22 80 71 12 61 13 81 70 55 44 51 19 35 80 57 75 99 42 32 86 79 56 12 75 91 8 100 48 81 54 24 46 69 46 48 38 13 36 95 13 58 24 92 22 5 39 21 33 87 33 41 60 54 82 30 26 78 71 16 84 69 31 25 24 69 100 73 87 22 40 2 35 50 1 45 6 88 48 55 16 28 47 100 95 13 74 9 28 54 74 50 44 78 42 83 4 46 55 39 40 62 13 67 93 28 77 59 21 6 57 46 74 90 32 18 67 92 33 51 61 25 9 83 54 54 48 7 36 98 97 7 68 54 94 34 68 28 58 74 21 69 64 44 53 68 3 86 11 61 84 99 50 48 39 26 82 1 68 38 83 10 62 89 29 92 70 91 84 61 38 56 33 66 86 8 75 2 31 3 97 79 13 30 8 73 75 83 73 14 82 30 91 53 49 91 56 59 49 34 12 44 46 2 93 50 15 17 95 78 93 57 39 22 52 8 89 29 96 11 99 28 57 71 71 66 91 91 36 1 52 100 60 48 69 23 20 27 6 77 5 93 73 53 84 89 48 611\n408\n41 87 5 89 24 7 54 4 29 92 31 7 78 54 91 23 89 18 48 1 69 49 51 9 29 3 78 60 21 90 4 100 87 29 22 70 31 97 74 90 86 11 72 90 7 35 34 42 73 40 9 44 54 21 12 19 68 90 33 14 67 29 13 28 20 64 36 72 3 50 72 13 6 82 75 13 67 54 15 68 38 58 62 37 21 52 9 53 13 7 38 17 4 39 48 88 20 67 29 18 79 4 29 68 100 75 25 80 23 11 79 53 42 72 21 96 95 53 68 17 96 96 49 61 38 2 87 84 66 1 7 23 15 18 23 92 77 71 87 15 71 57 59 70 25 81 13 48 33 86 99 66 54 21 33 84 46 26 34 29 14 78 16 63 59 46 10 51 11 95 65 92 66 44 58 40 39 65 50 60 54 63 34 62 92 41 23 48 38 86 63 26 58 49 72 45 97 26 17 81 87 25 12 6 29 46 9 55 10 74 75 27 67 50 33 80 45 89 68 86 59 35 32 85 8 56 58 56 14 62 18 56 56 14 78 52 1 2 24 35 84 15 25 5 69 50 33 54 47 2 14 6 79 29 34 34 34 6 51 71 30 47 91 20 36 56 81 16 45 82 1 40 68 43 90 79 59 96 88 98 13 5 25 20 83 82 48 59 24 79 40 7 7 60 71 89 63 63 14 74 5 10 63 10 49 58 89 9 81 37 51 56 37 47 1 32 29 63 48 11 15 65 7 71 26 93 71 57 44 95 36 81 84 42 81 77 28 42 18 42 51 96 65 69 5 11 98 64 48 53 68 66 79 95 27 85 93 39 69 15 40 98 41 51 74 14 99 14 18 59 1 23 43 48 83 91 65 94 66 11 55 3 58 48 48 28 22 12 55 35 41 90 86 73 40 8 73 100 33 27 32 83 37 79 5 78 78 364\n587\n96 77 83 26 47 5 36 98 28 73 52 95 82 76 24 72 69 83 59 7 73 43 9 18 20 93 13 10 56 14 5 52 70 34 11 24 71 60 34 57 94 85 36 80 47 12 46 38 97 55 10 49 49 63 43 88 58 44 69 20 96 8 33 22 32 69 51 48 56 31 66 78 98 77 65 27 95 32 81 100 1 23 83 9 72 30 59 43 94 43 82 19 97 46 54 24 90 60 89 81 4 16 20 32 99 4 9 83 99 60 30 64 52 42 65 40 1 19 47 80 51 91 41 83 95 25 21 31 66 26 85 60 90 57 44 93 81 95 3 77 73 3 25 34 45 64 68 3 64 51 77 32 62 55 56 13 83 18 99 89 68 89 91 27 67 84 38 10 78 31 6 34 25 54 72 81 58 3 78 5 56 17 41 14 27 27 20 30 70 39 99 41 77 83 58 8 36 28 28 20 3 1 10 70 42 2 65 85 85 32 50 51 4 76 20 79 76 79 30 35 91 97 56 48 47 11 6 70 63 57 79 14 92 25 4 63 46 23 4 11 47 80 95 100 32 95 20 61 88 57 2 59 59 61 22 64 17 34 70 59 64 29 55 83 93 21 89 84 31 21 81 78 45 3 56 79 63 27 68 5 58 49 71 70 79 79 8 82 6 37 96 90 73 54 65 51 30 56 75 87 100 12 5 75 43 12 81 15 20 63 78 24 59 64 90 79 79 79 82 98 93 79 92 37 99 52 5 37 26 12 40 25 23 3 4 70 86 59 6 64 22 5 70 38 49 62 4 53 62 92 94 62 47 8 23 11 24 21 12 14 52 60 29 22 89 77 65 43 73 25 10 57 29 2 22 88 96 18 40 98 44 38 19 90 99 46 76 40 84 21 17 73 96 54 96 46 8 3 83 96 56 87 98 71 5 73 53 48 48 89 41 79 11 23 12 17 67 68 40 64 36 28 67 46 59 78 60 10 80 28 44 89 74 34 33 89 95 27 70 16 41 32 29 14 78 88 66 58 66 52 91 46 6 17 93 18 99 18 27 6 29 98 11 8 45 10 3 13 87 52 24 6 100 87 21 39 80 26 98 21 3 2 75 36 96 32 16 58 23 55 16 38 39 30 17 34 68 45 89 5 55 8 80 91 61 68 8 53 39 6 31 25 30 17 74 57 34 1 64 24 92 69 7 18 4 34 5 71 5 98 72 27 18 43 73 10 22 20 57 80 6 50 31 63 86 2 55 50 40 63 39 92 23 51 56 26 54 45 65 75 28 99 59 80 39 10 27 35 19 9 89 41 66 32 51 92 36 83 64 23 87 72 34 19 66 7 161\n15\n11 27 3 95 25 29 20 62 74 14 88 44 65 7 42\n320\n45 15 29 92 66 76 12 60 45 77 43 35 9 36 18 62 61 32 77 61 70 51 19 13 41 90 4 25 72 47 4 32 20 34 47 90 1 50 74 54 77 75 35 66 65 57 8 74 16 34 35 38 61 54 99 83 3 97 63 38 26 13 51 26 20 63 4 81 9 77 52 97 82 38 99 37 56 5 43 17 78 95 63 61 48 83 76 62 69 64 37 53 43 14 38 50 1 26 72 90 100 10 46 91 41 67 4 98 43 61 58 4 72 86 94 97 78 41 97 18 69 60 50 24 68 97 8 48 93 75 15 89 57 70 12 61 36 7 19 68 96 87 35 82 80 49 58 45 40 88 31 68 57 1 36 82 92 41 49 96 90 77 22 53 94 73 91 25 84 75 6 95 19 89 51 59 28 15 11 52 11 82 83 93 96 24 47 1 9 21 5 64 19 39 51 59 52 53 30 44 78 28 91 13 98 31 77 68 96 35 4 92 43 12 68 61 43 86 93 72 19 95 19 84 35 24 41 90 95 41 23 40 11 27 86 82 89 59 85 4 13 84 100 53 29 84 36 29 80 56 7 8 70 23 26 73 71 94 62 27 66 43 8 5 42 67 3 41 56 71 80 41 98 2 10 59 74 32 45 57 12 88 58 50 35 12 63 30 81 3 61 34 33 36 27 87 80 73 19 92 41 73 52 74 86 95 73 47 10 93 46 59 31 30 89 55 49 15 91 941\n511\n65 64 45 75 13 43 36 67 92 63 56 53 22 55 3 75 25 12 16 76 33 53 46 34 3 37 83 91 12 83 44 2 54 100 23 90 78 26 61 69 13 8 82 51 69 75 34 47 98 98 45 51 37 18 86 84 50 32 61 12 50 42 61 66 68 24 16 62 34 62 45 65 35 95 8 100 14 68 36 25 30 85 43 52 53 75 16 20 44 13 100 53 39 74 78 52 78 73 2 49 70 5 26 46 32 61 32 75 6 66 12 77 17 3 93 55 38 71 74 78 66 35 7 19 84 58 66 18 58 32 5 20 37 35 73 11 90 86 42 51 76 78 42 52 75 73 39 31 83 18 31 92 87 68 56 37 89 76 25 52 72 48 8 2 22 57 83 79 30 88 1 64 31 94 17 87 24 54 63 33 62 24 43 61 79 33 27 33 6 48 52 92 100 38 75 19 22 47 55 11 50 92 21 17 46 22 29 17 14 44 41 54 7 50 32 46 6 37 28 79 26 37 88 54 86 50 92 10 4 92 9 44 93 40 88 13 56 10 12 78 95 36 40 40 50 45 92 31 27 21 88 29 28 53 41 38 85 1 63 8 15 38 67 76 59 82 20 42 89 40 28 24 51 38 38 45 23 55 36 62 62 62 25 1 6 78 92 17 82 70 98 43 79 86 32 73 22 12 8 5 41 7 2 37 79 45 85 13 40 61 22 10 95 32 87 5 82 79 35 11 10 33 24 31 97 56 18 35 94 100 60 17 82 66 19 8 95 25 15 58 59 49 42 35 85 51 11 83 50 17 49 94 47 52 10 7 73 4 33 48 89 40 64 15 13 26 10 48 11 74 61 28 22 3 49 76 80 48 93 74 38 49 52 69 65 21 5 83 31 32 49 87 43 71 5 67 96 27 35 75 62 55 63 8 62 1 86 24 75 100 20 5 24 43 51 19 61 87 43 25 12 93 17 76 14 15 13 68 5 36 15 41 22 21 7 23 30 79 30 59 89 2 53 93 85 77 14 46 16 36 96 28 61 49 68 81 95 78 56 84 51 24 9 81 64 72 18 64 14 41 4 84 98 36 17 9 9 30 96 97 44 72 48 13 29 55 35 95 81 53 92 2 56 95 37 52 7 86 42 30 39 34 52 66 89 26 9 94 54 75 815\n467\n89 88 74 5 36 82 77 49 18 60 58 58 89 18 6 55 94 32 2 52 34 87 9 95 90 35 11 2 30 2 6 41 26 98 87 84 56 9 38 98 87 45 76 86 80 48 47 100 3 83 73 82 90 70 50 63 5 17 53 7 65 33 42 38 16 20 35 90 96 15 57 82 53 6 64 65 27 65 82 1 40 63 38 99 95 9 57 24 60 34 21 7 51 80 33 2 69 59 55 6 79 37 67 53 7 6 46 20 20 7 61 57 7 3 85 22 91 78 62 16 31 71 47 38 38 100 1 51 21 94 29 88 50 79 11 100 71 31 19 57 69 70 22 44 2 69 20 73 80 97 94 97 99 11 40 37 87 49 26 25 96 77 77 65 99 38 38 58 42 6 82 48 9 67 30 94 98 62 64 71 87 9 26 51 54 81 59 49 61 84 23 2 73 65 6 18 53 17 51 22 90 34 33 15 34 75 58 68 78 18 76 63 20 76 77 82 54 3 22 19 97 7 97 93 45 76 43 2 33 51 7 86 4 82 16 39 88 75 79 99 72 17 20 15 4 56 18 47 19 57 78 54 82 40 4 84 68 75 94 49 68 5 34 44 95 72 49 32 17 88 65 91 98 32 55 33 3 35 5 64 38 44 11 9 86 24 100 26 49 8 10 62 95 86 93 40 53 80 35 56 38 17 28 31 98 79 9 40 58 54 46 40 42 45 51 5 7 77 47 42 56 70 14 84 5 77 70 50 21 63 75 71 33 43 12 15 32 8 98 37 6 72 21 63 41 78 42 52 77 62 33 53 71 83 25 49 41 16 77 81 57 65 14 13 16 84 59 70 19 52 28 15 86 12 79 88 15 99 17 27 17 50 82 91 53 65 85 78 47 44 4 52 42 11 24 91 46 54 53 91 54 9 7 81 5 22 14 57 89 9 88 49 68 49 94 68 97 37 59 20 53 24 48 82 41 67 23 67 65 38 3 49 27 76 26 25 42 16 83 20 78 35 61 19 59 80 43 85 3 92 54 36 15 38 85 35 83 96 82 24 82 83 58 26 28 90 475\n707\n93 54 46 69 48 91 94 58 76 27 60 29 57 50 57 24 8 25 36 73 58 3 33 4 91 22 38 21 74 48 37 79 65 46 9 69 91 42 42 82 43 50 19 39 55 21 73 13 90 48 33 19 91 82 98 54 35 21 58 39 82 21 4 31 13 61 18 74 86 18 74 78 59 45 43 9 58 7 5 98 78 77 6 14 12 26 64 58 70 89 80 70 38 16 79 49 89 93 80 43 36 87 4 41 57 72 96 87 48 91 8 79 88 97 63 96 70 83 39 13 77 16 94 16 39 6 98 48 78 11 43 25 58 77 46 20 28 55 89 83 94 49 60 94 91 29 61 81 89 71 63 56 32 47 58 81 16 36 75 38 87 83 22 68 21 28 11 54 6 95 60 2 36 81 85 85 53 32 16 9 76 21 26 98 91 51 96 2 59 98 67 53 6 19 80 18 51 1 15 50 73 56 48 63 77 6 54 7 89 48 19 89 45 95 67 28 35 76 80 21 32 42 76 58 8 3 54 96 27 13 51 60 10 50 1 6 95 16 75 72 8 75 92 69 22 99 56 2 14 91 42 50 19 80 40 80 73 84 13 23 78 40 29 47 43 77 11 26 1 31 55 46 56 50 54 69 78 86 46 90 76 25 19 29 73 70 87 14 6 29 10 48 21 36 65 52 44 59 88 43 40 61 93 32 65 15 82 76 38 79 49 59 35 44 8 68 91 41 69 5 66 16 35 68 100 71 21 14 39 69 69 71 57 76 72 87 91 55 61 76 3 50 91 39 62 67 57 43 11 22 54 42 93 79 53 31 32 73 53 82 29 90 84 52 94 20 47 46 94 87 75 26 68 51 90 83 91 85 21 21 65 45 52 19 38 20 41 93 100 27 29 87 44 61 50 38 44 99 42 22 14 30 3 100 17 81 12 52 44 44 39 99 44 76 59 28 55 6 49 83 36 35 34 54 25 14 21 79 73 19 31 52 78 73 35 36 18 12 96 35 36 90 24 28 27 86 52 48 49 80 6 97 65 90 58 61 9 8 77 13 49 60 70 28 30 5 93 83 27 87 64 89 23 88 39 81 31 96 15 58 84 58 48 26 54 45 30 14 22 14 99 78 43 47 15 63 5 54 3 32 77 85 27 94 35 23 57 22 90 17 79 34 82 61 59 83 74 35 49 17 3 2 10 72 75 47 79 53 26 33 90 47 71 64 5 25 55 18 24 3 58 85 51 91 96 39 74 99 36 10 74 2 44 91 6 63 99 63 56 67 90 3 85 34 27 3 11 44 78 45 69 100 53 58 22 44 72 42 2 28 74 88 27 38 83 25 90 84 66 22 57 49 96 17 18 78 29 53 45 90 46 50 32 57 78 90 54 70 11 45 98 82 83 14 32 32 17 3 72 89 75 43 60 15 8 5 60 35 92 71 85 97 57 96 100 99 89 49 79 16 78 4 19 28 39 23 27 17 75 59 27 44 36 37 53 11 14 37 23 11 58 89 61 49 55 93 1 30 54 69 96 65 8 23 26 67 97 4 22 50 79 44 42 24 81 91 41 14 95 71 36 3 59 68 64 67 14 50 42 3 92 36 88 29 40 88 428\n592\n23 66 32 83 14 11 56 70 11 83 66 42 86 39 4 67 78 13 60 100 26 73 83 31 86 31 70 44 63 42 60 3 72 27 60 92 68 14 63 56 20 25 93 16 12 1 23 36 89 15 46 60 95 26 41 34 16 73 33 40 31 65 46 56 96 56 91 46 19 77 74 33 59 73 56 95 8 21 8 24 24 39 16 53 45 62 13 99 68 3 76 47 83 4 62 38 27 11 10 73 62 62 58 97 22 29 61 76 44 3 44 33 14 26 44 16 57 40 46 9 67 66 22 96 42 88 78 73 71 1 59 85 27 37 39 27 15 46 65 89 81 20 49 14 11 66 45 8 63 46 52 35 99 36 13 58 30 24 7 98 63 7 67 16 89 86 83 37 92 37 36 18 43 98 57 5 33 52 34 75 31 28 69 31 50 9 10 86 94 51 90 57 83 74 47 15 26 53 35 29 57 84 85 52 49 96 57 6 30 6 37 12 34 15 90 65 70 31 22 78 39 76 59 18 98 50 41 10 88 12 29 56 50 32 41 7 5 44 58 64 43 60 69 84 29 7 78 86 43 96 66 76 66 47 37 87 4 57 59 78 33 58 97 31 37 64 96 58 27 62 46 51 75 12 75 52 80 38 44 4 6 95 6 23 95 83 57 46 32 30 46 22 1 23 89 34 17 42 54 25 87 50 33 35 22 38 78 62 77 15 81 100 81 86 31 30 22 14 21 36 83 66 93 12 69 95 26 38 1 92 50 65 71 37 74 75 80 70 18 10 53 98 74 34 29 70 91 46 81 78 90 12 45 86 66 69 30 62 99 63 58 21 67 44 20 92 89 52 18 26 38 1 58 8 17 5 19 78 5 25 52 77 98 6 79 1 77 30 15 32 14 11 76 19 66 56 81 12 97 93 38 60 30 35 40 97 36 32 92 31 54 75 4 58 39 90 33 7 51 3 8 58 55 14 96 48 94 21 93 78 15 67 79 7 55 21 75 2 14 44 23 76 76 95 89 9 12 79 32 52 62 33 7 37 6 80 92 29 96 94 23 42 22 14 55 15 95 6 59 50 51 91 34 52 77 9 35 24 16 98 72 51 47 62 2 47 87 26 22 86 27 40 31 10 52 28 24 97 86 74 34 21 53 66 96 81 94 54 84 71 84 94 71 40 69 23 51 45 92 39 43 9 18 41 86 96 82 67 37 75 78 99 49 96 59 42 100 67 92 30 58 68 46 48 90 14 23 78 14 94 44 91 15 37 8 100 35 12 60 65 52 23 65 42 86 8 73 59 4 69 83 11 61 29 1 46 99 82 34 32 4 30 68 95 75 72 95 6 80 17 50 820\n473\n15 7 91 36 20 47 52 45 47 85 21 94 69 15 89 9 3 44 77 42 68 61 80 63 3 45 26 73 10 78 6 62 16 34 94 8 61 53 16 41 8 88 75 68 99 1 12 85 14 70 46 20 65 82 1 99 92 37 22 53 39 40 93 85 81 12 78 97 71 42 55 78 40 67 73 30 80 36 79 72 19 72 49 39 8 27 74 21 56 72 69 15 20 13 92 12 46 50 71 87 73 34 23 13 25 61 55 85 28 99 89 63 35 30 11 75 2 23 9 55 56 37 37 98 11 30 28 69 1 93 14 51 91 23 1 18 70 20 42 83 100 97 45 89 3 45 92 16 71 59 10 4 17 55 19 30 74 67 52 80 4 83 77 81 71 78 8 41 40 100 57 23 71 19 26 63 92 80 4 53 84 17 88 92 19 53 89 27 45 65 17 46 68 41 39 17 10 39 29 43 26 33 12 74 47 90 3 15 64 1 69 50 25 63 11 81 9 64 32 11 89 42 88 6 59 97 88 37 54 28 28 98 83 54 2 18 13 29 43 99 99 36 65 52 36 52 71 21 88 48 4 53 92 28 90 88 49 68 16 58 69 57 76 100 3 23 3 25 92 90 65 47 72 42 36 4 44 68 76 85 40 63 56 88 53 22 61 20 20 83 97 92 43 43 4 3 95 65 82 67 61 100 53 47 63 15 77 73 20 56 49 25 88 83 87 53 56 44 40 54 35 49 83 29 59 24 60 77 49 23 53 68 22 56 64 73 74 39 44 47 3 76 92 19 76 90 87 77 90 92 3 69 94 51 61 33 71 97 29 100 66 31 42 26 75 9 76 32 57 57 62 91 71 2 44 62 87 63 55 16 11 57 87 46 96 39 43 83 10 74 75 86 53 33 38 30 19 96 100 85 42 5 21 1 8 87 42 76 17 2 69 92 98 69 66 14 38 90 53 28 34 70 37 72 34 2 62 82 75 25 26 35 22 10 19 8 43 80 23 27 88 70 57 99 69 86 100 53 9 61 3 94 69 92 33 17 32 74 63 55 17 75 76 55 60 38 74 11 99 31 75 6 573\n783\n55 14 40 46 59 36 99 90 63 53 44 28 81 34 13 65 3 34 54 32 29 73 79 69 74 71 50 12 99 1 2 28 98 74 41 51 9 23 58 40 70 1 69 34 3 15 35 44 7 27 48 47 81 5 63 7 5 19 47 19 10 34 30 25 36 24 8 29 86 52 96 71 72 10 87 4 48 96 3 47 24 74 23 20 67 84 82 68 48 83 28 48 30 58 59 6 46 76 92 66 12 50 86 97 100 47 2 40 15 68 4 2 26 75 61 27 8 58 26 73 37 8 74 2 23 63 67 19 84 50 68 5 81 93 59 98 78 80 67 18 67 23 98 45 12 11 30 72 51 21 4 72 59 68 49 54 40 91 11 62 64 41 74 83 1 32 22 80 64 83 2 41 14 7 75 70 92 71 29 1 37 28 19 87 56 35 41 58 89 73 74 79 96 40 70 57 57 7 57 86 39 57 28 43 81 61 8 83 77 83 45 6 62 40 100 36 27 67 87 39 22 84 70 69 94 74 17 55 70 77 60 35 97 17 75 47 38 39 100 36 8 36 83 10 76 18 89 60 58 17 17 52 48 77 30 44 64 10 37 78 3 35 26 98 25 9 28 25 71 49 80 87 91 32 11 49 99 58 96 7 87 94 35 71 21 54 58 63 34 44 94 52 58 67 88 6 92 66 50 36 35 2 100 20 47 23 90 18 36 2 62 29 55 20 24 49 3 81 44 58 58 93 82 62 52 28 27 56 19 19 35 76 5 99 71 11 2 20 66 96 7 70 16 5 21 99 81 59 86 13 58 10 68 80 15 14 34 44 37 45 50 75 67 95 75 52 26 9 56 22 74 52 37 91 14 41 71 95 45 51 97 88 38 93 60 94 29 86 4 97 13 78 65 82 67 32 66 27 81 79 52 39 42 96 48 41 8 56 44 2 20 66 85 47 78 50 91 40 61 78 45 10 10 14 52 67 13 30 73 73 69 85 3 93 17 45 100 41 67 22 32 32 16 22 6 17 29 43 84 44 92 51 10 97 65 78 11 60 34 43 54 54 32 7 67 99 6 88 85 4 34 83 56 28 63 41 16 42 3 9 50 86 93 5 2 63 92 55 87 99 40 70 22 85 41 98 18 6 46 22 1 36 100 31 56 52 33 19 19 98 82 46 65 46 15 27 48 54 26 21 51 35 64 57 14 60 87 55 38 23 51 53 83 38 71 66 55 62 39 30 98 66 19 49 42 96 42 88 53 31 100 85 42 72 89 37 97 15 91 9 17 27 50 86 77 45 59 22 86 46 17 6 3 84 15 5 46 73 44 89 44 8 32 42 65 92 30 50 54 46 29 59 51 60 41 94 35 3 86 4 20 31 65 22 65 55 18 66 60 45 36 86 23 34 83 55 16 22 62 9 25 85 31 91 72 71 93 96 11 73 57 20 99 25 33 28 30 19 24 57 63 34 86 77 36 18 36 100 32 24 51 86 92 22 92 43 90 50 95 93 18 62 96 4 78 4 10 59 67 36 85 65 64 18 71 30 35 81 75 20 75 71 48 91 22 2 70 82 66 62 57 100 90 25 55 18 97 96 65 33 7 42 99 3 50 14 77 58 20 3 37 56 7 49 86 100 96 81 7 10 58 21 36 47 61 17 57 74 85 32 67 7 18 72 25 1 4 11 72 91 22 69 47 12 91 46 61 24 47 59 73 56 97 93 86 2 96 20 27 7 5 33 84 23 79 68 96 34 78 9 48 77 29 40 49 90 53 98 85 55 42 29 590\n159\n80 12 22 94 72 43 42 86 57 72 2 13 12 81 94 57 21 20 80 84 41 4 92 78 91 85 9 82 100 28 82 38 29 27 50 86 34 69 46 92 64 87 79 77 78 72 70 56 77 35 20 96 100 7 65 47 82 75 27 15 12 23 88 64 97 91 21 23 66 14 44 8 73 44 82 7 37 53 46 44 89 9 45 21 44 14 12 63 6 85 49 94 23 95 17 79 34 26 84 11 12 5 20 13 46 42 37 7 74 84 73 45 36 5 34 69 62 20 96 76 67 26 26 32 4 78 1 2 93 77 69 74 74 37 13 46 97 41 7 67 60 54 85 23 73 14 90 33 59 34 14 33 19 21 39 54 54 46 172\n643\n93 33 54 31 71 73 45 98 52 36 13 86 38 99 62 39 65 72 26 13 53 47 13 92 40 14 19 99 43 60 97 35 88 43 18 97 42 18 23 47 89 8 38 45 56 64 10 46 17 71 53 38 12 49 28 27 75 12 4 2 13 63 15 61 52 61 3 33 87 91 56 71 67 20 93 100 51 28 54 79 16 76 19 95 37 12 5 86 49 51 74 71 53 51 67 71 43 99 59 51 12 17 1 61 29 21 11 67 73 6 96 20 22 78 43 17 10 20 64 31 78 96 54 17 65 51 60 11 61 66 85 60 69 47 72 33 46 71 3 41 36 76 70 10 43 26 97 69 40 93 66 61 83 21 59 83 35 40 72 30 27 14 100 11 78 91 57 38 93 34 31 38 31 8 91 7 15 89 20 56 83 50 61 97 57 12 16 72 35 61 45 57 50 49 67 6 36 8 26 25 94 43 98 99 13 43 64 23 96 20 68 37 94 59 56 54 93 45 20 23 51 6 33 77 61 91 25 7 97 95 58 44 2 52 46 98 63 11 9 72 4 65 91 86 71 16 99 55 55 42 82 18 75 61 70 92 15 100 78 55 100 58 33 66 85 93 50 81 43 78 18 51 67 1 29 18 12 23 33 22 23 81 51 45 34 93 88 68 71 73 85 86 24 61 73 29 11 70 89 53 59 64 22 28 70 3 37 4 24 65 93 26 21 99 83 44 29 55 25 88 32 69 92 14 65 60 89 44 82 8 91 100 64 17 50 67 74 14 23 30 33 56 69 49 18 57 82 100 25 77 65 9 60 4 20 18 37 73 50 18 79 26 88 52 4 29 64 43 89 47 100 11 62 58 2 50 44 88 53 67 63 35 33 10 62 90 42 55 45 9 57 55 26 42 8 34 48 4 42 50 76 54 47 17 10 62 97 75 26 34 76 78 73 95 38 40 72 98 18 99 87 33 93 56 40 30 99 18 50 90 23 7 69 13 8 30 70 24 44 94 59 29 36 13 55 7 31 67 28 33 85 44 23 86 91 61 37 15 24 22 97 100 58 56 25 68 12 76 69 90 7 1 100 32 73 39 78 27 9 57 9 12 17 85 6 17 67 75 31 37 53 18 6 77 62 53 10 51 28 9 89 62 4 52 8 68 41 9 80 19 6 79 82 73 49 92 87 87 40 25 72 40 11 44 60 71 21 94 85 20 78 14 7 47 69 35 86 3 64 7 73 53 88 81 19 3 29 92 1 37 46 20 11 33 3 75 79 11 3 51 78 29 40 71 37 71 5 33 35 16 56 69 25 9 96 82 76 2 63 27 67 10 84 29 31 76 87 3 24 19 36 9 35 41 52 36 29 66 47 51 17 59 24 84 94 22 83 45 51 17 73 6 8 13 31 77 23 85 7 44 86 20 13 10 23 20 72 99 59 11 16 22 27 42 47 2 62 43 10 11 3 62 130\n142\n59 26 21 93 9 88 50 77 26 6 41 88 21 53 17 57 34 70 55 91 26 73 58 69 25 8 44 3 79 22 49 97 61 26 89 54 1 89 56 51 81 8 23 25 20 62 37 57 26 55 75 68 24 17 88 64 84 19 65 14 67 89 11 25 74 16 18 97 40 63 82 17 48 57 27 38 12 81 78 55 7 55 12 98 39 82 20 17 42 48 92 99 55 12 49 16 37 65 39 8 51 72 52 28 73 48 87 11 41 63 78 47 12 71 47 17 93 93 88 27 73 11 60 68 27 20 48 84 62 89 97 17 48 37 97 9 91 71 5 6 56 91\n250\n63 81 13 87 60 99 77 34 65 86 80 57 40 47 89 57 63 63 48 60 64 42 58 76 68 96 25 96 20 72 59 59 72 96 9 15 6 46 1 99 62 63 57 21 18 98 61 46 52 42 47 77 4 72 90 22 64 85 52 36 83 54 37 87 1 17 15 52 97 48 4 42 21 26 41 47 15 59 53 56 18 81 39 88 79 42 86 66 78 41 87 89 81 35 71 44 76 8 12 92 31 27 82 23 16 12 75 12 83 37 78 87 87 65 36 14 34 8 54 3 12 57 70 79 81 59 57 48 69 95 29 51 64 54 20 93 19 94 35 88 43 29 77 50 10 85 52 31 39 91 90 57 66 27 95 9 13 25 16 92 38 80 10 14 95 80 75 72 22 47 16 24 15 98 39 53 65 78 68 20 28 20 97 35 30 47 43 35 62 61 51 18 68 68 78 23 2 73 95 79 36 22 24 39 92 41 3 25 95 93 29 54 6 37 27 75 97 33 47 84 74 22 66 58 46 18 96 97 67 88 79 21 44 41 56 32 44 100 71 11 1 54 2 83 44 61 44 33 8 706\n354\n37 11 75 89 98 47 73 85 75 42 31 68 80 1 54 2 72 99 48 55 62 19 74 85 88 73 21 85 45 16 73 18 63 42 86 10 80 6 14 77 5 80 71 88 26 59 52 49 62 7 79 83 98 95 25 64 66 48 61 51 60 79 3 88 67 10 6 66 75 75 20 97 58 95 57 98 60 1 42 63 12 71 90 12 71 40 44 33 68 25 92 55 44 92 46 28 78 41 87 33 6 23 79 5 71 83 97 24 17 42 67 24 36 90 17 12 17 75 92 87 55 52 26 81 22 4 62 77 32 89 85 71 23 59 49 63 4 12 60 70 3 53 69 33 32 30 70 72 25 24 79 70 75 6 37 100 64 47 63 8 67 95 69 45 37 72 26 53 63 90 60 96 1 38 44 94 78 26 80 5 76 19 87 56 100 18 46 20 32 48 50 32 7 43 86 92 83 16 30 18 57 37 61 63 58 55 94 22 38 42 55 99 61 92 9 62 27 24 55 13 98 5 84 85 2 36 89 91 38 74 48 10 2 65 26 75 70 96 45 41 27 81 41 71 31 18 65 97 27 74 38 20 32 7 39 36 47 73 20 29 17 90 85 31 45 18 18 68 62 51 88 1 91 56 33 30 36 40 10 48 66 9 69 50 18 71 88 38 27 73 57 35 55 49 59 6 58 96 99 14 60 62 14 30 73 27 52 21 86 41 94 52 18 92 27 78 26 63 93 97 74 93 97 22 33 52 45 20 55 15 39 62 50 93 51 56 72 3 73 90 41 76 14 73 77 53 80 53 15 46 29 27 85 679\n548\n26 7 32 55 76 55 60 11 95 70 18 95 80 92 23 53 40 40 73 74 36 69 72 89 6 12 27 13 8 89 77 15 56 25 34 91 10 39 77 41 48 71 31 93 85 11 23 45 45 55 76 3 76 2 28 72 20 72 95 31 87 53 64 87 26 88 33 73 87 100 78 30 91 5 77 15 96 7 50 91 72 51 58 55 49 39 86 95 39 100 3 34 57 56 59 45 80 56 2 12 63 26 17 18 30 32 73 36 24 28 23 6 85 41 50 26 98 76 98 85 73 61 57 7 100 22 92 35 3 49 83 57 79 39 60 36 82 91 52 49 13 35 77 63 98 26 15 63 31 83 4 30 99 73 29 33 5 91 2 70 55 79 4 37 58 69 70 42 95 62 15 63 16 74 70 95 74 85 50 74 92 72 45 51 97 92 52 77 21 84 53 82 27 56 73 12 57 59 2 4 97 44 28 7 37 49 47 42 3 32 61 93 52 43 69 72 88 44 64 83 46 14 29 88 55 88 29 23 59 60 69 93 34 19 81 9 62 47 78 18 76 88 82 96 91 99 79 42 33 67 84 70 26 83 5 45 85 35 66 69 16 73 93 40 100 2 50 26 27 42 23 88 72 48 66 8 7 20 20 86 28 95 90 1 32 17 17 90 41 15 62 100 67 38 40 36 89 29 91 39 39 5 23 89 32 73 24 24 19 77 20 53 71 61 11 49 67 59 34 39 52 97 98 7 38 28 44 6 34 68 57 34 69 34 18 72 100 25 35 81 8 34 62 4 20 38 36 22 73 84 84 75 75 93 30 95 53 34 34 79 66 93 21 36 23 67 46 46 67 74 8 14 7 32 61 2 90 22 50 49 82 19 46 86 29 93 58 81 28 55 36 54 92 95 65 78 25 100 45 27 19 81 95 89 97 99 87 14 8 79 88 84 7 44 94 51 12 2 30 86 13 88 15 88 1 13 2 77 80 49 2 73 47 41 49 70 27 55 66 89 93 35 12 74 44 3 70 92 13 69 46 4 80 97 43 24 12 14 79 31 7 58 1 27 64 38 5 49 36 98 33 69 1 77 20 40 54 1 95 80 42 73 49 38 52 9 86 79 31 16 60 100 5 14 26 22 61 17 66 92 38 26 24 81 91 74 72 59 83 83 73 40 59 90 96 12 42 97 73 33 14 97 28 56 23 11 88 84 12 99 6 11 64 38 25 27 8 53 15 5 40 57 79 85 50 75 60 126\n25\n13 9 99 11 6 9 100 50 15 3 59 84 50 6 37 29 26 78 24 53 13 69 8 17 270\n149\n30 81 8 55 31 93 86 84 82 10 2 17 64 89 13 28 80 39 10 71 97 87 71 19 3 92 36 65 17 20 51 96 54 23 2 13 19 43 54 67 39 38 39 29 64 60 60 67 49 36 70 43 97 18 17 33 27 89 74 87 50 72 92 96 84 22 69 72 93 44 21 34 47 32 36 96 77 30 63 85 77 98 96 12 68 1 20 41 21 35 54 68 45 95 26 91 1 48 58 45 58 31 32 88 13 61 77 12 1 67 98 97 34 99 57 80 6 27 85 4 59 14 8 50 4 95 11 34 12 26 12 4 69 53 33 19 56 48 75 17 33 12 15 85 11 58 50 10 485\n427\n18 61 64 51 93 18 36 66 81 84 47 96 16 47 46 15 27 83 85 94 63 12 56 88 91 92 25 11 65 77 45 63 63 80 77 34 11 78 100 87 98 27 64 100 30 54 24 5 47 43 87 84 11 25 89 19 14 75 24 68 52 54 39 35 73 55 92 82 52 78 77 42 67 34 99 15 100 33 28 22 33 61 9 87 97 32 7 79 53 53 66 22 52 84 67 66 40 91 18 50 62 44 73 39 30 36 65 88 62 19 39 22 50 96 46 90 99 24 90 22 99 35 73 37 6 18 94 32 14 42 6 98 3 62 11 86 79 19 2 70 56 97 20 11 56 63 15 13 90 86 87 56 59 10 78 74 48 44 88 60 57 45 81 41 10 2 64 47 68 76 74 56 25 52 28 41 76 83 18 34 93 23 46 68 38 5 88 19 23 43 53 79 5 1 10 48 72 16 93 82 57 32 60 84 32 83 31 62 66 18 99 56 73 39 90 5 1 36 43 34 75 48 82 64 64 85 51 46 58 95 43 65 66 41 30 13 99 79 16 94 6 48 98 63 25 25 44 51 13 39 26 70 4 57 68 12 39 53 11 79 59 56 53 100 99 9 36 78 32 21 59 65 76 91 31 66 98 47 84 90 90 42 89 88 90 28 32 26 63 80 88 5 12 77 26 9 84 17 21 32 2 94 39 66 50 35 34 67 87 89 81 84 88 24 81 17 12 91 69 29 50 67 39 15 40 29 75 3 34 41 83 80 15 68 51 11 81 25 99 100 67 1 49 78 30 2 56 50 64 99 4 22 53 45 95 61 22 7 31 52 68 3 54 41 42 50 11 71 91 66 60 75 51 60 74 100 73 56 35 56 32 15 10 15 17 90 92 6 56 91 31 93 75 65 67 2 57 91 69 71 13 84 82 22 50 5 87 75 87 38 17 13 32 13 76 22 89 7 55 83 91 8 68 16 33 91 530\n99\n3 78 7 60 57 10 23 30 2 21 100 39 49 19 52 35 14 20 85 50 47 51 63 59 95 95 44 34 9 96 29 57 94 6 27 49 26 15 56 17 55 77 41 13 63 5 22 98 6 13 1 74 14 75 8 58 48 17 99 7 29 14 90 70 96 93 88 53 55 47 21 19 65 61 17 77 28 71 15 75 41 81 18 49 88 78 79 37 73 54 71 99 52 84 29 91 31 24 555\n",
"30\n441\n55 33 26 69 20 22 70 84 82 74 32 41 12 39 55 87 37 46 89 55 85 52 48 73 27 50 21 76 11 93 49 84 56 59 83 86 36 91 77 84 42 85 9 100 23 1 83 15 24 36 11 49 91 40 87 99 31 49 33 86 11 35 83 69 21 88 69 54 81 4 29 90 36 16 85 59 74 27 92 31 30 93 62 95 50 21 47 41 87 44 21 68 33 39 7 22 36 88 25 42 48 40 8 47 83 62 91 34 43 73 81 72 53 91 7 86 52 12 94 100 95 21 33 69 93 79 53 75 67 35 43 70 57 13 1 98 5 15 15 84 88 34 56 14 74 9 71 87 3 91 62 58 72 65 91 83 21 45 35 47 91 24 83 94 75 55 28 83 77 92 80 86 80 8 53 49 11 22 66 25 98 71 71 40 81 30 90 60 41 72 81 97 79 51 59 55 23 30 36 10 51 84 54 69 9 20 17 37 27 99 9 32 59 27 93 3 75 64 40 7 25 75 25 39 57 22 24 19 57 16 48 41 62 90 19 86 74 19 80 99 8 72 27 19 41 5 91 82 96 51 25 26 97 69 4 86 54 80 23 93 34 19 24 87 98 68 97 84 95 16 96 64 22 1 94 87 76 91 66 11 85 68 73 69 79 37 36 35 40 46 34 4 54 11 12 51 12 87 41 17 100 7 67 18 51 54 23 18 72 32 68 92 9 86 99 39 74 18 74 18 17 47 80 66 41 59 84 92 78 1 92 68 32 99 7 90 30 61 20 46 53 54 96 39 27 46 77 17 84 35 24 66 41 50 38 45 99 58 87 20 21 20 74 33 45 67 71 42 44 67 56 25 33 74 65 69 46 36 95 66 96 12 27 12 56 91 60 10 70 79 97 90 66 52 79 60 89 53 31 43 9 11 19 82 30 37 15 14 93 59 93 49 63 60 86 2 15 2 87 63 79 24 97 26 24 47 8 10 63 51 64 23 35 48 5 53 52 20 86 97 295\n586\n68 58 39 57 44 64 45 50 10 55 93 37 37 92 89 74 36 22 50 17 15 21 2 88 21 44 18 20 1 67 98 17 50 30 61 20 9 48 64 90 31 100 83 36 16 83 63 2 28 49 71 61 36 95 63 21 86 96 4 32 80 57 9 80 61 41 95 68 42 28 44 100 85 20 23 63 100 71 58 32 92 37 86 17 28 13 80 59 2 11 73 33 17 74 43 14 100 1 47 58 27 91 80 33 67 96 53 82 14 65 88 4 66 5 10 90 81 66 68 73 71 72 30 82 61 45 100 32 82 99 7 2 25 35 7 63 91 72 4 50 56 19 7 49 35 41 29 74 56 61 80 52 78 96 21 8 44 65 100 87 100 49 79 19 30 80 97 9 84 85 2 29 0 57 34 88 45 79 16 38 15 99 39 58 93 64 65 58 89 28 35 78 66 71 18 8 42 62 57 20 79 22 35 32 89 66 96 97 81 41 99 97 5 73 54 88 79 65 30 5 88 82 11 70 4 38 36 56 78 75 80 73 46 7 70 20 32 3 4 83 34 78 34 12 75 38 9 63 81 34 53 65 28 59 19 93 78 66 61 22 29 10 54 13 94 43 84 58 79 83 65 53 31 28 20 100 79 74 20 35 46 72 71 74 36 73 46 77 76 91 43 88 24 61 64 65 9 10 81 29 72 73 65 72 47 11 77 40 40 14 65 43 66 15 55 25 19 76 56 27 49 64 99 71 8 18 96 82 32 35 66 33 57 22 46 98 67 70 67 14 97 9 48 19 23 22 24 6 3 13 10 19 73 27 51 8 58 84 20 13 90 46 90 26 25 51 98 38 4 3 91 63 10 64 40 36 24 82 47 12 88 27 87 60 21 38 41 4 45 82 13 20 66 81 39 15 37 80 58 62 40 82 86 51 10 88 4 61 61 3 5 3 58 80 74 23 72 38 58 66 60 33 6 87 31 48 84 72 2 78 71 32 14 6 63 40 3 61 80 82 43 56 50 12 77 78 29 78 35 58 43 9 84 8 58 53 94 59 69 96 36 5 58 99 97 21 21 69 59 63 37 40 84 12 61 19 52 19 59 68 45 16 26 45 38 86 41 59 55 19 66 54 16 34 19 52 12 88 99 19 50 34 44 76 10 74 62 74 95 19 41 17 52 61 71 82 83 24 29 94 50 50 38 58 50 43 22 42 11 17 94 56 24 81 2 94 89 48 63 89 2 13 78 98 6 20 26 41 65 54 7 18 26 83 13 28 49 99 76 80 85 47 78 20 61 31 100 86 70 43 7 35 24 17 23 34 62 25 67 79 7 58 32 88 61 266\n487\n95 64 69 7 95 52 90 8 94 36 72 23 99 74 11 84 41 22 31 22 39 99 63 19 53 66 75 3 12 29 19 53 90 13 9 79 7 9 17 43 76 72 66 29 63 15 40 18 32 93 97 25 85 70 94 48 2 11 61 65 19 81 35 63 25 100 5 33 32 82 45 20 55 100 9 2 38 50 81 5 49 79 65 23 97 28 23 35 78 51 98 85 100 22 33 93 56 81 23 59 55 30 27 50 10 55 73 25 53 21 98 40 19 40 57 83 40 73 29 96 38 66 40 84 55 57 19 17 17 68 33 24 38 10 95 86 19 16 92 5 14 71 57 92 19 40 49 5 79 81 53 98 40 74 61 25 41 87 83 19 100 12 65 81 78 53 6 39 18 3 32 96 82 85 97 79 56 36 68 28 19 60 13 60 62 91 22 42 93 46 29 36 14 38 80 35 89 16 20 39 70 29 45 49 86 31 17 5 73 43 78 51 17 40 20 47 7 6 67 87 48 17 98 62 79 12 24 23 16 52 72 18 87 64 28 18 88 22 58 50 90 10 44 89 12 65 20 86 44 7 95 18 63 72 59 7 33 89 65 86 97 9 100 85 34 82 24 51 31 68 45 71 75 44 67 30 54 27 11 77 28 47 12 8 11 32 25 86 8 56 43 39 30 41 100 55 70 39 22 70 89 53 57 14 94 17 87 17 58 22 25 93 94 99 6 15 94 73 51 98 82 2 35 53 29 23 63 38 36 46 64 12 93 40 20 56 15 66 86 79 8 22 2 1 77 5 13 15 14 81 30 66 33 99 75 38 26 98 39 26 9 51 18 37 72 35 53 25 52 94 2 54 27 83 37 82 47 21 43 82 73 7 21 57 81 61 64 82 58 26 45 50 42 1 90 54 92 25 49 33 63 94 47 66 59 40 23 12 62 90 7 61 53 5 28 72 35 32 32 95 95 98 66 21 72 26 33 82 30 34 17 91 96 98 3 74 72 98 11 53 56 17 91 35 61 26 48 69 84 50 72 3 37 23 7 28 98 30 34 60 11 57 77 3 1 31 71 52 68 11 89 51 45 58 65 66 62 79 95 44 90 100 63 32 66 84 492\n169\n3 16 59 35 74 70 83 60 98 100 20 85 74 10 34 2 55 53 90 69 68 16 21 90 14 84 22 65 68 98 5 98 14 49 52 28 35 74 68 57 52 39 44 21 97 64 16 30 45 75 9 1 91 69 56 29 70 71 38 32 65 23 97 93 7 93 8 81 65 72 22 9 95 84 93 62 37 28 31 69 13 14 32 46 28 45 36 26 49 46 1 46 91 81 35 51 87 91 7 20 80 41 1 87 52 13 51 23 84 38 33 9 2 8 31 22 1 13 34 89 62 17 91 1 83 75 35 47 54 94 48 23 6 2 10 56 63 74 20 39 69 48 28 60 42 56 71 2 30 14 76 68 96 93 27 70 77 92 22 7 93 36 15 12 99 44 47 6 8\n133\n36 43 19 53 15 15 21 60 79 29 31 39 8 47 25 92 70 86 2 58 85 42 90 17 11 58 53 24 76 37 72 43 20 7 40 30 28 54 7 27 74 39 62 96 7 37 50 55 68 69 35 64 70 91 91 30 15 14 91 42 67 63 48 10 47 99 95 54 100 3 25 72 23 23 38 55 68 30 34 54 89 100 21 97 69 37 67 96 70 45 24 27 84 88 53 81 69 8 49 51 84 92 54 29 36 71 100 37 51 93 47 53 19 54 76 92 92 13 39 62 10 30 65 4 79 62 65 99 2 60 76 45 387\n720\n71 83 69 47 36 92 68 59 90 23 54 16 80 20 50 40 46 97 51 46 7 5 40 70 87 6 52 12 97 100 29 100 88 65 46 44 31 23 35 9 90 84 59 32 78 100 40 65 53 10 12 54 64 2 58 77 31 39 72 11 39 56 10 91 67 39 8 20 57 37 45 6 33 56 29 29 19 63 54 93 90 42 39 66 61 57 23 66 97 5 32 50 61 32 36 34 62 65 57 34 16 84 38 98 2 89 6 96 49 35 29 83 18 51 88 77 9 93 8 18 77 34 78 32 77 5 74 6 4 41 55 35 32 68 57 36 50 58 57 3 58 54 81 51 39 10 14 7 63 100 49 95 67 97 30 42 93 3 75 85 40 89 82 45 19 25 27 44 45 52 42 8 34 6 50 90 69 11 54 51 53 92 20 58 36 18 16 9 87 83 100 72 64 62 13 25 49 26 67 17 26 50 27 98 89 30 1 40 91 31 93 82 85 17 50 56 84 50 14 56 59 4 10 84 39 93 19 10 29 78 79 69 57 56 29 32 91 81 56 19 73 17 43 99 41 81 9 100 79 47 14 79 4 13 65 63 62 40 22 39 92 58 85 23 35 90 33 37 18 25 38 55 10 87 22 51 82 78 42 58 35 86 13 99 88 30 45 18 22 34 96 95 38 88 100 52 32 40 21 2 61 50 100 26 56 61 61 18 10 66 41 97 16 45 39 57 87 74 71 92 44 23 45 24 26 67 24 20 97 91 43 7 48 20 69 55 5 47 84 14 63 55 38 1 60 57 81 35 47 12 16 67 25 12 24 94 98 48 80 6 39 34 63 57 82 77 20 68 31 25 81 85 39 94 2 58 88 48 98 51 8 68 64 57 4 12 57 46 22 35 88 85 48 59 95 82 73 12 85 9 74 3 71 78 77 61 3 83 12 33 34 11 81 89 1 17 43 64 64 29 54 66 36 16 85 83 93 39 68 71 52 77 27 51 10 28 44 40 24 67 43 32 29 60 9 83 23 24 67 34 1 2 56 43 47 84 13 70 34 91 97 19 95 86 77 12 23 18 73 36 75 52 52 16 63 94 93 86 28 77 96 77 65 98 58 78 18 66 3 35 75 64 36 94 88 93 66 39 81 17 84 20 10 85 87 3 85 38 75 78 96 27 77 43 33 98 94 98 34 70 16 4 82 61 49 73 52 15 56 32 58 20 48 49 90 81 5 77 57 6 49 68 65 21 71 96 12 21 51 83 78 9 8 23 51 54 99 19 73 12 53 36 34 72 45 81 35 76 56 99 74 66 68 63 50 13 56 64 65 45 89 28 43 25 56 29 52 23 37 60 40 57 27 59 16 21 18 2 37 11 24 51 10 24 58 50 67 53 76 61 17 72 88 7 32 19 15 23 24 97 41 88 49 89 94 51 84 99 7 17 76 57 28 26 32 79 76 52 46 11 66 97 81 17 100 19 40 10 74 9 32 23 66 56 6 28 52 66 50 32 90 4 51 14 44 49 27 12 53 95 94 48 46 31 21 94 86 3 88 98 9 93 84 51 37 83 34 42 92 62 28 99 39 28 85 28 97 15 28 98 60 45 72 13 81 72 89 86 21 57 51 40 23 56 78 9 20 4 95 896\n285\n16 46 3 19 53 22 6 6 59 82 1 61 6 72 97 32 55 94 47 45 72 54 17 25 30 98 31 37 4 77 34 84 96 36 78 89 14 37 88 70 58 86 54 90 43 66 18 48 94 78 25 78 3 40 40 60 59 13 57 4 94 36 58 70 50 70 33 46 81 77 73 34 44 40 91 3 74 91 53 12 54 96 37 25 30 3 50 6 81 69 33 89 94 59 39 40 5 37 45 29 53 87 15 40 52 27 57 17 64 52 63 29 43 26 20 23 54 12 50 75 88 12 1 99 52 62 9 12 78 86 59 42 66 93 40 25 68 61 40 4 38 56 80 97 36 69 92 70 92 80 56 81 30 77 24 49 22 73 25 61 1 100 71 19 23 58 61 8 28 98 39 21 21 33 26 71 66 11 9 22 61 39 20 86 91 80 94 80 22 6 66 29 54 28 44 8 5 18 84 40 16 91 85 40 64 6 18 57 9 8 1 83 80 54 97 78 17 98 6 99 35 61 76 70 58 13 18 86 63 32 91 80 19 78 43 27 97 82 80 3 42 91 36 56 97 92 96 85 52 14 70 5 51 95 46 30 47 33 24 95 68 28 58 93 15 77 53 46 3 38 72 66 15 17 91 45 65 14 87 92 76 44 72 48 578\n495\n53 26 90 65 33 25 2 57 17 6 51 48 47 16 24 96 26 77 61 17 84 76 50 11 89 52 71 64 71 69 51 65 94 93 15 99 100 42 20 13 9 31 67 25 1 14 74 93 53 17 62 8 36 81 67 2 21 3 23 90 17 78 24 42 92 98 12 46 15 49 9 82 18 83 73 18 22 6 27 65 75 47 40 33 29 74 94 72 50 3 81 78 66 35 62 85 91 50 78 94 30 1 16 25 77 54 44 100 92 7 40 76 43 51 85 1 94 86 72 63 5 72 100 76 29 31 99 55 69 73 96 64 72 59 100 82 19 40 27 26 3 13 97 14 92 30 47 47 62 12 49 91 28 92 27 61 60 85 78 99 69 43 22 28 39 98 33 85 52 98 65 3 41 64 76 100 77 64 56 36 12 80 21 86 90 76 69 69 84 67 48 52 33 68 91 91 84 52 87 61 23 53 23 77 60 68 26 8 44 30 53 72 54 87 32 50 71 96 46 30 65 12 61 97 28 29 13 38 29 52 33 58 55 68 19 71 70 97 11 79 14 60 91 39 41 74 7 68 76 80 91 69 65 21 89 98 62 63 35 27 2 26 61 47 17 34 34 43 56 8 29 26 80 92 81 33 14 91 96 89 98 30 61 71 7 20 67 86 69 66 90 73 12 48 6 67 64 44 81 73 11 30 8 58 32 5 33 53 8 95 34 57 37 19 33 67 68 23 43 95 51 79 77 48 60 38 100 93 49 73 4 54 31 19 95 6 3 10 62 19 48 57 58 4 31 72 37 54 77 24 64 49 93 16 18 44 29 64 39 96 10 61 89 19 5 92 33 59 80 63 79 43 49 27 85 37 57 71 20 88 35 81 32 76 22 41 66 37 100 30 32 78 24 54 41 42 97 11 5 72 85 97 79 7 46 10 49 16 28 47 54 73 38 54 28 31 50 81 24 69 45 56 30 95 7 25 81 64 85 49 68 85 2 79 16 13 82 40 89 59 28 24 21 67 43 14 66 3 32 59 98 81 73 56 95 31 18 96 71 61 73 8 64 42 97 68 64 15 97 56 56 23 10 44 79 80 57 67 5 42 7 6 41 91 61 18 36 62 91 50 40 47 61 16 590\n602\n2 4 17 49 46 22 70 79 94 25 65 45 93 94 78 56 22 92 57 41 96 55 69 41 7 32 18 83 39 74 71 86 53 87 55 73 34 75 44 94 78 42 98 48 5 15 96 8 67 43 93 34 92 11 49 90 30 68 93 81 32 57 70 30 82 60 86 86 58 95 26 20 51 86 70 57 98 3 19 65 46 31 72 20 69 27 2 41 82 70 67 7 56 64 46 91 29 94 16 2 26 76 63 11 13 94 15 84 96 23 47 90 75 34 24 99 95 73 28 34 3 66 81 65 38 97 42 22 94 83 51 31 64 91 53 35 90 10 92 57 1 46 63 9 20 13 32 90 46 56 38 50 66 9 24 30 15 59 44 84 28 62 95 55 19 13 78 55 94 31 49 78 29 44 45 81 83 40 86 11 41 97 59 2 74 77 68 92 86 72 40 95 89 66 50 31 58 68 96 57 80 37 13 86 77 78 9 86 97 1 84 8 57 40 40 97 6 71 80 80 11 50 55 42 42 48 70 100 37 20 29 11 54 84 26 9 63 79 99 33 13 66 33 90 40 78 69 23 19 42 59 34 85 38 98 39 3 51 42 100 3 8 2 28 46 98 48 51 94 10 54 57 33 17 42 62 24 54 83 95 27 41 64 63 94 39 38 56 75 80 54 86 65 47 97 21 89 11 44 90 74 91 11 59 56 65 54 10 76 5 69 66 23 65 13 56 8 79 33 46 99 25 72 6 50 49 22 65 9 37 39 56 40 64 49 12 84 94 43 71 38 49 12 20 54 44 99 71 4 72 34 15 6 30 96 9 41 61 86 58 30 32 30 34 98 12 45 50 47 44 5 13 9 94 3 59 26 65 26 23 31 38 76 29 99 70 81 44 9 41 36 58 55 12 84 46 37 49 37 21 6 91 23 4 47 84 87 63 87 91 80 68 73 90 69 68 60 63 72 5 2 39 27 92 86 99 97 98 22 40 6 65 22 31 99 27 11 10 73 82 92 58 65 70 30 68 96 34 92 84 34 53 52 91 1 54 66 93 64 40 50 79 48 3 26 72 63 94 70 63 39 67 40 32 92 72 1 79 24 59 41 17 41 33 16 77 75 9 82 13 18 55 53 68 71 40 18 27 99 66 1 22 100 70 86 24 41 64 53 89 65 85 6 8 49 89 59 31 39 72 47 77 26 31 19 85 85 38 94 34 74 65 35 75 27 90 76 94 49 97 48 26 36 62 30 76 34 36 3 60 13 52 52 31 40 7 96 53 96 56 98 38 72 74 71 78 15 84 77 4 92 60 59 41 28 95 44 17 99 39 73 70 74 42 36 17 72 87 1 37 66 59 87 42 73 87 60 28 40 30 72 205\n571\n93 41 40 61 62 16 16 100 51 62 4 33 32 88 54 18 93 17 97 98 1 86 63 72 57 24 12 44 76 21 34 51 39 29 83 93 38 17 66 66 81 34 4 96 33 60 88 60 63 27 40 99 16 92 30 79 49 16 32 21 89 31 8 46 49 18 8 73 5 51 20 96 100 63 66 62 44 12 6 64 41 56 97 64 95 77 16 95 40 40 43 49 92 15 58 98 63 34 12 15 65 39 77 3 80 54 10 61 9 25 4 84 73 34 16 92 97 12 45 69 11 75 87 22 57 45 70 50 44 36 93 26 58 57 26 67 66 21 39 54 9 65 15 14 97 75 50 18 73 63 79 46 29 71 84 41 73 68 86 22 57 52 31 52 17 46 22 32 52 28 100 68 34 84 10 36 48 15 90 57 56 67 39 9 57 56 6 20 59 12 33 69 14 57 78 80 78 57 39 49 48 75 1 9 23 16 97 83 41 70 78 79 62 9 65 69 97 98 52 69 56 97 6 68 5 37 26 68 36 53 36 92 58 10 7 51 22 17 94 27 1 83 11 39 51 12 69 3 53 35 30 19 6 54 50 67 56 84 30 4 44 6 56 23 14 2 43 71 93 63 27 92 42 37 43 98 33 39 56 92 52 86 3 5 15 83 31 9 82 77 76 29 70 15 93 43 68 19 30 29 11 59 63 79 30 4 5 22 64 89 79 82 70 34 47 94 62 72 42 87 82 90 38 47 22 80 71 12 61 13 81 70 55 44 51 19 35 80 57 75 99 42 32 86 79 56 12 75 91 8 100 48 81 54 24 46 69 46 48 38 13 36 95 13 58 24 92 22 5 39 21 33 87 33 41 60 54 82 30 26 78 71 16 84 69 31 25 24 69 100 73 87 22 40 2 35 50 1 45 6 88 48 55 16 28 47 100 95 13 74 9 28 54 74 50 44 78 42 83 4 46 55 39 40 62 13 67 93 28 77 59 21 6 57 46 74 90 32 18 67 92 33 51 61 25 9 83 54 54 48 7 36 98 97 7 68 54 94 34 68 28 58 74 21 69 64 44 53 68 3 86 11 61 84 99 50 48 39 26 82 1 68 38 83 10 62 89 29 92 70 91 84 61 38 56 33 66 86 8 75 2 31 3 97 79 13 30 8 73 75 83 73 14 82 30 91 53 49 91 56 59 49 34 12 44 46 2 93 50 15 17 95 78 93 57 39 22 52 8 89 29 96 11 99 28 57 71 71 66 91 91 36 1 52 100 60 48 69 23 20 27 6 77 5 93 73 53 84 89 48 611\n408\n41 87 5 89 24 7 54 4 29 92 31 7 78 54 91 23 89 18 48 1 69 49 51 9 29 3 78 60 21 90 4 100 87 29 22 70 31 97 74 90 86 11 72 90 7 35 34 42 73 40 9 44 54 21 12 19 68 90 33 14 67 29 13 28 20 64 36 72 3 50 72 13 6 82 75 13 67 54 15 68 38 58 62 37 21 52 9 53 13 7 38 17 4 39 48 88 20 67 29 18 79 4 29 68 100 75 25 80 23 11 79 53 42 72 21 96 95 53 68 17 96 96 49 61 38 2 87 84 66 1 7 23 15 18 23 92 77 71 87 15 71 57 59 70 25 81 13 48 33 86 99 66 54 21 33 84 46 26 34 29 14 78 16 63 59 46 10 51 11 95 65 92 66 44 58 40 39 65 50 60 54 63 34 62 92 41 23 48 38 86 63 26 58 49 72 45 97 26 17 81 87 25 12 6 29 46 9 55 10 74 75 27 67 50 33 80 45 89 68 86 59 35 32 85 8 56 58 56 14 62 18 56 56 14 78 52 1 2 24 35 84 15 25 5 69 50 33 54 47 2 14 6 79 29 34 34 34 6 51 71 30 47 91 20 36 56 81 16 45 82 1 40 68 43 90 79 59 96 88 98 13 5 25 20 83 82 48 59 24 79 40 7 7 60 71 89 63 63 14 74 5 10 63 10 49 58 89 9 81 37 51 56 37 47 1 32 29 63 48 11 15 65 7 71 26 93 71 57 44 95 36 81 84 42 81 77 28 42 18 42 51 96 65 69 5 11 98 64 48 53 68 66 79 95 27 85 93 39 69 15 40 98 41 51 74 14 99 14 18 59 1 23 43 48 83 91 65 94 66 11 55 3 58 48 48 28 22 12 55 35 41 90 86 73 40 8 73 100 33 27 32 83 37 79 5 78 78 364\n587\n96 77 83 26 47 5 36 98 28 73 52 95 82 76 24 72 69 83 59 7 73 43 9 18 20 93 13 10 56 14 5 52 70 34 11 24 71 60 34 57 94 85 36 80 47 12 46 38 97 55 10 49 49 63 43 88 58 44 69 20 96 8 33 22 32 69 51 48 56 31 66 78 98 77 65 27 95 32 81 100 1 23 83 9 72 30 59 43 94 43 82 19 97 46 54 24 90 60 89 81 4 16 20 32 99 4 9 83 99 60 30 64 52 42 65 40 1 19 47 80 51 91 41 83 95 25 21 31 66 26 85 60 90 57 44 93 81 95 3 77 73 3 25 34 45 64 68 3 64 51 77 32 62 55 56 13 83 18 99 89 68 89 91 27 67 84 38 10 78 31 6 34 25 54 72 81 58 3 78 5 56 17 41 14 27 27 20 30 70 39 99 41 77 83 58 8 36 28 28 20 3 1 10 70 42 2 65 85 85 32 50 51 4 76 20 79 76 79 30 35 91 97 56 48 47 11 6 70 63 57 79 14 92 25 4 63 46 23 4 11 47 80 95 100 32 95 20 61 88 57 2 59 59 61 22 64 17 34 70 59 64 29 55 83 93 21 89 84 31 21 81 78 45 3 56 79 63 27 68 5 58 49 71 70 79 79 8 82 6 37 96 90 73 54 65 51 30 56 75 87 100 12 5 75 43 12 81 15 20 63 78 24 59 64 90 79 79 79 82 98 93 79 92 37 99 52 5 37 26 12 40 25 23 3 4 70 86 59 6 64 22 5 70 38 49 62 4 53 62 92 94 62 47 8 23 11 24 21 12 14 52 60 29 22 89 77 65 43 73 25 10 57 29 2 22 88 96 18 40 98 44 38 19 90 99 46 76 40 84 21 17 73 96 54 96 46 8 3 83 96 56 87 98 71 5 73 53 48 48 89 41 79 11 23 12 17 67 68 40 64 36 28 67 46 59 78 60 10 80 28 44 89 74 34 33 89 95 27 70 16 41 32 29 14 78 88 66 58 66 52 91 46 6 17 93 18 99 18 27 6 29 98 11 8 45 10 3 13 87 52 24 6 100 87 21 39 80 26 98 21 3 2 75 36 96 32 16 58 23 55 16 38 39 30 17 34 68 45 89 5 55 8 80 91 61 68 8 53 39 6 31 25 30 17 74 57 34 1 64 24 92 69 7 18 4 34 5 71 5 98 72 27 18 43 73 10 22 20 57 80 6 50 31 63 86 2 55 50 40 63 39 92 23 51 56 26 54 45 65 75 28 99 59 80 39 10 27 35 19 9 89 41 66 32 51 92 36 83 64 23 87 72 34 19 66 7 161\n15\n11 27 3 95 25 29 20 62 74 14 88 44 65 7 42\n320\n45 15 29 92 66 76 12 60 45 77 43 35 9 36 18 62 61 32 77 61 70 51 19 13 41 90 4 25 72 47 4 32 20 34 47 90 1 50 74 54 77 75 35 66 65 57 8 74 16 34 35 38 61 54 99 83 3 97 63 38 26 13 51 26 20 63 4 81 9 77 52 97 82 38 99 37 56 5 43 17 78 95 63 61 48 83 76 62 69 64 37 53 43 14 38 50 1 26 72 90 100 10 46 91 41 67 4 98 43 61 58 4 72 86 94 97 78 41 97 18 69 60 50 24 68 97 8 48 93 75 15 89 57 70 12 61 36 7 19 68 96 87 35 82 80 49 58 45 40 88 31 68 57 1 36 82 92 41 49 96 90 77 22 53 94 73 91 25 84 75 6 95 19 89 51 59 28 15 11 52 11 82 83 93 96 24 47 1 9 21 5 64 19 39 51 59 52 53 30 44 78 28 91 13 98 31 77 68 96 35 4 92 43 12 68 61 43 86 93 72 19 95 19 84 35 24 41 90 95 41 23 40 11 27 86 82 89 59 85 4 13 84 100 53 29 84 36 29 80 56 7 8 70 23 26 73 71 94 62 27 66 43 8 5 42 67 3 41 56 71 80 41 98 2 10 59 74 32 45 57 12 88 58 50 35 12 63 30 81 3 61 34 33 36 27 87 80 73 19 92 41 73 52 74 86 95 73 47 10 93 46 59 31 30 89 55 49 15 91 941\n511\n65 64 45 75 13 43 36 67 92 63 56 53 22 55 3 75 25 12 16 76 33 53 46 34 3 37 83 91 12 83 44 2 54 100 23 90 78 26 61 69 13 8 82 51 69 75 34 47 98 98 45 51 37 18 86 84 50 32 61 12 50 42 61 66 68 24 16 62 34 62 45 65 35 95 8 100 14 68 36 25 30 85 43 52 53 75 16 20 44 13 100 53 39 74 78 52 78 73 2 49 70 5 26 46 32 61 32 75 6 66 12 77 17 3 93 55 38 71 74 78 66 35 7 19 84 58 66 18 58 32 5 20 37 35 73 11 90 86 42 51 76 78 42 52 75 73 39 31 83 18 31 92 87 68 56 37 89 76 25 52 72 48 8 2 22 57 83 79 30 88 1 64 31 94 17 87 24 54 63 33 62 24 43 61 79 33 27 33 6 48 52 92 100 38 75 19 22 47 55 11 50 92 21 17 46 22 29 17 14 44 41 54 7 50 32 46 6 37 28 79 26 37 88 54 86 50 92 10 4 92 9 44 93 40 88 13 56 10 12 78 95 36 40 40 50 45 92 31 27 21 88 29 28 53 41 38 85 1 63 8 15 38 67 76 59 82 20 42 89 40 28 24 51 38 38 45 23 55 36 62 62 62 25 1 6 78 92 17 82 70 98 43 79 86 32 73 22 12 8 5 41 7 2 37 79 45 85 13 40 61 22 10 95 32 87 5 82 79 35 11 10 33 24 31 97 56 18 35 94 100 60 17 82 66 19 8 95 25 15 58 59 49 42 35 85 51 11 83 50 17 49 94 47 52 10 7 73 4 33 48 89 40 64 15 13 26 10 48 11 74 61 28 22 3 49 76 80 48 93 74 38 49 52 69 65 21 5 83 31 32 49 87 43 71 5 67 96 27 35 75 62 55 63 8 62 1 86 24 75 100 20 5 24 43 51 19 61 87 43 25 12 93 17 76 14 15 13 68 5 36 15 41 22 21 7 23 30 79 30 59 89 2 53 93 85 77 14 46 16 36 96 28 61 49 68 81 95 78 56 84 51 24 9 81 64 72 18 64 14 41 4 84 98 36 17 9 9 30 96 97 44 72 48 13 29 55 35 95 81 53 92 2 56 95 37 52 7 86 42 30 39 34 52 66 89 26 9 94 54 75 815\n467\n89 88 74 5 36 82 77 49 18 60 58 58 89 18 6 55 94 32 2 52 34 87 9 95 90 35 11 2 30 2 6 41 26 98 87 84 56 9 38 98 87 45 76 86 80 48 47 100 3 83 73 82 90 70 50 63 5 17 53 7 65 33 42 38 16 20 35 90 96 15 57 82 53 6 64 65 27 65 82 1 40 63 38 99 95 9 57 24 60 34 21 7 51 80 33 2 69 59 55 6 79 37 67 53 7 6 46 20 20 7 61 57 7 3 85 22 91 78 62 16 31 71 47 38 38 100 1 51 21 94 29 88 50 79 11 100 71 31 19 57 69 70 22 44 2 69 20 73 80 97 94 97 99 11 40 37 87 49 26 25 96 77 77 65 99 38 38 58 42 6 82 48 9 67 30 94 98 62 64 71 87 9 26 51 54 81 59 49 61 84 23 2 73 65 6 18 53 17 51 22 90 34 33 15 34 75 58 68 78 18 76 63 20 76 77 82 54 3 22 19 97 7 97 93 45 76 43 2 33 51 7 86 4 82 16 39 88 75 79 99 72 17 20 15 4 56 18 47 19 57 78 54 82 40 4 84 68 75 94 49 68 5 34 44 95 72 49 32 17 88 65 91 98 32 55 33 3 35 5 64 38 44 11 9 86 24 100 26 49 8 10 62 95 86 93 40 53 80 35 56 38 17 28 31 98 79 9 40 58 54 46 40 42 45 51 5 7 77 47 42 56 70 14 84 5 77 70 50 21 63 75 71 33 43 12 15 32 8 98 37 6 72 21 63 41 78 42 52 77 62 33 53 71 83 25 49 41 16 77 81 57 65 14 13 16 84 59 70 19 52 28 15 86 12 79 88 15 99 17 27 17 50 82 91 53 65 85 78 47 44 4 52 42 11 24 91 46 54 53 91 54 9 7 81 5 22 14 57 89 9 88 49 68 49 94 68 97 37 59 20 53 24 48 82 41 67 23 67 65 38 3 49 27 76 26 25 42 16 83 20 78 35 61 19 59 80 43 85 3 92 54 36 15 38 85 35 83 96 82 24 82 83 58 26 28 90 475\n707\n93 54 46 69 48 91 94 58 76 27 60 29 57 50 57 24 8 25 36 73 58 3 33 4 91 22 38 21 74 48 37 79 65 46 9 69 91 42 42 82 43 50 19 39 55 21 73 13 90 48 33 19 91 82 98 54 35 21 58 39 82 21 4 31 13 61 18 74 86 18 74 78 59 45 43 9 58 7 5 98 78 77 6 14 12 26 64 58 70 89 80 70 38 16 79 49 89 93 80 43 36 87 4 41 57 72 96 87 48 91 8 79 88 97 63 96 70 83 39 13 77 16 94 16 39 6 98 48 78 11 43 25 58 77 46 20 28 55 89 83 94 49 60 94 91 29 61 81 89 71 63 56 32 47 58 81 16 36 75 38 87 83 22 68 21 28 11 54 6 95 60 2 36 81 85 85 53 32 16 9 76 21 26 98 91 51 96 2 59 98 67 53 6 19 80 18 51 1 15 50 73 56 48 63 77 6 54 7 89 48 19 89 45 95 67 28 35 76 80 21 32 42 76 58 8 3 54 96 27 13 51 60 10 50 1 6 95 16 75 72 8 75 92 69 22 99 56 2 14 91 42 50 19 80 40 80 73 84 13 23 78 40 29 47 43 77 11 26 1 31 55 46 56 50 54 69 78 86 46 90 76 25 19 29 73 70 87 14 6 29 10 48 21 36 65 52 44 59 88 43 40 61 93 32 65 15 82 76 38 79 49 59 35 44 8 68 91 41 69 5 66 16 35 68 100 71 21 14 39 69 69 71 57 76 72 87 91 55 61 76 3 50 91 39 62 67 57 43 11 22 54 42 93 79 53 31 32 73 53 82 29 90 84 52 94 20 47 46 94 87 75 26 68 51 90 83 91 85 21 21 65 45 52 19 38 20 41 93 100 27 29 87 44 61 50 38 44 99 42 22 14 30 3 100 17 81 12 52 44 44 39 99 44 76 59 28 55 6 49 83 36 35 34 54 25 14 21 79 73 19 31 52 78 73 35 36 18 12 96 35 36 90 24 28 27 86 52 48 49 80 6 97 65 90 58 61 9 8 77 13 49 60 70 28 30 5 93 83 27 87 64 89 23 88 39 81 31 96 15 58 84 58 48 26 54 45 30 14 22 14 99 78 43 47 15 63 5 54 3 32 77 85 27 94 35 23 57 22 90 17 79 34 82 61 59 83 74 35 49 17 3 2 10 72 75 47 79 53 26 33 90 47 71 64 5 25 55 18 24 3 58 85 51 91 96 39 74 99 36 10 74 2 44 91 6 63 99 63 56 67 90 3 85 34 27 3 11 44 78 45 69 100 53 58 22 44 72 42 2 28 74 88 27 38 83 25 90 84 66 22 57 49 96 17 18 78 29 53 45 90 46 50 32 57 78 90 54 70 11 45 98 82 83 14 32 32 17 3 72 89 75 43 60 15 8 5 60 35 92 71 85 97 57 96 100 99 89 49 79 16 78 4 19 28 39 23 27 17 75 59 27 44 36 37 53 11 14 37 23 11 58 89 61 49 55 93 1 30 54 69 96 65 8 23 26 67 97 4 22 50 79 44 42 24 81 91 41 14 95 71 36 3 59 68 64 67 14 50 42 3 92 36 88 29 40 88 428\n592\n23 66 32 83 14 11 56 70 11 83 66 42 86 39 4 67 78 13 60 100 26 73 83 31 86 31 70 44 63 42 60 3 72 27 60 92 68 14 63 56 20 25 93 16 12 1 23 36 89 15 46 60 95 26 41 34 16 73 33 40 31 65 46 56 96 56 91 46 19 77 74 33 59 73 56 95 8 21 8 24 24 39 16 53 45 62 13 99 68 3 76 47 83 4 62 38 27 11 10 73 62 62 58 97 22 29 61 76 44 3 44 33 14 26 44 16 57 40 46 9 67 66 22 96 42 88 78 73 71 1 59 85 27 37 39 27 15 46 65 89 81 20 49 14 11 66 45 8 63 46 52 35 99 36 13 58 30 24 7 98 63 7 67 16 89 86 83 37 92 37 36 18 43 98 57 5 33 52 34 75 31 28 69 31 50 9 10 86 94 51 90 57 83 74 47 15 26 53 35 29 57 84 85 52 49 96 57 6 30 6 37 12 34 15 90 65 70 31 22 78 39 76 59 18 98 50 41 10 88 12 29 56 50 32 41 7 5 44 58 64 43 60 69 84 29 7 78 86 43 96 66 76 66 47 37 87 4 57 59 78 33 58 97 31 37 64 96 58 27 62 46 51 75 12 75 52 80 38 44 4 6 95 6 23 95 83 57 46 32 30 46 22 1 23 89 34 17 42 54 25 87 50 33 35 22 38 78 62 77 15 81 100 81 86 31 30 22 14 21 36 83 66 93 12 69 95 26 38 1 92 50 65 71 37 74 75 80 70 18 10 53 98 74 34 29 70 91 46 81 78 90 12 45 86 66 69 30 62 99 63 58 21 67 44 20 92 89 52 18 26 38 1 58 8 17 5 19 78 5 25 52 77 98 6 79 1 77 30 15 32 14 11 76 19 66 56 81 12 97 93 38 60 30 35 40 97 36 32 92 31 54 75 4 58 39 90 33 7 51 3 8 58 55 14 96 48 94 21 93 78 15 67 79 7 55 21 75 2 14 44 23 76 76 95 89 9 12 79 32 52 62 33 7 37 6 80 92 29 96 94 23 42 22 14 55 15 95 6 59 50 51 91 34 52 77 9 35 24 16 98 72 51 47 62 2 47 87 26 22 86 27 40 31 10 52 28 24 97 86 74 34 21 53 66 96 81 94 54 84 71 84 94 71 40 69 23 51 45 92 39 43 9 18 41 86 96 82 67 37 75 78 99 49 96 59 42 100 67 92 30 58 68 46 48 90 14 23 78 14 94 44 91 15 37 8 100 35 12 60 65 52 23 65 42 86 8 73 59 4 69 83 11 61 29 1 46 99 82 34 32 4 30 68 95 75 72 95 6 80 17 50 820\n473\n15 7 91 36 20 47 52 45 47 85 21 94 69 15 89 9 3 44 77 42 68 61 80 63 3 45 26 73 10 78 6 62 16 34 94 8 61 53 16 41 8 88 75 68 99 1 12 85 14 70 46 20 65 82 1 99 92 37 22 53 39 40 93 85 81 12 78 97 71 42 55 78 40 67 73 30 80 36 79 72 19 72 49 39 8 27 74 21 56 72 69 15 20 13 92 12 46 50 71 87 73 34 23 13 25 61 55 85 28 99 89 63 35 30 11 75 2 23 9 55 56 37 37 98 11 30 28 69 1 93 14 51 91 23 1 18 70 20 42 83 100 97 45 89 3 45 92 16 71 59 10 4 17 55 19 30 74 67 52 80 4 83 77 81 71 78 8 41 40 100 57 23 71 19 26 63 92 80 4 53 84 17 88 92 19 53 89 27 45 65 17 46 68 41 39 17 10 39 29 43 26 33 12 74 47 90 3 15 64 1 69 50 25 63 11 81 9 64 32 11 89 42 88 6 59 97 88 37 54 28 28 98 83 54 2 18 13 29 43 99 99 36 65 52 36 52 71 21 88 48 4 53 92 28 90 88 49 68 16 58 69 57 76 100 3 23 3 25 92 90 65 47 72 42 36 4 44 68 76 85 40 63 56 88 53 22 61 20 20 83 97 92 43 43 4 3 95 65 82 67 61 100 53 47 63 15 77 73 20 56 49 25 88 83 87 53 56 44 40 54 35 49 83 29 59 24 60 77 49 23 53 68 22 56 64 73 74 39 44 47 3 76 92 19 76 90 87 77 90 92 3 69 94 51 61 33 71 97 29 100 66 31 42 26 75 9 76 32 57 57 62 91 71 2 44 62 87 63 55 16 11 57 87 46 96 39 43 83 10 74 75 86 53 33 38 30 19 96 100 85 42 5 21 1 8 87 42 76 17 2 69 92 98 69 66 14 38 90 53 28 34 70 37 72 34 2 62 82 75 25 26 35 22 10 19 8 43 80 23 27 88 70 57 99 69 86 100 53 9 61 3 94 69 92 33 17 32 74 63 55 17 75 76 55 60 38 74 11 99 31 75 6 573\n783\n55 14 40 46 59 36 99 90 63 53 44 28 81 34 13 65 3 34 54 32 29 73 79 69 74 71 50 12 99 1 2 28 98 74 41 51 9 23 58 40 70 1 69 34 3 15 35 44 7 27 48 47 81 5 63 7 5 19 47 19 10 34 30 25 36 24 8 29 86 52 96 71 72 10 87 4 48 96 3 47 24 74 23 20 67 84 82 68 48 83 28 48 30 58 59 6 46 76 92 66 12 50 86 97 100 47 2 40 15 68 4 2 26 75 61 27 8 58 26 73 37 8 74 2 23 63 67 19 84 50 68 5 81 93 59 98 78 80 67 18 67 23 98 45 12 11 30 72 51 21 4 72 59 68 49 54 40 91 11 62 64 41 74 83 1 32 22 80 64 83 2 41 14 7 75 70 92 71 29 1 37 28 19 87 56 35 41 58 89 73 74 79 96 40 70 57 57 7 57 86 39 57 28 43 81 61 8 83 77 83 45 6 62 40 100 36 27 67 87 39 22 84 70 69 94 74 17 55 70 77 60 35 97 17 75 47 38 39 100 36 8 36 83 10 76 18 89 60 58 17 17 52 48 77 30 44 64 10 37 78 3 35 26 98 25 9 28 25 71 49 80 87 91 32 11 49 99 58 96 7 87 94 35 71 21 54 58 63 34 44 94 52 58 67 88 6 92 66 50 36 35 2 100 20 47 23 90 18 36 2 62 29 55 20 24 49 3 81 44 58 58 93 82 62 52 28 27 56 19 19 35 76 5 99 71 11 2 20 66 96 7 70 16 5 21 99 81 59 86 13 58 10 68 80 15 14 34 44 37 45 50 75 67 95 75 52 26 9 56 22 74 52 37 91 14 41 71 95 45 51 97 88 38 93 60 94 29 86 4 97 13 78 65 82 67 32 66 27 81 79 52 39 42 96 48 41 8 56 44 2 20 66 85 47 78 50 91 40 61 78 45 10 10 14 52 67 13 30 73 73 69 85 3 93 17 45 100 41 67 22 32 32 16 22 6 17 29 43 84 44 92 51 10 97 65 78 11 60 34 43 54 54 32 7 67 99 6 88 85 4 34 83 56 28 63 41 16 42 3 9 50 86 93 5 2 63 92 55 87 99 40 70 22 85 41 98 18 6 46 22 1 36 100 31 56 52 33 19 19 98 82 46 65 46 15 27 48 54 26 21 51 35 64 57 14 60 87 55 38 23 51 53 83 38 71 66 55 62 39 30 98 66 19 49 42 96 42 88 53 31 100 85 42 72 89 37 97 15 91 9 17 27 50 86 77 45 59 22 86 46 17 6 3 84 15 5 46 73 44 89 44 8 32 42 65 92 30 50 54 46 29 59 51 60 41 94 35 3 86 4 20 31 65 22 65 55 18 66 60 45 36 86 23 34 83 55 16 22 62 9 25 85 31 91 72 71 93 96 11 73 57 20 99 25 33 28 30 19 24 57 63 34 86 77 36 18 36 100 32 24 51 86 92 22 92 43 90 50 95 93 18 62 96 4 78 4 10 59 67 36 85 65 64 18 71 30 35 81 75 20 75 71 48 91 22 2 70 82 66 62 57 100 90 25 55 18 97 96 65 33 7 42 99 3 50 14 77 58 20 3 37 56 7 49 86 100 96 81 7 10 58 21 36 47 61 17 57 74 85 32 67 7 18 72 25 1 4 11 72 91 22 69 47 12 91 46 61 24 47 59 73 56 97 93 86 2 96 20 27 7 5 33 84 23 79 68 96 34 78 9 48 77 29 40 49 90 53 98 85 55 42 29 590\n159\n80 12 22 94 72 43 42 86 57 72 2 13 12 81 94 57 21 20 80 84 41 4 92 78 91 85 9 82 100 28 82 38 29 27 50 86 34 69 46 92 64 87 79 77 78 72 70 56 77 35 20 96 100 7 65 47 82 75 27 15 12 23 88 64 97 91 21 23 66 14 44 8 73 44 82 7 37 53 46 44 89 9 45 21 44 14 12 63 6 85 49 94 23 95 17 79 34 26 84 11 12 5 20 13 46 42 37 7 74 84 73 45 36 5 34 69 62 20 96 76 67 26 26 32 4 78 1 2 93 77 69 74 74 37 13 46 97 41 7 67 60 54 85 23 73 14 90 33 59 34 14 33 19 21 39 54 54 46 172\n643\n93 33 54 31 71 73 45 98 52 36 13 86 38 99 62 39 65 72 26 13 53 47 13 92 40 14 19 99 43 60 97 35 88 43 18 97 42 18 23 47 89 8 38 45 56 64 10 46 17 71 53 38 12 49 28 27 75 12 4 2 13 63 15 61 52 61 3 33 87 91 56 71 67 20 93 100 51 28 54 79 16 76 19 95 37 12 5 86 49 51 74 71 53 51 67 71 43 99 59 51 12 17 1 61 29 21 11 67 73 6 96 20 22 78 43 17 10 20 64 31 78 96 54 17 65 51 60 11 61 66 85 60 69 47 72 33 46 71 3 41 36 76 70 10 43 26 97 69 40 93 66 61 83 21 59 83 35 40 72 30 27 14 100 11 78 91 57 38 93 34 31 38 31 8 91 7 15 89 20 56 83 50 61 97 57 12 16 72 35 61 45 57 50 49 67 6 36 8 26 25 94 43 98 99 13 43 64 23 96 20 68 37 94 59 56 54 93 45 20 23 51 6 33 77 61 91 25 7 97 95 58 44 2 52 46 98 63 11 9 72 4 65 91 86 71 16 99 55 55 42 82 18 75 61 70 92 15 100 78 55 100 58 33 66 85 93 50 81 43 78 18 51 67 1 29 18 12 23 33 22 23 81 51 45 34 93 88 68 71 73 85 86 24 61 73 29 11 70 89 53 59 64 22 28 70 3 37 4 24 65 93 26 21 99 83 44 29 55 25 88 32 69 92 14 65 60 89 44 82 8 91 100 64 17 50 67 74 14 23 30 33 56 69 49 18 57 82 100 25 77 65 9 60 4 20 18 37 73 50 18 79 26 88 52 4 29 64 43 89 47 100 11 62 58 2 50 44 88 53 67 63 35 33 10 62 90 42 55 45 9 57 55 26 42 8 34 48 4 42 50 76 54 47 17 10 62 97 75 26 34 76 78 73 95 38 40 72 98 18 99 87 33 93 56 40 30 99 18 50 90 23 7 69 13 8 30 70 24 44 94 59 29 36 13 55 7 31 67 28 33 85 44 23 86 91 61 37 15 24 22 97 100 58 56 25 68 12 76 69 90 7 1 100 32 73 39 78 27 9 57 9 12 17 85 6 17 67 75 31 37 53 18 6 77 62 53 10 51 28 9 89 62 4 52 8 68 41 9 80 19 6 79 82 73 49 92 87 87 40 25 72 40 11 44 60 71 21 94 85 20 78 14 7 47 69 35 86 3 64 7 73 53 88 81 19 3 29 92 1 37 46 20 11 33 3 75 79 11 3 51 78 29 40 71 37 71 5 33 35 16 56 69 25 9 96 82 76 2 63 27 67 10 84 29 31 76 87 3 24 19 36 9 35 41 52 36 29 66 47 51 17 59 24 84 94 22 83 45 51 17 73 6 8 13 31 77 23 85 7 44 86 20 13 10 23 20 72 99 59 11 16 22 27 42 47 2 62 43 10 11 3 62 130\n142\n59 26 21 93 9 88 50 77 26 6 41 88 21 53 17 57 34 70 55 91 26 73 58 69 25 8 44 3 79 22 49 97 61 26 89 54 1 89 56 51 81 8 23 25 20 62 37 57 26 55 75 68 24 17 88 64 84 19 65 14 67 89 11 25 74 16 18 97 40 63 82 17 48 57 27 38 12 81 78 55 7 55 12 98 39 82 20 17 42 48 92 99 55 12 49 16 37 65 39 8 51 72 52 28 73 48 87 11 41 63 78 47 12 71 47 17 93 93 88 27 73 11 60 68 27 20 48 84 62 89 97 17 48 37 97 9 91 71 5 6 56 91\n250\n63 81 13 87 60 99 77 34 65 86 80 57 40 47 89 57 63 63 48 60 64 42 58 76 68 96 25 96 20 72 59 59 72 96 9 15 6 46 1 99 62 63 57 21 18 98 61 46 52 42 47 77 4 72 90 22 64 85 52 36 83 54 37 87 1 17 15 52 97 48 4 42 21 26 41 47 15 59 53 56 18 81 39 88 79 42 86 66 78 41 87 89 81 35 71 44 76 8 12 92 31 27 82 23 16 12 75 12 83 37 78 87 87 65 36 14 34 8 54 3 12 57 70 79 81 59 57 48 69 95 29 51 64 54 20 93 19 94 35 88 43 29 77 50 10 85 52 31 39 91 90 57 66 27 95 9 13 25 16 92 38 80 10 14 95 80 75 72 22 47 16 24 15 98 39 53 65 78 68 20 28 20 97 35 30 47 43 35 62 61 51 18 68 68 78 23 2 73 95 79 36 22 24 39 92 41 3 25 95 93 29 54 6 37 27 75 97 33 47 84 74 22 66 58 46 18 96 97 67 88 79 21 44 41 56 32 44 100 71 11 1 54 2 83 44 61 44 33 8 706\n354\n37 11 75 89 98 47 73 85 75 42 31 68 80 1 54 2 72 99 48 55 62 19 74 85 88 73 21 85 45 16 73 18 63 42 86 10 80 6 14 77 5 80 71 88 26 59 52 49 62 7 79 83 98 95 25 64 66 48 61 51 60 79 3 88 67 10 6 66 75 75 20 97 58 95 57 98 60 1 42 63 12 71 90 12 71 40 44 33 68 25 92 55 44 92 46 28 78 41 87 33 6 23 79 5 71 83 97 24 17 42 67 24 36 90 17 12 17 75 92 87 55 52 26 81 22 4 62 77 32 89 85 71 23 59 49 63 4 12 60 70 3 53 69 33 32 30 70 72 25 24 79 70 75 6 37 100 64 47 63 8 67 95 69 45 37 72 26 53 63 90 60 96 1 38 44 94 78 26 80 5 76 19 87 56 100 18 46 20 32 48 50 32 7 43 86 92 83 16 30 18 57 37 61 63 58 55 94 22 38 42 55 99 61 92 9 62 27 24 55 13 98 5 84 85 2 36 89 91 38 74 48 10 2 65 26 75 70 96 45 41 27 81 41 71 31 18 65 97 27 74 38 20 32 7 39 36 47 73 20 29 17 90 85 31 45 18 18 68 62 51 88 1 91 56 33 30 36 40 10 48 66 9 69 50 18 71 88 38 27 73 57 35 55 49 59 6 58 96 99 14 60 62 14 30 73 27 52 21 86 41 94 52 18 92 27 78 26 63 93 97 74 93 97 22 33 52 45 20 55 15 39 62 50 93 51 56 72 3 73 90 41 76 14 73 77 53 80 53 15 46 29 27 85 679\n548\n26 7 32 55 76 55 60 11 95 70 18 95 80 92 23 53 40 40 73 74 36 69 72 89 6 12 27 13 8 89 77 15 56 25 34 91 10 39 77 41 48 71 31 93 85 11 23 45 45 55 76 3 76 2 28 72 20 72 95 31 87 53 64 87 26 88 33 73 87 100 78 30 91 5 77 15 96 7 50 91 72 51 58 55 49 39 86 95 39 100 3 34 57 56 59 45 80 56 2 12 63 26 17 18 30 32 73 36 24 28 23 6 85 41 50 26 98 76 98 85 73 61 57 7 100 22 92 35 3 49 83 57 79 39 60 36 82 91 52 49 13 35 77 63 98 26 15 63 31 83 4 30 99 73 29 33 5 91 2 70 55 79 4 37 58 69 70 42 95 62 15 63 16 74 70 95 74 85 50 74 92 72 45 51 97 92 52 77 21 84 53 82 27 56 73 12 57 59 2 4 97 44 28 7 37 49 47 42 3 32 61 93 52 43 69 72 88 44 64 83 46 14 29 88 55 88 29 23 59 60 69 93 34 19 81 9 62 47 78 18 76 88 82 96 91 99 79 42 33 67 84 70 26 83 5 45 85 35 66 69 16 73 93 40 100 2 50 26 27 42 23 88 72 48 66 8 7 20 20 86 28 95 90 1 32 17 17 90 41 15 62 100 67 38 40 36 89 29 91 39 39 5 23 89 32 73 24 24 19 77 20 53 71 61 11 49 67 59 34 39 52 97 98 7 38 28 44 6 34 68 57 34 69 34 18 72 100 25 35 81 8 34 62 4 20 38 36 22 73 84 84 75 75 93 30 95 53 34 34 79 66 93 21 36 23 67 46 46 67 74 8 14 7 32 61 2 90 22 50 49 82 19 46 86 29 93 58 81 28 55 36 54 92 95 65 78 25 100 45 27 19 81 95 89 97 99 87 14 8 79 88 84 7 44 94 51 12 2 30 86 13 88 15 88 1 13 2 77 80 49 2 73 47 41 49 70 27 55 66 89 93 35 12 74 44 3 70 92 13 69 46 4 80 97 43 24 12 14 79 31 7 58 1 27 64 38 5 49 36 98 33 69 1 77 20 40 54 1 95 80 42 73 49 38 52 9 86 79 31 16 60 100 5 14 26 22 61 17 66 92 38 26 24 81 91 74 72 59 83 83 73 40 59 90 96 12 42 97 73 33 14 97 28 56 23 11 88 84 12 99 6 11 64 38 25 27 8 53 15 5 40 57 79 85 50 75 60 126\n25\n13 9 99 11 6 9 100 50 15 3 59 84 50 6 37 29 26 78 24 53 13 69 8 17 270\n149\n30 81 8 55 31 93 86 84 82 10 2 17 64 89 13 28 80 39 10 71 97 87 71 19 3 92 36 65 17 20 51 96 54 23 2 13 19 43 54 67 39 38 39 29 64 60 60 67 49 36 70 43 97 18 17 33 27 89 74 87 50 72 92 96 84 22 69 72 93 44 21 34 47 32 36 96 77 30 63 85 77 98 96 12 68 1 20 41 21 35 54 68 45 95 26 91 1 48 58 45 58 31 32 88 13 61 77 12 1 67 98 97 34 99 57 80 6 27 85 4 59 14 8 50 4 95 11 34 12 26 12 4 69 53 33 19 56 48 75 17 33 12 15 85 11 58 50 10 485\n427\n18 61 64 51 93 18 36 66 81 84 47 96 16 47 46 15 27 83 85 94 63 12 56 88 91 92 25 11 65 77 45 63 63 80 77 34 11 78 100 87 98 27 64 100 30 54 24 5 47 43 87 84 11 25 89 19 14 75 24 68 52 54 39 35 73 55 92 82 52 78 77 42 67 34 99 15 100 33 28 22 33 61 9 87 97 32 7 79 53 53 66 22 52 84 67 66 40 91 18 50 62 44 73 39 30 36 65 88 62 19 39 22 50 96 46 90 99 24 90 22 99 35 73 37 6 18 94 32 14 42 6 98 3 62 11 86 79 19 2 70 56 97 20 11 56 63 15 13 90 86 87 56 59 10 78 74 48 44 88 60 57 45 81 41 10 2 64 47 68 76 74 56 25 52 28 41 76 83 18 34 93 23 46 68 38 5 88 19 23 43 105 79 5 1 10 48 72 16 93 82 57 32 60 84 32 83 31 62 66 18 99 56 73 39 90 5 1 36 43 34 75 48 82 64 64 85 51 46 58 95 43 65 66 41 30 13 99 79 16 94 6 48 98 63 25 25 44 51 13 39 26 70 4 57 68 12 39 53 11 79 59 56 53 100 99 9 36 78 32 21 59 65 76 91 31 66 98 47 84 90 90 42 89 88 90 28 32 26 63 80 88 5 12 77 26 9 84 17 21 32 2 94 39 66 50 35 34 67 87 89 81 84 88 24 81 17 12 91 69 29 50 67 39 15 40 29 75 3 34 41 83 80 15 68 51 11 81 25 99 100 67 1 49 78 30 2 56 50 64 99 4 22 53 45 95 61 22 7 31 52 68 3 54 41 42 50 11 71 91 66 60 75 51 60 74 100 73 56 35 56 32 15 10 15 17 90 92 6 56 91 31 93 75 65 67 2 57 91 69 71 13 84 82 22 50 5 87 75 87 38 17 13 32 13 76 22 89 7 55 83 91 8 68 16 33 91 530\n99\n3 78 7 60 57 10 23 30 2 21 100 39 49 19 52 35 14 20 85 50 47 51 63 59 95 95 44 34 9 96 29 57 94 6 27 49 26 15 56 17 55 77 41 13 63 5 22 98 6 13 1 74 14 75 8 58 48 17 99 7 29 14 90 70 96 93 88 53 55 47 21 19 65 61 17 77 28 71 15 75 41 81 18 49 88 78 79 37 73 54 71 99 52 84 29 91 31 24 555\n",
"4\n0\n1 1\n4\n1 1 6 4\n4\n2 4 11 0\n3\n1 3 3\n\nSAMPLE\n",
"30\n441\n55 33 26 69 20 22 70 84 82 74 32 41 12 39 55 87 37 46 89 55 85 52 48 73 27 50 21 76 11 93 49 84 56 59 83 86 36 91 77 84 42 85 9 100 23 1 83 15 24 36 11 49 91 40 87 99 31 49 33 86 11 35 83 69 21 88 69 54 81 4 29 90 36 16 85 59 74 27 92 31 30 93 62 95 50 21 47 41 87 44 21 68 33 39 7 22 36 88 25 42 48 40 8 47 83 62 91 34 43 73 81 72 53 91 7 86 52 12 94 100 95 21 33 69 93 79 53 75 67 35 43 70 57 13 1 98 5 15 15 84 88 34 56 14 74 9 71 87 3 91 62 58 72 65 91 83 21 45 35 47 91 24 83 94 75 55 28 83 77 92 80 86 80 8 53 49 11 22 66 25 98 71 71 40 81 30 90 60 41 72 81 97 79 51 59 55 23 30 36 10 51 84 54 69 9 20 17 37 27 99 9 32 59 27 93 3 75 64 40 7 25 75 25 39 57 22 24 19 57 16 48 41 62 90 19 86 74 19 80 99 8 72 27 19 41 5 91 82 96 51 25 26 97 69 4 86 54 80 23 93 34 19 24 87 98 68 97 84 95 16 96 64 22 1 94 87 76 91 66 11 85 68 73 69 79 37 36 35 40 46 34 4 54 11 12 51 12 87 41 17 100 7 67 18 51 54 23 18 72 32 68 92 9 86 99 39 74 18 74 18 17 47 80 66 41 59 84 92 78 1 92 68 32 99 7 90 30 61 20 46 53 54 96 39 27 46 77 17 84 35 24 66 41 50 38 45 99 58 87 20 21 20 74 33 45 67 71 42 44 67 56 25 33 74 65 69 46 36 95 66 96 12 27 12 56 91 60 10 70 79 97 90 66 52 79 60 89 53 31 43 9 11 19 82 30 37 15 14 93 59 93 49 63 60 86 2 15 2 87 63 79 24 97 26 24 47 8 10 63 51 64 23 35 48 5 53 52 20 86 97 295\n586\n68 58 39 57 44 64 45 50 10 55 93 37 37 92 89 74 36 22 50 17 15 21 2 88 21 44 18 20 1 67 98 17 50 30 61 20 9 48 64 90 31 100 83 36 16 83 63 2 28 49 71 61 36 95 63 21 86 96 4 32 80 57 9 80 61 41 95 68 42 28 44 100 85 20 23 63 100 71 58 32 92 37 86 17 28 13 80 59 2 11 73 33 17 74 43 14 100 1 47 58 27 91 80 33 67 96 53 82 14 65 88 4 66 5 10 90 81 66 68 73 71 72 30 82 61 45 100 32 82 99 7 2 25 35 7 63 91 72 4 50 56 19 7 49 35 41 29 74 56 61 80 52 78 96 21 8 44 65 100 87 100 49 79 19 30 80 97 9 84 85 2 29 0 57 34 88 45 79 16 38 15 99 39 58 93 64 65 58 89 28 35 78 66 71 18 8 42 62 57 20 79 22 35 32 89 66 96 97 81 41 99 97 5 73 54 88 79 65 30 5 88 82 11 70 4 38 36 56 78 75 80 73 46 7 70 20 32 3 4 83 34 78 34 12 75 38 9 63 81 34 53 65 28 59 19 93 78 66 61 22 29 10 54 13 94 43 84 58 79 83 65 53 31 28 20 100 79 74 20 35 46 72 71 74 36 73 46 77 76 91 43 88 24 61 64 65 9 10 81 29 72 73 65 72 47 11 77 40 40 14 65 43 66 15 55 25 19 76 56 27 49 64 99 71 8 18 96 82 32 35 66 33 57 22 46 98 67 70 67 14 97 9 48 19 23 22 24 6 3 13 10 19 73 27 51 8 58 84 20 13 90 46 90 26 25 51 98 38 4 3 91 63 10 64 40 36 24 82 47 12 88 27 87 60 21 38 41 4 45 82 13 20 66 81 39 15 37 80 58 62 40 82 86 51 10 88 4 61 61 3 5 3 58 80 74 23 72 38 58 66 60 33 6 87 31 48 84 72 2 78 71 32 14 6 63 40 3 61 80 82 43 56 50 12 77 78 29 78 35 58 43 9 84 8 58 53 94 59 69 96 36 5 58 99 97 21 21 69 59 63 37 40 84 12 61 19 52 19 59 68 45 16 26 45 38 86 41 59 55 19 66 54 16 34 19 52 12 88 99 19 50 34 44 76 10 74 62 74 95 19 41 17 52 61 71 82 83 24 29 94 50 50 38 58 50 43 22 42 11 17 94 56 24 81 2 94 89 48 63 89 2 13 78 98 6 20 26 41 65 54 7 18 26 83 13 28 49 99 76 80 85 47 78 20 61 31 100 86 70 43 7 35 24 17 23 34 62 25 67 79 7 58 32 88 61 266\n487\n95 64 69 7 95 52 90 8 94 36 72 23 99 74 11 84 41 22 31 22 39 99 63 19 53 66 75 3 12 29 19 53 90 13 9 79 7 9 17 43 76 72 66 29 63 15 40 18 32 93 97 25 85 70 94 48 2 11 61 65 19 81 35 63 25 100 5 33 32 82 45 20 55 100 9 2 38 50 81 5 49 79 65 23 97 28 23 35 78 51 98 85 100 22 33 93 56 81 23 59 55 30 27 50 10 55 73 25 53 21 98 40 19 40 57 83 40 73 29 96 38 66 40 84 55 57 19 17 17 68 33 24 38 10 95 86 19 16 92 5 14 71 57 92 19 40 49 5 79 81 53 98 40 74 61 25 41 87 83 19 100 12 65 96 78 53 6 39 18 3 32 96 82 85 97 79 56 36 68 28 19 60 13 60 62 91 22 42 93 46 29 36 14 38 80 35 89 16 20 39 70 29 45 49 86 31 17 5 73 43 78 51 17 40 20 47 7 6 67 87 48 17 98 62 79 12 24 23 16 52 72 18 87 64 28 18 88 22 58 50 90 10 44 89 12 65 20 86 44 7 95 18 63 72 59 7 33 89 65 86 97 9 100 85 34 82 24 51 31 68 45 71 75 44 67 30 54 27 11 77 28 47 12 8 11 32 25 86 8 56 43 39 30 41 100 55 70 39 22 70 89 53 57 14 94 17 87 17 58 22 25 93 94 99 6 15 94 73 51 98 82 2 35 53 29 23 63 38 36 46 64 12 93 40 20 56 15 66 86 79 8 22 2 1 77 5 13 15 14 81 30 66 33 99 75 38 26 98 39 26 9 51 18 37 72 35 53 25 52 94 2 54 27 83 37 82 47 21 43 82 73 7 21 57 81 61 64 82 58 26 45 50 42 1 90 54 92 25 49 33 63 94 47 66 59 40 23 12 62 90 7 61 53 5 28 72 35 32 32 95 95 98 66 21 72 26 33 82 30 34 17 91 96 98 3 74 72 98 11 53 56 17 91 35 61 26 48 69 84 50 72 3 37 23 7 28 98 30 34 60 11 57 77 3 1 31 71 52 68 11 89 51 45 58 65 66 62 79 95 44 90 100 63 32 66 84 492\n169\n3 16 59 35 74 70 83 60 98 100 20 85 74 10 34 2 55 53 90 69 68 16 21 90 14 84 22 65 68 98 5 98 14 49 52 28 35 74 68 57 52 39 44 21 97 64 16 30 45 75 9 1 91 69 56 29 70 71 38 32 65 23 97 93 7 93 8 81 65 72 22 9 95 84 93 62 37 28 31 69 13 14 32 46 28 45 36 26 49 46 1 46 91 81 35 51 87 91 7 20 80 41 1 87 52 13 51 23 84 38 33 9 2 8 31 22 1 13 34 89 62 17 91 1 83 75 35 47 54 94 48 23 6 2 10 56 63 74 20 39 69 48 28 60 42 56 71 2 30 14 76 68 96 93 27 70 77 92 22 7 93 36 15 12 99 44 47 6 8\n133\n36 43 19 53 15 15 21 60 79 29 31 39 8 47 25 92 70 86 2 58 85 42 90 17 11 58 53 24 76 37 72 43 20 7 40 30 28 54 7 27 74 39 62 96 7 37 50 55 68 69 35 64 70 91 91 30 15 14 91 42 67 63 48 10 47 99 95 54 100 3 25 72 23 23 38 55 68 30 34 54 89 100 21 97 69 37 67 96 70 45 24 27 84 88 53 81 69 8 49 51 84 92 54 29 36 71 100 37 51 93 47 53 19 54 76 92 92 13 39 62 10 30 65 4 79 62 65 99 2 60 76 45 387\n720\n71 83 69 47 36 92 68 59 90 23 54 16 80 20 50 40 46 97 51 46 7 5 40 70 87 6 52 12 97 100 29 100 88 65 46 44 31 23 35 9 90 84 59 32 78 100 40 65 53 10 12 54 64 2 58 77 31 39 72 11 39 56 10 91 67 39 8 20 57 37 45 6 33 56 29 29 19 63 54 93 90 42 39 66 61 57 23 66 97 5 32 50 61 32 36 34 62 65 57 34 16 84 38 98 2 89 6 96 49 35 29 83 18 51 88 77 9 93 8 18 77 34 78 32 77 5 74 6 4 41 55 35 32 68 57 36 50 58 57 3 58 54 81 51 39 10 14 7 63 100 49 95 67 97 30 42 93 3 75 85 40 89 82 45 19 25 27 44 45 52 42 8 34 6 50 90 69 11 54 51 53 92 20 58 36 18 16 9 87 83 100 72 64 62 13 25 49 26 67 17 26 50 27 98 89 30 1 40 91 31 93 82 85 17 50 56 84 50 14 56 59 4 10 84 39 93 19 10 29 78 79 69 57 56 29 32 91 81 56 19 73 17 43 99 41 81 9 100 79 47 14 79 4 13 65 63 62 40 22 39 92 58 85 23 35 90 33 37 18 25 38 55 10 87 22 51 82 78 42 58 35 86 13 99 88 30 45 18 22 34 96 95 38 88 100 52 32 40 21 2 61 50 100 26 56 61 61 18 10 66 41 97 16 45 39 57 87 74 71 92 44 23 45 24 26 67 24 20 97 91 43 7 48 20 69 55 5 47 84 14 63 55 38 1 60 57 81 35 47 12 16 67 25 12 24 94 98 48 80 6 39 34 63 57 82 77 20 68 31 25 81 85 39 94 2 58 88 48 98 51 8 68 64 57 4 12 57 46 22 35 88 85 48 59 95 82 73 12 85 9 74 3 71 78 77 61 3 83 12 33 34 11 81 89 1 17 43 64 64 29 54 66 36 16 85 83 93 39 68 71 52 77 27 51 10 28 44 40 24 67 43 32 29 60 9 83 23 24 67 34 1 2 56 43 47 84 13 70 34 91 97 19 95 86 77 12 23 18 73 36 75 52 52 16 63 94 93 86 28 77 96 77 65 98 58 78 18 66 3 35 75 64 36 94 88 93 66 39 81 17 84 20 10 85 87 3 85 38 75 78 96 27 77 43 33 98 94 98 34 70 16 4 82 61 49 73 52 15 56 32 58 20 48 49 90 81 5 77 57 6 49 68 65 21 71 96 12 21 51 83 78 9 8 23 51 54 99 19 73 12 53 36 34 72 45 81 35 76 56 99 74 66 68 63 50 13 56 64 65 45 89 28 43 25 56 29 52 23 37 60 40 57 27 59 16 21 18 2 37 11 24 51 10 24 58 50 67 53 76 61 17 72 88 7 32 19 15 23 24 97 41 88 49 89 94 51 84 99 7 17 76 57 28 26 32 79 76 52 46 11 66 97 81 17 100 19 40 10 74 9 32 23 66 56 6 28 52 66 50 32 90 4 51 14 44 49 27 12 53 95 94 48 46 31 21 94 86 3 88 98 9 93 84 51 37 83 34 42 92 62 28 99 39 28 85 28 97 15 28 98 60 45 72 13 81 72 89 86 21 57 51 40 23 56 78 9 20 4 95 896\n285\n16 46 3 19 53 22 6 6 59 82 1 61 6 72 97 32 55 94 47 45 72 54 17 25 30 98 31 37 4 77 34 84 96 36 78 89 14 37 88 70 58 86 54 90 43 66 18 48 94 78 25 78 3 40 40 60 59 13 57 4 94 36 58 70 50 70 33 46 81 77 73 34 44 40 91 3 74 91 53 12 54 96 37 25 30 3 50 6 81 69 33 89 94 59 39 40 5 37 45 29 53 87 15 40 52 27 57 17 64 52 63 29 43 26 20 23 54 12 50 75 88 12 1 99 52 62 9 12 78 86 59 42 66 93 40 25 68 61 40 4 38 56 80 97 36 69 92 70 92 80 56 81 30 77 24 49 22 73 25 61 1 100 71 19 23 58 61 8 28 98 39 21 21 33 26 71 66 11 9 22 61 39 20 86 91 80 94 80 22 6 66 29 54 28 44 8 5 18 84 40 16 91 85 40 64 6 18 57 9 8 1 83 80 54 97 78 17 98 6 99 35 61 76 70 58 13 18 86 63 32 91 80 19 78 43 27 97 82 80 3 42 91 36 56 97 92 96 85 52 14 70 5 51 95 46 30 47 33 24 95 68 28 58 93 15 77 53 46 3 38 72 66 15 17 91 45 65 14 87 92 76 44 72 48 578\n495\n53 26 90 65 33 25 2 57 17 6 51 48 47 16 24 96 26 77 61 17 84 76 50 11 89 52 71 64 71 69 51 65 94 93 15 99 100 42 20 13 9 31 67 25 1 14 74 93 53 17 62 8 36 81 67 2 21 3 23 90 17 78 24 42 92 98 12 46 15 49 9 82 18 83 73 18 22 6 27 65 75 47 40 33 29 74 94 72 50 3 81 78 66 35 62 85 91 50 78 94 30 1 16 25 77 54 44 100 92 7 40 76 43 51 85 1 94 86 72 63 5 72 100 76 29 31 99 55 69 73 96 64 72 59 100 82 19 40 27 26 3 13 97 14 92 30 47 47 62 12 49 91 28 92 27 61 60 85 78 99 69 43 22 28 39 98 33 85 52 98 65 3 41 64 76 100 77 64 56 36 12 80 21 86 90 76 69 69 84 67 48 52 33 68 91 91 84 52 87 61 23 53 23 77 60 68 26 8 44 30 53 72 54 87 32 50 71 96 46 30 65 12 61 97 28 29 13 38 29 52 33 58 55 68 19 71 70 97 11 79 14 60 91 39 41 74 7 68 76 80 91 69 65 21 89 98 62 63 35 27 2 26 61 47 17 34 34 43 56 8 29 26 80 92 81 33 14 91 96 89 98 30 61 71 7 20 67 86 69 66 90 73 12 48 6 67 64 44 81 73 11 30 8 58 32 5 33 53 8 95 34 57 37 19 33 67 68 23 43 95 51 79 77 48 60 38 100 93 49 73 4 54 31 19 95 6 3 10 62 19 48 57 58 4 31 72 37 54 77 24 64 49 93 16 18 44 29 64 39 96 10 61 89 19 5 92 33 59 80 63 79 43 49 27 85 37 57 71 20 88 35 81 32 76 22 41 66 37 100 30 32 78 24 54 41 42 97 11 5 72 85 97 79 7 46 10 49 16 28 47 54 73 38 54 28 31 50 81 24 69 45 56 30 95 7 25 81 64 85 49 68 85 2 79 16 13 82 40 89 59 28 24 21 67 43 14 66 3 32 59 98 81 73 56 95 31 18 96 71 61 73 8 64 42 97 68 64 15 97 56 56 23 10 44 79 80 57 67 5 42 7 6 41 91 61 18 36 62 91 50 40 47 61 16 590\n602\n2 4 17 49 46 22 70 79 94 25 65 45 93 94 78 56 22 92 57 41 96 55 69 41 7 32 18 83 39 74 71 86 53 87 55 73 34 75 44 94 78 42 98 48 5 15 96 8 67 43 93 34 92 11 49 90 30 68 93 81 32 57 70 30 82 60 86 86 58 95 26 20 51 86 70 57 98 3 19 65 46 31 72 20 69 27 2 41 82 70 67 7 56 64 46 91 29 94 16 2 26 76 63 11 13 94 15 84 96 23 47 90 75 34 24 99 95 73 28 34 3 66 81 65 38 97 42 22 94 83 51 31 64 91 53 35 90 10 92 57 1 46 63 9 20 13 32 90 46 56 38 50 66 9 24 30 15 59 44 84 28 62 95 55 19 13 78 55 94 31 49 78 29 44 45 81 83 40 86 11 41 97 59 2 74 77 68 92 86 72 40 95 89 66 50 31 58 68 96 57 80 37 13 86 77 78 9 86 97 1 84 8 57 40 40 97 6 71 80 80 11 50 55 42 42 48 70 100 37 20 29 11 54 84 26 9 63 79 99 33 13 66 33 90 40 78 69 23 19 42 59 34 85 38 98 39 3 51 42 100 3 8 2 28 46 98 48 51 94 10 54 57 33 17 42 62 24 54 83 95 27 41 64 63 94 39 38 56 75 80 54 86 65 47 97 21 89 11 44 90 74 91 11 59 56 65 54 10 76 5 69 66 23 65 13 56 8 79 33 46 99 25 72 6 50 49 22 65 9 37 39 56 40 64 49 12 84 94 43 71 38 49 12 20 54 44 99 71 4 72 34 15 6 30 96 9 41 61 86 58 30 32 30 34 98 12 45 50 47 44 5 13 9 94 3 59 26 65 26 23 31 38 76 29 99 70 81 44 9 41 36 58 55 12 84 46 37 49 37 21 6 91 23 4 47 84 87 63 87 91 80 68 73 90 69 68 60 63 72 5 2 39 27 92 86 99 97 98 22 40 6 65 22 31 99 27 11 10 73 82 92 58 65 70 30 68 96 34 92 84 34 53 52 91 1 54 66 93 64 40 50 79 48 3 26 72 63 94 70 63 39 67 40 32 92 72 1 79 24 59 41 17 41 33 16 77 75 9 82 13 18 55 53 68 71 40 18 27 99 66 1 22 100 70 86 24 41 64 53 89 65 85 6 8 49 89 59 31 39 72 47 77 26 31 19 85 85 38 94 34 74 65 35 75 27 90 76 94 49 97 48 26 36 62 30 76 34 36 3 60 13 52 52 31 40 7 96 53 96 56 98 38 72 74 71 78 15 84 77 4 92 60 59 41 28 95 44 17 99 39 73 70 74 42 36 17 72 87 1 37 66 59 87 42 73 87 60 28 40 30 72 205\n571\n93 41 40 61 62 16 16 100 51 62 4 33 32 88 54 18 93 17 97 98 1 86 63 72 57 24 12 44 76 21 34 51 39 29 83 93 38 17 66 66 81 34 4 96 33 60 88 60 63 27 40 99 16 92 30 79 49 16 32 21 89 31 8 46 49 18 8 73 5 51 20 96 100 63 66 62 44 12 6 64 41 56 97 64 95 77 16 95 40 40 43 49 92 15 58 98 63 34 12 15 65 39 77 3 80 54 10 61 9 25 4 84 73 34 16 92 97 12 45 69 11 75 87 22 57 45 70 50 44 36 93 26 58 57 26 67 66 21 39 54 9 65 15 14 97 75 50 18 73 63 79 46 29 71 84 41 73 68 86 22 57 52 31 52 17 46 22 32 52 28 100 68 34 84 10 36 48 15 90 57 56 67 39 9 57 56 6 20 59 12 33 69 14 57 78 80 78 57 39 49 48 75 1 9 23 16 97 83 41 70 78 79 62 9 65 69 97 98 52 69 56 97 6 68 5 37 26 68 36 53 36 92 58 10 7 51 22 17 94 27 1 83 11 39 51 12 69 3 53 35 30 19 6 54 50 67 56 84 30 4 44 6 56 23 14 2 43 71 93 63 27 92 42 37 43 98 33 39 56 92 52 86 3 5 15 83 31 9 82 77 76 29 70 15 93 43 68 19 30 29 11 59 63 79 30 4 5 22 64 89 79 82 70 34 47 94 62 72 42 87 82 90 38 47 22 80 71 12 61 13 81 70 55 44 51 19 35 80 57 75 99 42 32 86 79 56 12 75 91 8 100 48 81 54 24 46 69 46 48 38 13 36 95 13 58 24 92 22 5 39 21 33 87 33 41 60 54 82 30 26 78 71 16 84 69 31 25 24 69 100 73 87 22 40 2 35 50 1 45 6 88 48 55 16 28 47 100 95 13 74 9 28 54 74 50 44 78 42 83 4 46 55 39 40 62 13 67 93 28 77 59 21 6 57 46 74 90 32 18 67 92 33 51 61 25 9 83 54 54 48 7 36 98 97 7 68 54 94 34 68 28 58 74 21 69 64 44 53 68 3 86 11 61 84 99 50 48 39 26 82 1 68 38 83 10 62 89 29 92 70 91 84 61 38 56 33 66 86 8 75 2 31 3 97 79 13 30 8 73 75 83 73 14 82 30 91 53 49 91 56 59 49 34 12 44 46 2 93 50 15 17 95 78 93 57 39 22 52 8 89 29 96 11 99 28 57 71 71 66 91 91 36 1 52 100 60 48 69 23 20 27 6 77 5 93 73 53 84 89 48 611\n408\n41 87 5 89 24 7 54 4 29 92 31 7 78 54 91 23 89 18 48 1 69 49 51 9 29 3 78 60 21 90 4 100 87 29 22 70 31 97 74 90 86 11 72 90 7 35 34 42 73 40 9 44 54 21 12 19 68 90 33 14 67 29 13 28 20 64 36 72 3 50 72 13 6 82 75 13 67 54 15 68 38 58 62 37 21 52 9 53 13 7 38 17 4 39 48 88 20 67 29 18 79 4 29 68 100 75 25 80 23 11 79 53 42 72 21 96 95 53 68 17 96 96 49 61 38 2 87 84 66 1 7 23 15 18 23 92 77 71 87 15 71 57 59 70 25 81 13 48 33 86 99 66 54 21 33 84 46 26 34 29 14 78 16 63 59 46 10 51 11 95 65 92 66 44 58 40 39 65 50 60 54 63 34 62 92 41 23 48 38 86 63 26 58 49 72 45 97 26 17 81 87 25 12 6 29 46 9 55 10 74 75 27 67 50 33 80 45 89 68 86 59 35 32 85 8 56 58 56 14 62 18 56 56 14 78 52 1 2 24 35 84 15 25 5 69 50 33 54 47 2 14 6 79 29 34 34 34 6 51 71 30 47 91 20 36 56 81 16 45 82 1 40 68 43 90 79 59 96 88 98 13 5 25 20 83 82 48 59 24 79 40 7 7 60 71 89 63 63 14 74 5 10 63 10 49 58 89 9 81 37 51 56 37 47 1 32 29 63 48 11 15 65 7 71 26 93 71 57 44 95 36 81 84 42 81 77 28 42 18 42 51 96 65 69 5 11 98 64 48 53 68 66 79 95 27 85 93 39 69 15 40 98 41 51 74 14 99 14 18 59 1 23 43 48 83 91 65 94 66 11 55 3 58 48 48 28 22 12 55 35 41 90 86 73 40 8 73 100 33 27 32 83 37 79 5 78 78 364\n587\n96 77 83 26 47 5 36 98 28 73 52 95 82 76 24 72 69 83 59 7 73 43 9 18 20 93 13 10 56 14 5 52 70 34 11 24 71 60 34 57 94 85 36 80 47 12 46 38 97 55 10 49 49 63 43 88 58 44 69 20 96 8 33 22 32 69 51 48 56 31 66 78 98 77 65 27 95 32 81 100 1 23 83 9 72 30 59 43 94 43 82 19 97 46 54 24 90 60 89 81 4 16 20 32 99 4 9 83 99 60 30 64 52 42 65 40 1 19 47 80 51 91 41 83 95 25 21 31 66 26 85 60 90 57 44 93 81 95 3 77 73 3 25 34 45 64 68 3 64 51 77 32 62 55 56 13 83 18 99 89 68 89 91 27 67 84 38 10 78 31 6 34 25 54 72 81 58 3 78 5 56 17 41 14 27 27 20 30 70 39 99 41 77 83 58 8 36 28 28 20 3 1 10 70 42 2 65 85 85 32 50 51 4 76 20 79 76 79 30 35 91 97 56 48 47 11 6 70 63 57 79 14 92 25 4 63 46 23 4 11 47 80 95 100 32 95 20 61 88 57 2 59 59 61 22 64 17 34 70 59 64 29 55 83 93 21 89 84 31 21 81 78 45 3 56 79 63 27 68 5 58 49 71 70 79 79 8 82 6 37 96 90 73 54 65 51 30 56 75 87 100 12 5 75 43 12 81 15 20 63 78 24 59 64 90 79 79 79 82 98 93 79 92 37 99 52 5 37 26 12 40 25 23 3 4 70 86 59 6 64 22 5 70 38 49 62 4 53 62 92 94 62 47 8 23 11 24 21 12 14 52 60 29 22 89 77 65 43 73 25 10 57 29 2 22 88 96 18 40 98 44 38 19 90 99 46 76 40 84 21 17 73 96 54 96 46 8 3 83 96 56 87 98 71 5 73 53 48 48 89 41 79 11 23 12 17 67 68 40 64 36 28 67 46 59 78 60 10 80 28 44 89 74 34 33 89 95 27 70 16 41 32 29 14 78 88 66 58 66 52 91 46 6 17 93 18 99 18 27 6 29 98 11 8 45 10 3 13 87 52 24 6 100 87 21 39 80 26 98 21 3 2 75 36 96 32 16 58 23 55 16 38 39 30 17 34 68 45 89 5 55 8 80 91 61 68 8 53 39 6 31 25 30 17 74 57 34 1 64 24 92 69 7 18 4 34 5 71 5 98 72 27 18 43 73 10 22 20 57 80 6 50 31 63 86 2 55 50 40 63 39 92 23 51 56 26 54 45 65 75 28 99 59 80 39 10 27 35 19 9 89 41 66 32 51 92 36 83 64 23 87 72 34 19 66 7 161\n15\n11 27 3 95 25 29 20 62 74 14 88 44 65 7 42\n320\n45 15 29 92 66 76 12 60 45 77 43 35 9 36 18 62 61 32 77 61 70 51 19 13 41 90 4 25 72 47 4 32 20 34 47 90 1 50 74 54 77 75 35 66 65 57 8 74 16 34 35 38 61 54 99 83 3 97 63 38 26 13 51 26 20 63 4 81 9 77 52 97 82 38 99 37 56 5 43 17 78 95 63 61 48 83 76 62 69 64 37 53 43 14 38 50 1 26 72 90 100 10 46 91 41 67 4 98 43 61 58 4 72 86 94 97 78 41 97 18 69 60 50 24 68 97 8 48 93 75 15 89 57 70 12 61 36 7 19 68 96 87 35 82 80 49 58 45 40 88 31 68 57 1 36 82 92 41 49 96 90 77 22 53 94 73 91 25 84 75 6 95 19 89 51 59 28 15 11 52 11 82 83 93 96 24 47 1 9 21 5 64 19 39 51 59 52 53 30 44 78 28 91 13 98 31 77 68 96 35 4 92 43 12 68 61 43 86 93 72 19 95 19 84 35 24 41 90 95 41 23 40 11 27 86 82 89 59 85 4 13 84 100 53 29 84 36 29 80 56 7 8 70 23 26 73 71 94 62 27 66 43 8 5 42 67 3 41 56 71 80 41 98 2 10 59 74 32 45 57 12 88 58 50 35 12 63 30 81 3 61 34 33 36 27 87 80 73 19 92 41 73 52 74 86 95 73 47 10 93 46 59 31 30 89 55 49 15 91 941\n511\n65 64 45 75 13 43 36 67 92 63 56 53 22 55 3 75 25 12 16 76 33 53 46 34 3 37 83 91 12 83 44 2 54 100 23 90 78 26 61 69 13 8 82 51 69 75 34 47 98 98 45 51 37 18 86 84 50 32 61 12 50 42 61 66 68 24 16 62 34 62 45 65 35 95 8 100 14 68 36 25 30 85 43 52 53 75 16 20 44 13 100 53 39 74 78 52 78 73 2 49 70 5 26 46 32 61 32 75 6 66 12 77 17 3 93 55 38 71 74 78 66 35 7 19 84 58 66 18 58 32 5 20 37 35 73 11 90 86 42 51 76 78 42 52 75 73 39 31 83 18 31 92 87 68 56 37 89 76 25 52 72 48 8 2 22 57 83 79 30 88 1 64 31 94 17 87 24 54 63 33 62 24 43 61 79 33 27 33 6 48 52 92 100 38 75 19 22 47 55 11 50 92 21 17 46 22 29 17 14 44 41 54 7 50 32 46 6 37 28 79 26 37 88 54 86 50 92 10 4 92 9 44 93 40 88 13 56 10 12 78 95 36 40 40 50 45 92 31 27 21 88 29 28 53 41 38 85 1 63 8 15 38 67 76 59 82 20 42 89 40 28 24 51 38 38 45 23 55 36 62 62 62 25 1 6 78 92 17 82 70 98 43 79 86 32 73 22 12 8 5 41 7 2 37 79 45 85 13 40 61 22 10 95 32 87 5 82 79 35 11 10 33 24 31 97 56 18 35 94 100 60 17 82 66 19 8 95 25 15 58 59 49 42 35 85 51 11 83 50 17 49 94 47 52 10 7 73 4 33 48 89 40 64 15 13 26 10 48 11 74 61 28 22 3 49 76 80 48 93 74 38 49 52 69 65 21 5 83 31 32 49 87 43 71 5 67 96 27 35 75 62 55 63 8 62 1 86 24 75 100 20 5 24 43 51 19 61 87 43 25 12 93 17 76 14 15 13 68 5 36 15 41 22 21 7 23 30 79 30 59 89 2 53 93 85 77 14 46 16 36 96 28 61 49 68 81 95 78 56 84 51 24 9 81 64 72 18 64 14 41 4 84 98 36 17 9 9 30 96 97 44 72 48 13 29 55 35 95 81 53 92 2 56 95 37 52 7 86 42 30 39 34 52 66 89 26 9 94 54 75 815\n467\n89 88 74 5 36 82 77 49 18 60 58 58 89 18 6 55 94 32 2 52 34 87 9 95 90 35 11 2 30 2 6 41 26 98 87 84 56 9 38 98 87 45 76 86 80 48 47 100 3 83 73 82 90 70 50 63 5 17 53 7 65 33 42 38 16 20 35 90 96 15 57 82 53 6 64 65 27 65 82 1 40 63 38 99 95 9 57 24 60 34 21 7 51 80 33 2 69 59 55 6 79 37 67 53 7 6 46 20 20 7 61 57 7 3 85 22 91 78 62 16 31 71 47 38 38 100 1 51 21 94 29 88 50 79 11 100 71 31 19 57 69 70 22 44 2 69 20 73 80 97 94 97 99 11 40 37 87 49 26 25 96 77 77 65 99 38 38 58 42 6 82 48 9 67 30 94 98 62 64 71 87 9 26 51 54 81 59 49 61 84 23 2 73 65 6 18 53 17 51 22 90 34 33 15 34 75 58 68 78 18 76 63 20 76 77 82 54 3 22 19 97 7 97 93 45 76 43 2 33 51 7 86 4 82 16 39 88 75 79 99 72 17 20 15 4 56 18 47 19 57 78 54 82 40 4 84 68 75 94 49 68 5 34 44 95 72 49 32 17 88 65 91 98 32 55 33 3 35 5 64 38 44 11 9 86 24 100 26 49 8 10 62 95 86 93 40 53 80 35 56 38 17 28 31 98 79 9 40 58 54 46 40 42 45 51 5 7 77 47 42 56 70 14 84 5 77 70 50 21 63 75 71 33 43 12 15 32 8 98 37 6 72 21 63 41 78 42 52 77 62 33 53 71 83 25 49 41 16 77 81 57 65 14 13 16 84 59 70 19 52 28 15 86 12 79 88 15 99 17 27 17 50 82 91 53 65 85 78 47 44 4 52 42 11 24 91 46 54 53 91 54 9 7 81 5 22 14 57 89 9 88 49 68 49 94 68 97 37 59 20 53 24 48 82 41 67 23 67 65 38 3 49 27 76 26 25 42 16 83 20 78 35 61 19 59 80 43 85 3 92 54 36 15 38 85 35 83 96 82 24 82 83 58 26 28 90 475\n707\n93 54 46 69 48 91 94 58 76 27 60 29 57 50 57 24 8 25 36 73 58 3 33 4 91 22 38 21 74 48 37 79 65 46 9 69 91 42 42 82 43 50 19 39 55 21 73 13 90 48 33 19 91 82 98 54 35 21 58 39 82 21 4 31 13 61 18 74 86 18 74 78 59 45 43 9 58 7 5 98 78 77 6 14 12 26 64 58 70 89 80 70 38 16 79 49 89 93 80 43 36 87 4 41 57 72 96 87 48 91 8 79 88 97 63 96 70 83 39 13 77 16 94 16 39 6 98 48 78 11 43 25 58 77 46 20 28 55 89 83 94 49 60 94 91 29 61 81 89 71 63 56 32 47 58 81 16 36 75 38 87 83 22 68 21 28 11 54 6 95 60 2 36 81 85 85 53 32 16 9 76 21 26 98 91 51 96 2 59 98 67 53 6 19 80 18 51 1 15 50 73 56 48 63 77 6 54 7 89 48 19 89 45 95 67 28 35 76 80 21 32 42 76 58 8 3 54 96 27 13 51 60 10 50 1 6 95 16 75 72 8 75 92 69 22 99 56 2 14 91 42 50 19 80 40 80 73 84 13 23 78 40 29 47 43 77 11 26 1 31 55 46 56 50 54 69 78 86 46 90 76 25 19 29 73 70 87 14 6 29 10 48 21 36 65 52 44 59 88 43 40 61 93 32 65 15 82 76 38 79 49 59 35 44 8 68 91 41 69 5 66 16 35 68 100 71 21 14 39 69 69 71 57 76 72 87 91 55 61 76 3 50 91 39 62 67 57 43 11 22 54 42 93 79 53 31 32 73 53 82 29 90 84 52 94 20 47 46 94 87 75 26 68 51 90 83 91 85 21 21 65 45 52 19 38 20 41 93 100 27 29 87 44 61 50 38 44 99 42 22 14 30 3 100 17 81 12 52 44 44 39 99 44 76 59 28 55 6 49 83 36 35 34 54 25 14 21 79 73 19 31 52 78 73 35 36 18 12 96 35 36 90 24 28 27 86 52 48 49 80 6 97 65 90 58 61 9 8 77 13 49 60 70 28 30 5 93 83 27 87 64 89 23 88 39 81 31 96 15 58 84 58 48 26 54 45 30 14 22 14 99 78 43 47 15 63 5 54 3 32 77 85 27 94 35 23 57 22 90 17 79 34 82 61 59 83 74 35 49 17 3 2 10 72 75 47 79 53 26 33 90 47 71 64 5 25 55 18 24 3 58 85 51 91 96 39 74 99 36 10 74 2 44 91 6 63 99 63 56 67 90 3 85 34 27 3 11 44 78 45 69 100 53 58 22 44 72 42 2 28 74 88 27 38 83 25 90 84 66 22 57 49 96 17 18 78 29 53 45 90 46 50 32 57 78 90 54 70 11 45 98 82 83 14 32 32 17 3 72 89 75 43 60 15 8 5 60 35 92 71 85 97 57 96 100 99 89 49 79 16 78 4 19 28 39 23 27 17 75 59 27 44 36 37 53 11 14 37 23 11 58 89 61 49 55 93 1 30 54 69 96 65 8 23 26 67 97 4 22 50 79 44 42 24 81 91 41 14 95 71 36 3 59 68 64 67 14 50 42 3 92 36 88 29 40 88 428\n592\n23 66 32 83 14 11 56 70 11 83 66 42 86 39 4 67 78 13 60 100 26 73 83 31 86 31 70 44 63 42 60 3 72 27 60 92 68 14 63 56 20 25 93 16 12 1 23 36 89 15 46 60 95 26 41 34 16 73 33 40 31 65 46 56 96 56 91 46 19 77 74 33 59 73 56 95 8 21 8 24 24 39 16 53 45 62 13 99 68 3 76 47 83 4 62 38 27 11 10 73 62 62 58 97 22 29 61 76 44 3 44 33 14 26 44 16 57 40 46 9 67 66 22 96 42 88 78 73 71 1 59 85 27 37 39 27 15 46 65 89 81 20 49 14 11 66 45 8 63 46 52 35 99 36 13 58 30 24 7 98 63 7 67 16 89 86 83 37 92 37 36 18 43 98 57 5 33 52 34 75 31 28 69 31 50 9 10 86 94 51 90 57 83 74 47 15 26 53 35 29 57 84 85 52 49 96 57 6 30 6 37 12 34 15 90 65 70 31 22 78 39 76 59 18 98 50 41 10 88 12 29 56 50 32 41 7 5 44 58 64 43 60 69 84 29 7 78 86 43 96 66 76 66 47 37 87 4 57 59 78 33 58 97 31 37 64 96 58 27 62 46 51 75 12 75 52 80 38 44 4 6 95 6 23 95 83 57 46 32 30 46 22 1 23 89 34 17 42 54 25 87 50 33 35 22 38 78 62 77 15 81 100 81 86 31 30 22 14 21 36 83 66 93 12 69 95 26 38 1 92 50 65 71 37 74 75 80 70 18 10 53 98 74 34 29 70 91 46 81 78 90 12 45 86 66 69 30 62 99 63 58 21 67 44 20 92 89 52 18 26 38 1 58 8 17 5 19 78 5 25 52 77 98 6 79 1 77 30 15 32 14 11 76 19 66 56 81 12 97 93 38 60 30 35 40 97 36 32 92 31 54 75 4 58 39 90 33 7 51 3 8 58 55 14 96 48 94 21 93 78 15 67 79 7 55 21 75 2 14 44 23 76 76 95 89 9 12 79 32 52 62 33 7 37 6 80 92 29 96 94 23 42 22 14 55 15 95 6 59 50 51 91 34 52 77 9 35 24 16 98 72 51 47 62 2 47 87 26 22 86 27 40 31 10 52 28 24 97 86 74 34 21 53 66 96 81 94 54 84 71 84 94 71 40 69 23 51 45 92 39 43 9 18 41 86 96 82 67 37 75 78 99 49 96 59 42 100 67 92 30 58 68 46 48 90 14 23 78 14 94 44 91 15 37 8 100 35 12 60 65 52 23 65 42 86 8 73 59 4 69 83 11 61 29 1 46 99 82 34 32 4 30 68 95 75 72 95 6 80 17 50 820\n473\n15 7 91 36 20 47 52 45 47 85 21 94 69 15 89 9 3 44 77 42 68 61 80 63 3 45 26 73 10 78 6 62 16 34 94 8 61 53 16 41 8 88 75 68 99 1 12 85 14 70 46 20 65 82 1 99 92 37 22 53 39 40 93 85 81 12 78 97 71 42 55 78 40 67 73 30 80 36 79 72 19 72 49 39 8 27 74 21 56 72 69 15 20 13 92 12 46 50 71 87 73 34 23 13 25 61 55 85 28 99 89 63 35 30 11 75 2 23 9 55 56 37 37 98 11 30 28 69 1 93 14 51 91 23 1 18 70 20 42 83 100 97 45 89 3 45 92 16 71 59 10 4 17 55 19 30 74 67 52 80 4 83 77 81 71 78 8 41 40 100 57 23 71 19 26 63 92 80 4 53 84 17 88 92 19 53 89 27 45 65 17 46 68 41 39 17 10 39 29 43 26 33 12 74 47 90 3 15 64 1 69 50 25 63 11 81 9 64 32 11 89 42 88 6 59 97 88 37 54 28 28 98 83 54 2 18 13 29 43 99 99 36 65 52 36 52 71 21 88 48 4 53 92 28 90 88 49 68 16 58 69 57 76 100 3 23 3 25 92 90 65 47 72 42 36 4 44 68 76 85 40 63 56 88 53 22 61 20 20 83 97 92 43 43 4 3 95 65 82 67 61 100 53 47 63 15 77 73 20 56 49 25 88 83 87 53 56 44 40 54 35 49 83 29 59 24 60 77 49 23 53 68 22 56 64 73 74 39 44 47 3 76 92 19 76 90 87 77 90 92 3 69 94 51 61 33 71 97 29 100 66 31 42 26 75 9 76 32 57 57 62 91 71 2 44 62 87 63 55 16 11 57 87 46 96 39 43 83 10 74 75 86 53 33 38 30 19 96 100 85 42 5 21 1 8 87 42 76 17 2 69 92 98 69 66 14 38 90 53 28 34 70 37 72 34 2 62 82 75 25 26 35 22 10 19 8 43 80 23 27 88 70 57 99 69 86 100 53 9 61 3 94 69 92 33 17 32 74 63 55 17 75 76 55 60 38 74 11 99 31 75 6 573\n783\n55 14 40 46 59 36 99 90 63 53 44 28 81 34 13 65 3 34 54 32 29 73 79 69 74 71 50 12 99 1 2 28 98 74 41 51 9 23 58 40 70 1 69 34 3 15 35 44 7 27 48 47 81 5 63 7 5 19 47 19 10 34 30 25 36 24 8 29 86 52 96 71 72 10 87 4 48 96 3 47 24 74 23 20 67 84 82 68 48 83 28 48 30 58 59 6 46 76 92 66 12 50 86 97 100 47 2 40 15 68 4 2 26 75 61 27 8 58 26 73 37 8 74 2 23 63 67 19 84 50 68 5 81 93 59 98 78 80 67 18 67 23 98 45 12 11 30 72 51 21 4 72 59 68 49 54 40 91 11 62 64 41 74 83 1 32 22 80 64 83 2 41 14 7 75 70 92 71 29 1 37 28 19 87 56 35 41 58 89 73 74 79 96 40 70 57 57 7 57 86 39 57 28 43 81 61 8 83 77 83 45 6 62 40 100 36 27 67 87 39 22 84 70 69 94 74 17 55 70 77 60 35 97 17 75 47 38 39 100 36 8 36 83 10 76 18 89 60 58 17 17 52 48 77 30 44 64 10 37 78 3 35 26 98 25 9 28 25 71 49 80 87 91 32 11 49 99 58 96 7 87 94 35 71 21 54 58 63 34 44 94 52 58 67 88 6 92 66 50 36 35 2 100 20 47 23 90 18 36 2 62 29 55 20 24 49 3 81 44 58 58 93 82 62 52 28 27 56 19 19 35 76 5 99 71 11 2 20 66 96 7 70 16 5 21 99 81 59 86 13 58 10 68 80 15 14 34 44 37 45 50 75 67 95 75 52 26 9 56 22 74 52 37 91 14 41 71 95 45 51 97 88 38 93 60 94 29 86 4 97 13 78 65 82 67 32 66 27 81 79 52 39 42 96 48 41 8 56 44 2 20 66 85 47 78 50 91 40 61 78 45 10 10 14 52 67 13 30 73 73 69 85 3 93 17 45 100 41 67 22 32 32 16 22 6 17 29 43 84 44 92 51 10 97 65 78 11 60 34 43 54 54 32 7 67 99 6 88 85 4 34 83 56 28 63 41 16 42 3 9 50 86 93 5 2 63 92 55 87 99 40 70 22 85 41 98 18 6 46 22 1 36 100 31 56 52 33 19 19 98 82 46 65 46 15 27 48 54 26 21 51 35 64 57 14 60 87 55 38 23 51 53 83 38 71 66 55 62 39 30 98 66 19 49 42 96 42 88 53 31 100 85 42 72 89 37 97 15 91 9 17 27 50 86 77 45 59 22 86 46 17 6 3 84 15 5 46 73 44 89 44 8 32 42 65 92 30 50 54 46 29 59 51 60 41 94 35 3 86 4 20 31 65 22 65 55 18 66 60 45 36 86 23 34 83 55 16 22 62 9 25 85 31 91 72 71 93 96 11 73 57 20 99 25 33 28 30 19 24 57 63 34 86 77 36 18 36 100 32 24 51 86 92 22 92 43 90 50 95 93 18 62 96 4 78 4 10 59 67 36 85 65 64 18 71 30 35 81 75 20 75 71 48 91 22 2 70 82 66 62 57 100 90 25 55 18 97 96 65 33 7 42 99 3 50 14 77 58 20 3 37 56 7 49 86 100 96 81 7 10 58 21 36 47 61 17 57 74 85 32 67 7 18 72 25 1 4 11 72 91 22 69 47 12 91 46 61 24 47 59 73 56 97 93 86 2 96 20 27 7 5 33 84 23 79 68 96 34 78 9 48 77 29 40 49 90 53 98 85 55 42 29 590\n159\n80 12 22 94 72 43 42 86 57 72 2 13 12 81 94 57 21 20 80 84 41 4 92 78 91 85 9 82 100 28 82 38 29 27 50 86 34 69 46 92 64 87 79 77 78 72 70 56 77 35 20 96 100 7 65 47 82 75 27 15 12 23 88 64 97 91 21 23 66 14 44 8 73 44 82 7 37 53 46 44 89 9 45 21 44 14 12 63 6 85 49 94 23 95 17 79 34 26 84 11 12 5 20 13 46 42 37 7 74 84 73 45 36 5 34 69 62 20 96 76 67 26 26 32 4 78 1 2 93 77 69 74 74 37 13 46 97 41 7 67 60 54 85 23 73 14 90 33 59 34 14 33 19 21 39 54 54 46 172\n643\n93 33 54 31 71 73 45 98 52 36 13 86 38 99 62 39 65 72 26 13 53 47 13 92 40 14 19 99 43 60 97 35 88 43 18 97 42 18 23 47 89 8 38 45 56 64 10 46 17 71 53 38 12 49 28 27 75 12 4 2 13 63 15 61 52 61 3 33 87 91 56 71 67 20 93 100 51 28 54 79 16 76 19 95 37 12 5 86 49 51 74 71 53 51 67 71 43 99 59 51 12 17 1 61 29 21 11 67 73 6 96 20 22 78 43 17 10 20 64 31 78 96 54 17 65 51 60 11 61 66 85 60 69 47 72 33 46 71 3 41 36 76 70 10 43 26 97 69 40 93 66 61 83 21 59 83 35 40 72 30 27 14 100 11 78 91 57 38 93 34 31 38 31 8 91 7 15 89 20 56 83 50 61 97 57 12 16 72 35 61 45 57 50 49 67 6 36 8 26 25 94 43 98 99 13 43 64 23 96 20 68 37 94 59 56 54 93 45 20 23 51 6 33 77 61 91 25 7 97 95 58 44 2 52 46 98 63 11 9 72 4 65 91 86 71 16 99 55 55 42 82 18 75 61 70 92 15 100 78 55 100 58 33 66 85 93 50 81 43 78 18 51 67 1 29 18 12 23 33 22 23 81 51 45 34 93 88 68 71 73 85 86 24 61 73 29 11 70 89 53 59 64 22 28 70 3 37 4 24 65 93 26 21 99 83 44 29 55 25 88 32 69 92 14 65 60 89 44 82 8 91 100 64 17 50 67 74 14 23 30 33 56 69 49 18 57 82 100 25 77 65 9 60 4 20 18 37 73 50 18 79 26 88 52 4 29 64 43 89 47 100 11 62 58 2 50 44 88 53 67 63 35 33 10 62 90 42 55 45 9 57 55 26 42 8 34 48 4 42 50 76 54 47 17 10 62 97 75 26 34 76 78 73 95 38 40 72 98 18 99 87 33 93 56 40 30 99 18 50 90 23 7 69 13 8 30 70 24 44 94 59 29 36 13 55 7 31 67 28 33 85 44 23 86 91 61 37 15 24 22 97 100 58 56 25 68 12 76 69 90 7 1 100 32 73 39 78 27 9 57 9 12 17 85 6 17 67 75 31 37 53 18 6 77 62 53 10 51 28 9 89 62 4 52 8 68 41 9 80 19 6 79 82 73 49 92 87 87 40 25 72 40 11 44 60 71 21 94 85 20 78 14 7 47 69 35 86 3 64 7 73 53 88 81 19 3 29 92 1 37 46 20 11 33 3 75 79 11 3 51 78 29 40 71 37 71 5 33 35 16 56 69 25 9 96 82 76 2 63 27 67 10 84 29 31 76 87 3 24 19 36 9 35 41 52 36 29 66 47 51 17 59 24 84 94 22 83 45 51 17 73 6 8 13 31 77 23 85 7 44 86 20 13 10 23 20 72 99 59 11 16 22 27 42 47 2 62 43 10 11 3 62 130\n142\n59 26 21 93 9 88 50 77 26 6 41 88 21 53 17 57 34 70 55 91 26 73 58 69 25 8 44 3 79 22 49 97 61 26 89 54 1 89 56 51 81 8 23 25 20 62 37 57 26 55 75 68 24 17 88 64 84 19 65 14 67 89 11 25 74 16 18 97 40 63 82 17 48 57 27 38 12 81 78 55 7 55 12 98 39 82 20 17 42 48 92 99 55 12 49 16 37 65 39 8 51 72 52 28 73 48 87 11 41 63 78 47 12 71 47 17 93 93 88 27 73 11 60 68 27 20 48 84 62 89 97 17 48 37 97 9 91 71 5 6 56 91\n250\n63 81 13 87 60 99 77 34 65 86 80 57 40 47 89 57 63 63 48 60 64 42 58 76 68 96 25 96 20 72 59 59 72 96 9 15 6 46 1 99 62 63 57 21 18 98 61 46 52 42 47 77 4 72 90 22 64 85 52 36 83 54 37 87 1 17 15 52 97 48 4 42 21 26 41 47 15 59 53 56 18 81 39 88 79 42 86 66 78 41 87 89 81 35 71 44 76 8 12 92 31 27 82 23 16 12 75 12 83 37 78 87 87 65 36 14 34 8 54 3 12 57 70 79 81 59 57 48 69 95 29 51 64 54 20 93 19 94 35 88 43 29 77 50 10 85 52 31 39 91 90 57 66 27 95 9 13 25 16 92 38 80 10 14 95 80 75 72 22 47 16 24 15 98 39 53 65 78 68 20 28 20 97 35 30 47 43 35 62 61 51 18 68 68 78 23 2 73 95 79 36 22 24 39 92 41 3 25 95 93 29 54 6 37 27 75 97 33 47 84 74 22 66 58 46 18 96 97 67 88 79 21 44 41 56 32 44 100 71 11 1 54 2 83 44 61 44 33 8 706\n354\n37 11 75 89 98 47 73 85 75 42 31 68 80 1 54 2 72 99 48 55 62 19 74 85 88 73 21 85 45 16 73 18 63 42 86 10 80 6 14 77 5 80 71 88 26 59 52 49 62 7 79 83 98 95 25 64 66 48 61 51 60 79 3 88 67 10 6 66 75 75 20 97 58 95 57 98 60 1 42 63 12 71 90 12 71 40 44 33 68 25 92 55 44 92 46 28 78 41 87 33 6 23 79 5 71 83 97 24 17 42 67 24 36 90 17 12 17 75 92 87 55 52 26 81 22 4 62 77 32 89 85 71 23 59 49 63 4 12 60 70 3 53 69 33 32 30 70 72 25 24 79 70 75 6 37 100 64 47 63 8 67 95 69 45 37 72 26 53 63 90 60 96 1 38 44 94 78 26 80 5 76 19 87 56 100 18 46 20 32 48 50 32 7 43 86 92 83 16 30 18 57 37 61 63 58 55 94 22 38 42 55 99 61 92 9 62 27 24 55 13 98 5 84 85 2 36 89 91 38 74 48 10 2 65 26 75 70 96 45 41 27 81 41 71 31 18 65 97 27 74 38 20 32 7 39 36 47 73 20 29 17 90 85 31 45 18 18 68 62 51 88 1 91 56 33 30 36 40 10 48 66 9 69 50 18 71 88 38 27 73 57 35 55 49 59 6 58 96 99 14 60 62 14 30 73 27 52 21 86 41 94 52 18 92 27 78 26 63 93 97 74 93 97 22 33 52 45 20 55 15 39 62 50 93 51 56 72 3 73 90 41 76 14 73 77 53 80 53 15 46 29 27 85 679\n548\n26 7 32 55 76 55 60 11 95 70 18 95 80 92 23 53 40 40 73 74 36 69 72 89 6 12 27 13 8 89 77 15 56 25 34 91 10 39 77 41 48 71 31 93 85 11 23 45 45 55 76 3 76 2 28 72 20 72 95 31 87 53 64 87 26 88 33 73 87 100 78 30 91 5 77 15 96 7 50 91 72 51 58 55 49 39 86 95 39 100 3 34 57 56 59 45 80 56 2 12 63 26 17 18 30 32 73 36 24 28 23 6 85 41 50 26 98 76 98 85 73 61 57 7 100 22 92 35 3 49 83 57 79 39 60 36 82 91 52 49 13 35 77 63 98 26 15 63 31 83 4 30 99 73 29 33 5 91 2 70 55 79 4 37 58 69 70 42 95 62 15 63 16 74 70 95 74 85 50 74 92 72 45 51 97 92 52 77 21 84 53 82 27 56 73 12 57 59 2 4 97 44 28 7 37 49 47 42 3 32 61 93 52 43 69 72 88 44 64 83 46 14 29 88 55 88 29 23 59 60 69 93 34 19 81 9 62 47 78 18 76 88 82 96 91 99 79 42 33 67 84 70 26 83 5 45 85 35 66 69 16 73 93 40 100 2 50 26 27 42 23 88 72 48 66 8 7 20 20 86 28 95 90 1 32 17 17 90 41 15 62 100 67 38 40 36 89 29 91 39 39 5 23 89 32 73 24 24 19 77 20 53 71 61 11 49 67 59 34 39 52 97 98 7 38 28 44 6 34 68 57 34 69 34 18 72 100 25 35 81 8 34 62 4 20 38 36 22 73 84 84 75 75 93 30 95 53 34 34 79 66 93 21 36 23 67 46 46 67 74 8 14 7 32 61 2 90 22 50 49 82 19 46 86 29 93 58 81 28 55 36 54 92 95 65 78 25 100 45 27 19 81 95 89 97 99 87 14 8 79 88 84 7 44 94 51 12 2 30 86 13 88 15 88 1 13 2 77 80 49 2 73 47 41 49 70 27 55 66 89 93 35 12 74 44 3 70 92 13 69 46 4 80 97 43 24 12 14 79 31 7 58 1 27 64 38 5 49 36 98 33 69 1 77 20 40 54 1 95 80 42 73 49 38 52 9 86 79 31 16 60 100 5 14 26 22 61 17 66 92 38 26 24 81 91 74 72 59 83 83 73 40 59 90 96 12 42 97 73 33 14 97 28 56 23 11 88 84 12 99 6 11 64 38 25 27 8 53 15 5 40 57 79 85 50 75 60 126\n25\n13 9 99 11 6 9 100 50 15 3 59 84 50 6 37 29 26 78 24 53 13 69 8 17 270\n149\n30 81 8 55 31 93 86 84 82 10 2 17 64 89 13 28 80 39 10 71 97 87 71 19 3 92 36 65 17 20 51 96 54 23 2 13 19 43 54 67 39 38 39 29 64 60 60 67 49 36 70 43 97 18 17 33 27 89 74 87 50 72 92 96 84 22 69 72 93 44 21 34 47 32 36 96 77 30 63 85 77 98 96 12 68 1 20 41 21 35 54 68 45 95 26 91 1 48 58 45 58 31 32 88 13 61 77 12 1 67 98 97 34 99 57 80 6 27 85 4 59 14 8 50 4 95 11 34 12 26 12 4 69 53 33 19 56 48 75 17 33 12 15 85 11 58 50 10 485\n427\n18 61 64 51 93 18 36 66 81 84 47 96 16 47 46 15 27 83 85 94 63 12 56 88 91 92 25 11 65 77 45 63 63 80 77 34 11 78 100 87 98 27 64 100 30 54 24 5 47 43 87 84 11 25 89 19 14 75 24 68 52 54 39 35 73 55 92 82 52 78 77 42 67 34 99 15 100 33 28 22 33 61 9 87 97 32 7 79 53 53 66 22 52 84 67 66 40 91 18 50 62 44 73 39 30 36 65 88 62 19 39 22 50 96 46 90 99 24 90 22 99 35 73 37 6 18 94 32 14 42 6 98 3 62 11 86 79 19 2 70 56 97 20 11 56 63 15 13 90 86 87 56 59 10 78 74 48 44 88 60 57 45 81 41 10 2 64 47 68 76 74 56 25 52 28 41 76 83 18 34 93 23 46 68 38 5 88 19 23 43 105 79 5 1 10 48 72 16 93 82 57 32 60 84 32 83 31 62 66 18 99 56 73 39 90 5 1 36 43 34 75 48 82 64 64 85 51 46 58 95 43 65 66 41 30 13 99 79 16 94 6 48 98 63 25 25 44 51 13 39 26 70 4 57 68 12 39 53 11 79 59 56 53 100 99 9 36 78 32 21 59 65 76 91 31 66 98 47 84 90 90 42 89 88 90 28 32 26 63 80 88 5 12 77 26 9 84 17 21 32 2 94 39 66 50 35 34 67 87 89 81 84 88 24 81 17 12 91 69 29 50 67 39 15 40 29 75 3 34 41 83 80 15 68 51 11 81 25 99 100 67 1 49 78 30 2 56 50 64 99 4 22 53 45 95 61 22 7 31 52 68 3 54 41 42 50 11 71 91 66 60 75 51 60 74 100 73 56 35 56 32 15 10 15 17 90 92 6 56 91 31 93 75 65 67 2 57 91 69 71 13 84 82 22 50 5 87 75 87 38 17 13 32 13 76 22 89 7 55 83 91 8 68 16 33 91 530\n99\n3 78 7 60 57 10 23 30 2 21 100 39 49 19 52 35 14 20 85 50 47 51 63 59 95 95 44 34 9 96 29 57 94 6 27 49 26 15 56 17 55 77 41 13 63 5 22 98 6 13 1 74 14 75 8 58 48 17 99 7 29 14 90 70 96 93 88 53 55 47 21 19 65 61 17 77 28 71 15 75 41 81 18 49 88 78 79 37 73 54 71 99 52 84 29 91 31 24 555\n",
"4\n0\n1 1\n4\n1 1 6 4\n4\n2 4 11 -1\n3\n1 3 3\n\nSAMPLE\n"
] |
[
"47874\n84171\n58031\n6921\n4278\n126675\n20023\n59883\n88728\n79714\n40655\n84188\n49\n25052\n63800\n53200\n122101\n86048\n54859\n150101\n6156\n101844\n4952\n15225\n30554\n73339\n142\n5381\n44460\n2501\n",
"0\n2\n3\n2\n",
"47874\n84171\n58031\n6921\n4278\n126675\n20023\n59883\n88728\n79714\n40655\n84188\n49\n25052\n63818\n53200\n122101\n86048\n54859\n150101\n6156\n101844\n4952\n15225\n30554\n73339\n142\n5381\n44460\n2501\n",
"47874\n84215\n58031\n6921\n4278\n126675\n20023\n59883\n88728\n79714\n40655\n84188\n49\n25052\n63818\n53200\n122101\n86048\n54859\n150101\n6156\n101844\n4952\n15225\n30554\n73339\n142\n5381\n44460\n2501\n",
"0\n3\n3\n2\n",
"47874\n84215\n58031\n6921\n4278\n126675\n20023\n59883\n88758\n79714\n40655\n84188\n49\n25052\n63818\n53200\n122101\n86048\n54859\n150101\n6156\n101844\n4952\n15225\n30554\n73339\n142\n5381\n44460\n2501\n",
"47874\n84215\n58031\n6921\n4278\n126675\n20023\n59883\n88758\n79714\n40655\n84188\n49\n25052\n63818\n53200\n122101\n86048\n54859\n150101\n6156\n101844\n4952\n15225\n30554\n73339\n142\n5381\n44465\n2501\n",
"0\n1\n3\n2\n",
"47874\n84215\n58010\n6921\n4278\n126675\n20023\n59883\n88758\n79714\n40655\n84188\n49\n25052\n63818\n53200\n122101\n86048\n54859\n150101\n6156\n101844\n4952\n15225\n30554\n73339\n142\n5381\n44465\n2501\n",
"0\n1\n2\n2\n"
] |
CodeContests
|
Nuske has a grid with N rows and M columns of squares. The rows are numbered 1 through N from top to bottom, and the columns are numbered 1 through M from left to right. Each square in the grid is painted in either blue or white. If S_{i,j} is 1, the square at the i-th row and j-th column is blue; if S_{i,j} is 0, the square is white. For every pair of two blue square a and b, there is at most one path that starts from a, repeatedly proceeds to an adjacent (side by side) blue square and finally reaches b, without traversing the same square more than once.
Phantom Thnook, Nuske's eternal rival, gives Q queries to Nuske. The i-th query consists of four integers x_{i,1}, y_{i,1}, x_{i,2} and y_{i,2} and asks him the following: when the rectangular region of the grid bounded by (and including) the x_{i,1}-th row, x_{i,2}-th row, y_{i,1}-th column and y_{i,2}-th column is cut out, how many connected components consisting of blue squares there are in the region?
Process all the queries.
Constraints
* 1 ≤ N,M ≤ 2000
* 1 ≤ Q ≤ 200000
* S_{i,j} is either 0 or 1.
* S_{i,j} satisfies the condition explained in the statement.
* 1 ≤ x_{i,1} ≤ x_{i,2} ≤ N(1 ≤ i ≤ Q)
* 1 ≤ y_{i,1} ≤ y_{i,2} ≤ M(1 ≤ i ≤ Q)
Input
The input is given from Standard Input in the following format:
N M Q
S_{1,1}..S_{1,M}
:
S_{N,1}..S_{N,M}
x_{1,1} y_{i,1} x_{i,2} y_{i,2}
:
x_{Q,1} y_{Q,1} x_{Q,2} y_{Q,2}
Output
For each query, print the number of the connected components consisting of blue squares in the region.
Examples
Input
3 4 4
1101
0110
1101
1 1 3 4
1 1 3 1
2 2 3 4
1 2 2 4
Output
3
2
2
2
Input
5 5 6
11010
01110
10101
11101
01010
1 1 5 5
1 2 4 5
2 3 3 4
3 3 3 3
3 1 3 5
1 1 3 4
Output
3
2
1
1
3
2
|
stdin
| null | 1,211 | 1 |
[
"3 4 4\n1101\n0110\n1101\n1 1 3 4\n1 1 3 1\n2 2 3 4\n1 2 2 4\n",
"5 5 6\n11010\n01110\n10101\n11101\n01010\n1 1 5 5\n1 2 4 5\n2 3 3 4\n3 3 3 3\n3 1 3 5\n1 1 3 4\n"
] |
[
"3\n2\n2\n2\n",
"3\n2\n1\n1\n3\n2\n"
] |
[
"3 4 4\n1101\n0110\n1101\n1 1 3 4\n1 1 3 1\n2 2 3 4\n1 2 3 4\n",
"5 5 6\n11010\n01110\n10101\n11101\n01010\n1 1 5 5\n1 2 4 5\n2 3 3 5\n3 3 3 3\n3 1 3 5\n1 1 3 4\n",
"5 5 6\n11010\n01110\n10101\n11101\n01010\n1 1 5 5\n1 2 4 5\n2 3 3 5\n5 3 3 3\n3 1 3 5\n1 1 3 4\n",
"3 4 4\n1101\n0110\n1101\n1 1 3 4\n2 1 3 1\n2 2 3 4\n1 2 2 4\n",
"3 4 4\n1101\n0110\n1101\n1 1 3 4\n1 1 3 1\n2 2 3 4\n2 2 3 4\n",
"5 5 6\n11010\n01110\n10101\n10101\n01010\n1 1 5 5\n1 2 4 5\n2 3 3 5\n3 3 3 2\n3 1 3 5\n1 1 3 4\n",
"5 5 6\n11010\n01110\n10101\n11001\n01010\n1 1 5 5\n2 2 4 5\n2 4 3 5\n5 3 3 3\n3 1 3 5\n1 1 3 4\n",
"3 4 4\n1101\n0110\n1101\n2 1 3 4\n2 1 3 1\n2 2 3 4\n1 2 2 4\n",
"3 4 4\n1101\n1110\n1101\n1 1 3 4\n1 1 3 1\n2 2 3 4\n2 2 3 4\n",
"5 5 6\n11010\n01110\n10101\n11001\n01010\n1 1 5 5\n2 4 4 5\n2 4 3 5\n5 3 3 3\n3 1 3 5\n1 1 3 4\n"
] |
[
"3\n2\n2\n3\n",
"3\n2\n2\n1\n3\n2\n",
"3\n2\n2\n0\n3\n2\n",
"3\n1\n2\n2\n",
"3\n2\n2\n2\n",
"5\n2\n2\n0\n3\n2\n",
"4\n3\n2\n0\n3\n2\n",
"2\n1\n2\n2\n",
"1\n1\n2\n2\n",
"4\n2\n2\n0\n3\n2\n"
] |
CodeContests
|
Roy is going through the dark times of his life. Recently his girl friend broke up with him and to overcome the pain of acute misery he decided to restrict himself to Eat-Sleep-Code life cycle. For N days he did nothing but eat, sleep and code.
A close friend of Roy kept an eye on him for last N days. For every single minute of the day, he kept track of Roy's actions and prepared a log file.
The log file contains exactly N lines, each line contains a string of length 1440 ( i.e. number of minutes in 24 hours of the day).
The string is made of characters E, S, and C only; representing Eat, Sleep and Code respectively. i^th character of the string represents what Roy was doing during i^th minute of the day.
Roy's friend is now interested in finding out the maximum of longest coding streak of the day - X.
He also wants to find the longest coding streak of N days - Y.
Coding streak means number of C's without any E or S in between.
See sample test case for clarification.
Input:
First line of each file contains N - number of days.
Following N lines contains a string of exactly 1440 length representing his activity on that day.
Output:
Print X and Y separated by a space in a single line.
Constraints:
1 ≤ N ≤ 365
String consists of characters E, S, and C only.
String length is exactly 1440.
Note: The sample test case does not follow the given constraints on string length to avoid large data. It is meant only for explanation. We assure you that the hidden test files strictly follow the constraints.
SAMPLE INPUT
4
SSSSEEEECCCCEECCCC
CCCCCSSSSEEECCCCSS
SSSSSEEESSCCCCCCCS
EESSSSCCCCCCSSEEEESAMPLE OUTPUT
7 9Explanation
Longest coding streak for each day is as follows:
Day 1: 4
Day 2: 5
Day 3: 7
Day 4: 6
Maximum of these is 7, hence X is 7.
Now in order to find longest coding streak of the all days, we should also check if Roy continued his coding from previous days.
As in the sample test case, Roy was coding for 4 minutes at the end of Day 1 and he continued to code till 5 more minutes on Day 2. Hence the longest coding streak is 4+5 equals 9. There is no any other coding streak larger than this. So the longest coding streak of all days is 9.
|
stdin
| null | 11 | 1 |
[
"4\nSSSSEEEECCCCEECCCC\nCCCCCSSSSEEECCCCSS\nSSSSSEEESSCCCCCCCS\nEESSSSCCCCCCSSEEEESAMPLE\n"
] |
[
"7 9\n"
] |
[
"4\nSSSSEEEECCCCEECCCC\nCCCCCSSSSEEECCCCSS\nSCCCCCCCSSEEESSSSS\nEESSSSCCCCCCSSEEEESAMPLE\n",
"4\nCCCCEECBCCEEEESSSS\nCCCCCSSSSEEECCCCSS\nSSSSSEEESSCCCCCCCS\nEESSSSCCCCCCSSEEEESAMPLE\n",
"4\nSSSSEEEECCCCEECCCC\nCCCCSSSSSEEECCCCSC\nSCCCCCCCSSEEESSSSS\nEESSSSCCCCCCSSEEEESAMPLE\n",
"4\nSESSEEEECCBDESCCCC\nCCCCCCSSSEEESCCBSS\nSCCCCCCCSSEEESSSSS\nEESSSSCCCCCCSSEEEESAMPLE\n",
"4\nCCCCEECCCCEEEESSSS\nCCCCCSSSSEEECCCCSS\nSSCSSEEESSCCCCCCSS\nEESSSSCCCCCCSSEEEESAMPLE\n",
"4\nSESSEEEECCBDDSCCCC\nCCCCCSSSSEEECCCCSS\nCCCCCSCCSSEEESSSSS\nEESSSSCCCCCCSSEEEESAMPLE\n",
"4\nSSSSEEEECCCCEECCCC\nCSCCCCEEESSSSSCCCC\nSCECCCCCSSEECSSSSS\nEESSSSCSCCCCCSEEEESAMPLE\n",
"4\nSSSSECEECCCCEEECCC\nCCCCCSSSSEEECCCCSS\nSSCSSEEESCCBCCSCSS\nEESSSSCCCCCCSSEEEESBMPLE\n",
"4\nSSSSEEEECCCCCECECC\nCCCCSSSSSEEECCSCCC\nSCCSCCCCCSEEESSSSS\nEESSSSCSCCCCCSEEEESAMPLE\n",
"4\nSSSSEEEECCBCEECCCC\nCCCCCSSSSEEECCCCSS\nSCCCCCCCSSEEESSSSS\nEESSSSCCCCCCSSEEEESAMPLE\n"
] |
[
"7 9\n",
"7 7\n",
"7 8\n",
"7 10\n",
"6 6\n",
"6 9\n",
"5 5\n",
"6 8\n",
"5 6\n",
"7 9\n"
] |
CodeContests
|
In 2300, the Life Science Division of Federal Republic of Space starts a very ambitious project to complete the genome sequencing of all living creatures in the entire universe and develop the genomic database of all space life. Thanks to scientific research over many years, it has been known that the genome of any species consists of at most 26 kinds of molecules, denoted by English capital letters (i.e. `A` to `Z`).
What will be stored into the database are plain strings consisting of English capital letters. In general, however, the genome sequences of space life include frequent repetitions and can be awfully long. So, for efficient utilization of storage, we compress N-times repetitions of a letter sequence seq into N`(`seq`)`, where N is a natural number greater than or equal to two and the length of seq is at least one. When seq consists of just one letter c, we may omit parentheses and write Nc.
For example, a fragment of a genome sequence:
> `ABABABABXYXYXYABABABABXYXYXYCCCCCCCCCC`
can be compressed into:
> `4(AB)XYXYXYABABABABXYXYXYCCCCCCCCCC`
by replacing the first occurrence of `ABABABAB` with its compressed form. Similarly, by replacing the following repetitions of `XY`, `AB`, and `C`, we get:
> `4(AB)3(XY)4(AB)3(XY)10C`
Since `C` is a single letter, parentheses are omitted in this compressed representation. Finally, we have:
> `2(4(AB)3(XY))10C`
by compressing the repetitions of `4(AB)3(XY)`. As you may notice from this example, parentheses can be nested.
Your mission is to write a program that uncompress compressed genome sequences.
Input
The input consists of multiple lines, each of which contains a character string s and an integer i separated by a single space.
The character string s, in the aforementioned manner, represents a genome sequence. You may assume that the length of s is between 1 and 100, inclusive. However, of course, the genome sequence represented by s may be much, much, and much longer than 100. You may also assume that each natural number in s representing the number of repetitions is at most 1,000.
The integer i is at least zero and at most one million.
A line containing two zeros separated by a space follows the last input line and indicates the end of the input.
Output
For each input line, your program should print a line containing the i-th letter in the genome sequence that s represents. If the genome sequence is too short to have the i-th element, it should just print a zero. No other characters should be printed in the output lines. Note that in this problem the index number begins from zero rather than one and therefore the initial letter of a sequence is its zeroth element.
Example
Input
ABC 3
ABC 0
2(4(AB)3(XY))10C 30
1000(1000(1000(1000(1000(1000(NM)))))) 999999
0 0
Output
0
A
C
M
|
stdin
| null | 4,278 | 1 |
[
"ABC 3\nABC 0\n2(4(AB)3(XY))10C 30\n1000(1000(1000(1000(1000(1000(NM)))))) 999999\n0 0\n"
] |
[
"0\nA\nC\nM\n"
] |
[
"ABC 3\nABC 1\n2(4(AB)3(XY))10C 30\n1000(1000(1000(1000(1000(1000(NM)))))) 999999\n0 0\n",
"ABC 3\nABC 0\n2(4(AB)3(XY))10C 3\n1000(1000(1000(1000(1000(1000(NM)))))) 999999\n0 0\n",
"ABC 3\nABC 2\n2(4(AB)3(XY))10C 30\n1000(1000(1000(1000(1000(1000(NM)))))) 999999\n0 0\n",
"ABC 3\nABC 0\n2(4(AB)3(XY))10C 3\n1000(1000(1000(1000(1000(1000(NM)))))) 976314\n0 0\n",
"ABC 3\nABC 0\n2(4(AB)3(XY))10C 30\n1000(1000(1000(1000(1000(1000(NM)))))) 257350\n0 0\n",
"ABC 3\nABC 0\n2(4(AB)3(XY))10C 49\n1000(1000(1000(1000(1000(1000(NM)))))) 257350\n0 0\n",
"ABC 3\nBAB 0\n2(4(AB)3(XY))10C 3\n1000(1000(1000(1000(1000(1000(NM)))))) 247734\n0 0\n",
"ABC 3\nBAB 0\n2(4(AB)3(XY))10C 2\n1000(1000(1000(1000(1000(1000(NM)))))) 247734\n0 0\n",
"ABC 5\nABC 0\n2(4(AB)3(XY))10C 30\n1000(1000(1000(1000(1000(1000(NM)))))) 999999\n0 0\n",
"ABC 0\nABC 0\n2(4(AB)3(XY))10C 3\n1000(1000(1000(1000(1000(1000(NM)))))) 999999\n0 0\n"
] |
[
"0\nB\nC\nM\n",
"0\nA\nB\nM\n",
"0\nC\nC\nM\n",
"0\nA\nB\nN\n",
"0\nA\nC\nN\n",
"0\nA\n0\nN\n",
"0\nB\nB\nN\n",
"0\nB\nA\nN\n",
"0\nA\nC\nM\n",
"A\nA\nB\nM\n"
] |
CodeContests
|
Ikta loves fast programs. Recently, I'm trying to speed up the division program. However, it doesn't get much faster, so I thought it would be better to make it faster only for "common sense and typical" inputs. The problem Ikta is trying to solve is as follows.
For a given non-negative integer n, divide p (n) − 1-digit positive integer 11 ... 1 by p (n) in decimal notation. However, p (n) represents the smallest prime number larger than 22 {... 2} (n 2). Let p (0) = 2.
Your job is to complete the program faster than Ikta.
Input
The input is given in the following format.
n
Given the non-negative integer n of the input in question.
Constraints
Each variable being input satisfies the following constraints.
* 0 ≤ n <1000
Output
Print the solution to the problem on one line.
Examples
Input
0
Output
1
Input
1
Output
2
Input
2
Output
1
|
stdin
| null | 3,774 | 1 |
[
"0\n",
"1\n",
"2\n"
] |
[
"1\n",
"2\n",
"1\n"
] |
[
"3\n",
"001\n",
"000\n",
"6\n",
"4\n",
"10\n",
"5\n",
"7\n",
"17\n",
"11\n"
] |
[
"0\n",
"2\n",
"1\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n",
"0\n"
] |
CodeContests
|
Alice is climbing stairs. There are total N stairs. She climbs A stairs upwards in day and she comes downstairs in night by B stairs. Find number of days she will take to reach the top of staircase.
Input:
First and only line contains three space separated integers denoting A, B, N.
Output:
Print only one line of output denoting the answer to the question.
Constraints:
1 ≤ B<A≤N ≤ 10^9
SAMPLE INPUT
5 1 6
SAMPLE OUTPUT
2
|
stdin
| null | 636 | 1 |
[
"5 1 6\n\nSAMPLE\n"
] |
[
"2\n"
] |
[
"123461 96628 998998998\n",
"5 1 6\n\nELPMAS\n",
"2 1 8\n\nMAEPLS\n",
"5 1 15\n\nELPMAS\n",
"2 1 10\n\nSLPEAM\n",
"2 1 16\n\nSLPEAM\n",
"5 1 25\n\nELPM@S\n",
"5 1 41\n\nELPM@S\n",
"5 2 41\n\nELPM@S\n",
"123461 123460 405371410\n"
] |
[
"37227\n",
"2\n",
"7\n",
"4\n",
"9\n",
"15\n",
"6\n",
"10\n",
"13\n",
"405247950\n"
] |
CodeContests
|
You will be given a list of space separated integers, your task is to form a min-heap tree from the given set of inputs and display the root element of the Min-heap formed.
Input
A list of n Space separated integers.
Output
Root element of the Min-Heap formed.
Constrains
1 ≤ n ≤ 100
where n is the number of integers.
SAMPLE INPUT
12 5 4 8 79 6 54
SAMPLE OUTPUT
4
Explanation
In sample Input, the given integers are:
12 5 4 8 79 6 54
By forming a Min-Heap with the given set of numbers we get:
level - root: 4
level - 1 : 5, 6
level - 2 : 8, 79, 12, 54
4
/ \
5 6
/ \ / \
8 79 12 54
|
stdin
| null | 3,383 | 1 |
[] |
[] |
[
"18 25 66 11 14 0 85 63 2 21 6 90 53 99 59 66 90 57 65 9 87 97 42 33 63 9 6 81 43 25 53 47 45 11 8 58 1 63 38 51 81 2 82 20 97 73 12 49 25 3 83 26 18 89 14 47 27 85 15 71 57 94 35 95 19 46 96 55 15 65\n",
"24 32 78 1 31 2 2 31 1 51 0 23 36 80 29 91 3 57 4 9 26 238 2 13 60 0 -1 19 1 36 6 67 35 15 4 95 0 53 60 59 334 2 251 20 8 24 4 1 33 3 702 107 18 8 134 82 35 167 17 1 45 011 8 127 51 34 80 126 2 101\n",
"24 10 78 2 31 2 2 31 1 51 0 23 36 80 29 164 3 57 4 9 36 238 3 2 1 0 -2 29 1 36 6 67 0 30 4 95 0 53 19 59 334 2 251 20 8 45 0 1 33 3 561 107 18 8 134 82 35 282 17 1 45 011 8 127 51 6 16 126 2 101\n",
"2 10 78 2 31 1 2 31 1 97 -1 23 1 127 16 327 3 105 4 14 36 311 3 4 0 0 -4 52 1 36 6 20 0 30 4 95 0 53 19 59 334 4 80 18 8 45 0 0 52 6 561 107 30 3 259 1 35 282 17 1 45 010 0 100 51 6 1 476 2 111\n",
"0 5 123 4 31 1 0 31 2 97 -1 27 1 70 0 327 0 105 3 12 62 311 3 4 0 0 -8 0 1 36 3 40 -1 8 4 26 0 38 18 55 207 0 80 13 1 45 0 -1 38 5 412 1 18 1 555 -1 35 176 6 1 40 010 3 010 51 16 1 476 1 111\n",
"0 6 123 2 6 1 0 51 4 161 -1 28 1 38 1 327 -1 18 5 26 62 351 3 6 0 -1 -13 -1 0 30 2 40 -1 2 4 14 0 38 2 72 207 -2 92 13 1 51 0 -1 30 18 412 2 3 1 499 -1 35 109 6 0 42 100 0 010 58 43 0 60 0 000\n",
"-1 0 0 0 4 -2 1 -2 0 22 -6 151 2 1 0 46 -4 18 13 20 27 851 1 4 0 -1 -15 1 0 1 2 0 -1 2 11 31 0 36 4 80 239 -2 1 22 4 246 1 -1 15 18 412 2 3 12 533 -4 73 43 0 1 22 010 -1 010 50 74 -1 60 0 000\n",
"0 -2 -1 -2 6 -2 2 0 0 19 -4 151 3 1 0 47 -8 18 13 20 29 851 2 4 0 -2 -23 0 0 0 1 -2 -2 3 9 31 -1 36 3 80 419 -2 4 1 5 246 1 0 8 27 412 1 3 0 393 -4 136 43 0 1 22 010 -1 000 50 118 0 60 1 110\n",
"0 -3 -1 -2 6 -2 2 0 0 5 -4 151 3 0 0 47 -8 10 22 20 29 609 2 6 0 -2 -27 0 1 0 1 -2 -2 3 9 31 -1 53 3 51 419 -2 4 0 5 246 4 0 8 27 540 1 3 0 393 -3 249 54 0 1 22 010 0 000 50 118 0 60 2 100\n",
"-1 -3 -1 -2 6 -2 2 0 0 5 -2 120 3 0 0 18 -8 10 75 2 57 609 2 5 0 -2 -25 1 1 0 1 -2 -2 0 2 31 -1 53 4 57 10 -4 4 0 5 330 5 1 10 27 540 1 0 0 393 -3 36 24 1 1 22 110 2 101 50 118 0 60 2 100\n"
] |
[
"0\n",
"-1\n",
"-2\n",
"-4\n",
"-8\n",
"-13\n",
"-15\n",
"-23\n",
"-27\n",
"-25\n"
] |
CodeContests
|
Problem
Gaccho owns an N-sided field and M potatoes. Each field is numbered from 1 to N. Gaccho wants to increase the number of potatoes by planting and harvesting potatoes in the field.
Gaccho lives alone and can only manage fields up to the K side. In addition, the soil condition and area of each field vary, and the number of potatoes harvested and the number of potatoes that can be planted also vary. When potatoes are planted in field i, ai potatoes can be harvested for each potato planted in field i one year later. However, only bi potatoes can be planted in the field i at the maximum.
When you plant M or less potatoes in a field within K side, please find the maximum number of potatoes you can own one year later.
Constraints
* 1 ≤ N ≤ 15
* 1 ≤ M ≤ 104
* 1 ≤ K ≤ min (N, 3)
* 1 ≤ ai ≤ 103
* 1 ≤ bi ≤ 104
Input
The input is given in the following format.
NMK
a1 a2 ... aN
b1 b2 ... bN
Three integers N, M, K are given on the first line, separated by blanks.
N integers ai are given on the second line, separated by blanks.
N integers bi are given on the third line, separated by blanks.
Output
Output the maximum number of potatoes in one line.
Examples
Input
5 100 3
2 3 4 5 6
50 40 20 10 5
Output
280
Input
5 100 3
2 3 4 5 100
50 40 20 10 1
Output
339
|
stdin
| null | 4,555 | 1 |
[
"5 100 3\n2 3 4 5 6\n50 40 20 10 5\n",
"5 100 3\n2 3 4 5 100\n50 40 20 10 1\n"
] |
[
"280\n",
"339\n"
] |
[
"5 100 3\n2 3 4 5 4\n50 40 20 10 5\n",
"5 100 3\n2 2 4 5 100\n50 40 20 10 1\n",
"5 100 3\n2 2 4 5 110\n50 40 20 10 1\n",
"5 110 3\n2 2 4 5 110\n50 40 20 10 1\n",
"5 110 3\n2 3 4 5 110\n50 40 20 10 1\n",
"5 100 3\n-1 3 4 5 4\n50 40 12 10 1\n",
"5 100 3\n-1 3 4 5 4\n50 15 12 10 1\n",
"5 010 3\n2 3 4 3 110\n50 40 20 10 1\n",
"5 100 3\n-1 3 4 5 4\n50 21 12 10 1\n",
"5 010 3\n2 3 4 3 110\n50 40 3 10 1\n"
] |
[
"280\n",
"309\n",
"319\n",
"329\n",
"359\n",
"256\n",
"206\n",
"146\n",
"218\n",
"140\n"
] |
CodeContests
|
There are N cities. There are also K roads and L railways, extending between the cities. The i-th road bidirectionally connects the p_i-th and q_i-th cities, and the i-th railway bidirectionally connects the r_i-th and s_i-th cities. No two roads connect the same pair of cities. Similarly, no two railways connect the same pair of cities.
We will say city A and B are connected by roads if city B is reachable from city A by traversing some number of roads. Here, any city is considered to be connected to itself by roads. We will also define connectivity by railways similarly.
For each city, find the number of the cities connected to that city by both roads and railways.
Constraints
* 2 ≦ N ≦ 2*10^5
* 1 ≦ K, L≦ 10^5
* 1 ≦ p_i, q_i, r_i, s_i ≦ N
* p_i < q_i
* r_i < s_i
* When i ≠ j, (p_i, q_i) ≠ (p_j, q_j)
* When i ≠ j, (r_i, s_i) ≠ (r_j, s_j)
Input
The input is given from Standard Input in the following format:
N K L
p_1 q_1
:
p_K q_K
r_1 s_1
:
r_L s_L
Output
Print N integers. The i-th of them should represent the number of the cities connected to the i-th city by both roads and railways.
Examples
Input
4 3 1
1 2
2 3
3 4
2 3
Output
1 2 2 1
Input
4 2 2
1 2
2 3
1 4
2 3
Output
1 2 2 1
Input
7 4 4
1 2
2 3
2 5
6 7
3 5
4 5
3 4
6 7
Output
1 1 2 1 2 2 2
|
stdin
| null | 1,016 | 1 |
[
"7 4 4\n1 2\n2 3\n2 5\n6 7\n3 5\n4 5\n3 4\n6 7\n",
"4 3 1\n1 2\n2 3\n3 4\n2 3\n",
"4 2 2\n1 2\n2 3\n1 4\n2 3\n"
] |
[
"1 1 2 1 2 2 2\n",
"1 2 2 1\n",
"1 2 2 1\n"
] |
[
"7 4 4\n1 2\n2 3\n2 7\n6 7\n3 5\n4 5\n3 4\n6 7\n",
"4 3 0\n1 2\n2 3\n3 4\n2 3\n",
"4 2 2\n2 2\n2 3\n1 4\n2 3\n",
"6 3 0\n-1 2\n2 3\n3 4\n2 3\n",
"14 4 4\n1 2\n2 3\n2 5\n6 7\n3 5\n4 5\n3 4\n6 7\n",
"7 4 4\n1 2\n2 3\n2 7\n6 7\n3 5\n4 5\n3 4\n6 2\n",
"6 3 1\n-1 2\n2 3\n3 4\n2 3\n",
"5 3 0\n-1 2\n4 3\n3 4\n5 3\n",
"12 3 0\n0 2\n3 3\n3 3\n5 3\n",
"9 0 1\n-1 0\n2 10\n5 0\n1 0\n"
] |
[
"1 1 1 1 1 2 2\n",
"1 1 1 1\n",
"1 2 2 1\n",
"1 1 1 1 1 1\n",
"1 1 2 1 2 2 2 1 1 1 1 1 1 1\n",
"1 2 1 1 1 2 1\n",
"1 2 2 1 1 1\n",
"1 1 1 1 1\n",
"1 1 1 1 1 1 1 1 1 1 1 1\n",
"1 1 1 1 1 1 1 1 1\n"
] |
CodeContests
|
The problem statement is simple. You are given a string and you are
supposed to print all the distinct permutations of the string, as they would appear in an dictionary.
INPUT
The first and only line of the input contains a single string, S.
OUTPUT
The output contains the required strings, each string in a seperate line.
CONSTRAINTS
1 ≤ |S| ≤ 9
SAMPLE INPUT
abc
SAMPLE OUTPUT
abc
acb
bac
bca
cab
cba
|
stdin
| null | 3,550 | 1 |
[
"abc\n\nSAMPLE\n"
] |
[
"abc\nacb\nbac\nbca\ncab\ncba\n"
] |
[
"`bc\n\nSAMPLE\n",
"`cc\n\nELPMAS\n",
"`dc\n\nELPMAS\n",
"adc\n\nELPM@S\n",
"aec\n\nTON@LE\n",
"cbd\n\nTONEL@\n",
"cbc\n\nTONEL@\n",
"bbc\n\nOTNFL@\n",
"bac\n\n@NNFNT\n",
"dbb\n\n@NNFNT\n"
] |
[
"`bc\n`cb\nb`c\nbc`\nc`b\ncb`\n",
"`cc\nc`c\ncc`\n",
"`cd\n`dc\nc`d\ncd`\nd`c\ndc`\n",
"acd\nadc\ncad\ncda\ndac\ndca\n",
"ace\naec\ncae\ncea\neac\neca\n",
"bcd\nbdc\ncbd\ncdb\ndbc\ndcb\n",
"bcc\ncbc\nccb\n",
"bbc\nbcb\ncbb\n",
"abc\nacb\nbac\nbca\ncab\ncba\n",
"bbd\nbdb\ndbb\n"
] |
CodeContests
|
I am a pipe tie craftsman. As long as you get the joints and pipes that connect the pipes, you can connect any pipe. Every day, my master gives me pipes and joints, which I connect and give to my master. But if you have too many pipes, you can't connect them all in one day. Even in such a case, the master smiles and gives me a salary.
By the way, I noticed something strange at one point. Often, the salary is higher when all the pipes are not connected than when they are all connected. It's so weird that one day when my boss came, I secretly saw a memo that describes how to calculate my salary. Then, how
"The salary is paid by" the number of pipes x the total length of pipes ". However, if they are connected by a joint and become one, it is regarded as one pipe. "
It was written. Now I understand why the salary may be cheaper if you connect them all. For example, as shown in the figure below, if you connect all three pipes of length 1 and two joints of length 2 to make one pipe of length 1 + 2 + 1 + 2 + 1 = 7, 1 × (7) ) = 7. However, if you use only one joint and make two pipes with a length of 1 + 2 + 1 = 4 and a pipe with a length of 1, 2 × (4 + 1) = 10, so you will get more salary than connecting all of them. ..
<image>
I don't know why my boss decides my salary this way, but I know how I can get more salary!
Now, create a program that calculates the maximum amount of salary you can get given the number of pipes.
input
The input consists of multiple datasets. The end of the input is indicated by a single zero line. Each dataset is given in the following format.
n
p1 ... pn
j1 ... jn-1
The number of pipes n (2 ≤ n ≤ 65000) is given in the first line. The second line consists of n integers separated by a single space. pi (1 ≤ pi ≤ 1000) indicates the length of the i-th pipe. The third line consists of n-1 integers separated by one space. ji (1 ≤ ji ≤ 1000) indicates the length of the i-th joint.
The i-th joint can connect only the i-th and i + 1-th pipes. The length of the connected pipe is pi + ji + pi + 1.
The number of datasets does not exceed 100.
output
For each dataset, print the maximum amount of salary you can get on one line. For datasets given as input, the output value must always fall within the range of 32-bit unsigned integers.
Example
Input
3
1 1 1
3 3
4
3 3 3 3
1 1 1
5
1 2 3 4 5
4 3 2 1
0
Output
12
48
76
|
stdin
| null | 936 | 1 |
[
"3\n1 1 1\n3 3\n4\n3 3 3 3\n1 1 1\n5\n1 2 3 4 5\n4 3 2 1\n0\n"
] |
[
"12\n48\n76\n"
] |
[
"3\n1 1 1\n3 3\n4\n3 1 3 3\n1 1 1\n5\n1 2 3 4 5\n4 3 2 1\n0\n",
"3\n1 1 1\n3 3\n4\n3 1 3 3\n1 1 1\n5\n1 2 3 4 5\n3 3 2 1\n0\n",
"3\n0 1 1\n3 3\n4\n3 1 3 3\n1 1 1\n5\n1 2 3 4 5\n3 3 2 1\n0\n",
"3\n0 1 1\n3 3\n4\n3 1 5 3\n1 1 1\n5\n1 2 3 4 5\n3 3 2 1\n0\n",
"3\n1 1 2\n3 3\n4\n3 3 3 3\n1 1 1\n5\n1 2 3 4 5\n4 3 2 1\n0\n",
"3\n0 1 1\n3 3\n4\n3 1 3 3\n1 1 1\n5\n1 1 3 4 5\n3 3 2 1\n0\n",
"3\n0 1 1\n3 3\n4\n4 1 3 3\n1 1 1\n5\n1 1 3 4 5\n3 3 2 2\n0\n",
"3\n0 1 1\n3 3\n4\n0 1 3 3\n1 1 1\n5\n1 1 3 4 5\n3 3 2 2\n0\n",
"3\n0 1 1\n3 2\n4\n0 0 3 3\n1 1 1\n5\n1 1 3 4 5\n3 3 2 2\n0\n",
"3\n1 1 1\n3 5\n4\n3 3 3 3\n1 1 1\n5\n1 2 3 4 5\n4 3 2 1\n0\n"
] |
[
"12\n40\n76\n",
"12\n40\n75\n",
"10\n40\n75\n",
"10\n48\n75\n",
"14\n48\n76\n",
"10\n40\n70\n",
"10\n44\n70\n",
"10\n28\n70\n",
"10\n24\n70\n",
"16\n48\n76\n"
] |
CodeContests
|
Let’s play a card game called Gap.
You have 28 cards labeled with two-digit numbers. The first digit (from 1 to 4) represents the suit of the card, and the second digit (from 1 to 7) represents the value of the card.
First, you shuffle the cards and lay them face up on the table in four rows of seven cards, leaving a space of one card at the extreme left of each row. The following shows an example of initial layout.
<image>
Next, you remove all cards of value 1, and put them in the open space at the left end of the rows: “11” to the top row, “21” to the next, and so on.
Now you have 28 cards and four spaces, called gaps, in four rows and eight columns. You start moving cards from this layout.
<image>
At each move, you choose one of the four gaps and fill it with the successor of the left neighbor of the gap. The successor of a card is the next card in the same suit, when it exists. For instance the successor of “42” is “43”, and “27” has no successor.
In the above layout, you can move “43” to the gap at the right of “42”, or “36” to the gap at the right of “35”. If you move “43”, a new gap is generated to the right of “16”. You cannot move any card to the right of a card of value 7, nor to the right of a gap.
The goal of the game is, by choosing clever moves, to make four ascending sequences of the same suit, as follows.
<image>
Your task is to find the minimum number of moves to reach the goal layout.
Input
The input starts with a line containing the number of initial layouts that follow.
Each layout consists of five lines - a blank line and four lines which represent initial layouts of four rows. Each row has seven two-digit numbers which correspond to the cards.
Output
For each initial layout, produce a line with the minimum number of moves to reach the goal layout. Note that this number should not include the initial four moves of the cards of value 1. If there is no move sequence from the initial layout to the goal layout, produce “-1”.
Example
Input
4
12 13 14 15 16 17 21
22 23 24 25 26 27 31
32 33 34 35 36 37 41
42 43 44 45 46 47 11
26 31 13 44 21 24 42
17 45 23 25 41 36 11
46 34 14 12 37 32 47
16 43 27 35 22 33 15
17 12 16 13 15 14 11
27 22 26 23 25 24 21
37 32 36 33 35 34 31
47 42 46 43 45 44 41
27 14 22 35 32 46 33
13 17 36 24 44 21 15
43 16 45 47 23 11 26
25 37 41 34 42 12 31
Output
0
33
60
-1
|
stdin
| null | 5,023 | 1 |
[
"4\n\n12 13 14 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 21\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n"
] |
[
"0\n33\n60\n-1\n"
] |
[
"4\n\n12 13 15 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 21\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 29 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n18 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n44 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 29 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n44 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 38\n",
"4\n\n12 13 14 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 29 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n44 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 80 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 38\n",
"4\n\n12 13 14 15 16 27 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 29 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 12 16 13 15 14 11\n27 22 26 23 25 24 13\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n",
"4\n\n12 13 15 15 16 17 21\n22 23 24 25 26 27 31\n32 33 34 35 36 37 41\n42 43 44 45 46 47 11\n\n26 31 13 44 21 24 42\n17 45 23 25 41 36 11\n46 34 14 12 37 32 47\n16 43 27 35 22 33 15\n\n17 7 16 13 15 14 11\n27 22 26 23 25 24 21\n37 32 36 33 35 34 31\n47 42 46 43 45 44 41\n\n27 14 22 35 32 46 33\n13 17 36 24 44 21 15\n43 16 45 47 23 11 26\n25 37 41 34 42 12 31\n"
] |
[
"-1\n33\n60\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n-1\n-1\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n33\n-1\n-1\n",
"-1\n33\n-1\n-1\n"
] |
CodeContests
|
There are N stones, numbered 1, 2, \ldots, N. For each i (1 \leq i \leq N), the height of Stone i is h_i.
There is a frog who is initially on Stone 1. He will repeat the following action some number of times to reach Stone N:
* If the frog is currently on Stone i, jump to Stone i + 1 or Stone i + 2. Here, a cost of |h_i - h_j| is incurred, where j is the stone to land on.
Find the minimum possible total cost incurred before the frog reaches Stone N.
Constraints
* All values in input are integers.
* 2 \leq N \leq 10^5
* 1 \leq h_i \leq 10^4
Input
Input is given from Standard Input in the following format:
N
h_1 h_2 \ldots h_N
Output
Print the minimum possible total cost incurred.
Examples
Input
4
10 30 40 20
Output
30
Input
2
10 10
Output
0
Input
6
30 10 60 10 60 50
Output
40
|
stdin
| null | 4,742 | 1 |
[
"6\n30 10 60 10 60 50\n",
"4\n10 30 40 20\n",
"2\n10 10\n"
] |
[
"40\n",
"30\n",
"0\n"
] |
[
"6\n30 10 60 10 60 57\n",
"4\n10 14 40 20\n",
"2\n18 10\n",
"4\n5 14 40 20\n",
"2\n33 10\n",
"6\n30 12 60 10 60 9\n",
"2\n9 10\n",
"6\n30 12 60 17 60 9\n",
"2\n9 18\n",
"6\n30 12 60 33 60 9\n"
] |
[
"33\n",
"10\n",
"8\n",
"15\n",
"23\n",
"21\n",
"1\n",
"31\n",
"9\n",
"63\n"
] |
CodeContests
|
Solve The Mystery
Input:
First line contains T - number of test cases.
Following T lines each contains a string of characters in the range [a-z] only
Output:
Print a numeric string for each test case.
Constraints:
1 ≤ T ≤ 100
1 ≤ Length of String ≤ 100
SAMPLE INPUT
10
key
to
control
nine
tails
is
in
your
hand
phone
SAMPLE OUTPUT
539
86
2668765
6463
82457
47
46
9687
4263
74663
|
stdin
| null | 2,431 | 1 |
[
"10\nkey\nto\ncontrol\nnine\ntails\nis\nin\nyour\nhand\nphone\n\nSAMPLE\n"
] |
[
"539\n86\n2668765\n6463\n82457\n47\n46\n9687\n4263\n74663\n"
] |
[
"10\nyxreuzmhd\nvcpgzn\nfcz\nh\npng\ngo\nvmhgmhmuy\ngmwfkpf\nblheu\nspuuxwa\n",
"10\nkey\nto\ncontrol\nnine\ntails\nis\nin\nyour\nahnd\nepiphany\n",
"10\nkey\nto\ncontrol\nnine\ntails\nis\nin\nyour\nahnd\nphone\n\nSAMPLE\n",
"10\nyxreuzmhd\nvcpgzn\nfcz\nh\npng\ngo\nvmhgmhmuy\ngmwfkpg\nblheu\nspuuxwa\n",
"10\nyxreuzmhd\nnzgpcv\nfcz\nh\npng\ngo\nvmhgmhmuy\ngmwfkpg\nblheu\nspuuxwa\n",
"10\nkey\nto\ncontrol\nnine\ntails\njs\nin\nyour\nahnd\nepiphany\n",
"10\nkey\nto\ncontrol\nenin\ntaiks\njs\nin\nyour\nahnd\nepiphany\n",
"10\nkey\nto\ncontrol\nnine\ntails\nis\nhn\nyour\niand\nphone\n\nELPMAS\n",
"10\nyxreuzmhd\nnzgpcv\nfcz\nh\nqng\nfn\nvmhgmhmuy\ngmwfkpg\nblheu\nspuuxwa\n",
"10\nkey\nto\ncontrol\nenin\ntails\nis\nhn\nyour\niand\nphone\n\nELPMAS\n"
] |
[
"997389643\n827496\n329\n4\n764\n46\n864464689\n4693573\n25438\n7788992\n",
"539\n86\n2668765\n6463\n82457\n47\n46\n9687\n2463\n37474269\n",
"539\n86\n2668765\n6463\n82457\n47\n46\n9687\n2463\n74663\n",
"997389643\n827496\n329\n4\n764\n46\n864464689\n4693574\n25438\n7788992\n",
"997389643\n694728\n329\n4\n764\n46\n864464689\n4693574\n25438\n7788992\n",
"539\n86\n2668765\n6463\n82457\n57\n46\n9687\n2463\n37474269\n",
"539\n86\n2668765\n3646\n82457\n57\n46\n9687\n2463\n37474269\n",
"539\n86\n2668765\n6463\n82457\n47\n46\n9687\n4263\n74663\n",
"997389643\n694728\n329\n4\n764\n36\n864464689\n4693574\n25438\n7788992\n",
"539\n86\n2668765\n3646\n82457\n47\n46\n9687\n4263\n74663\n"
] |
CodeContests
|
You are given two string S and T. Find the maximal length of some prefix of the string S which occurs in strings T as subsequence.
Input
The first line contains string S.
The second line contains string T.
Both strings consist of lowecase Latin letters.
Output
Output one integer - answer to the question.
Constraints
1 ≤ length of S, T ≤ 10^6
SAMPLE INPUT
digger
biggerdiagram
SAMPLE OUTPUT
3
|
stdin
| null | 3,345 | 1 |
[
"digger\nbiggerdiagram\n\nSAMPLE\n"
] |
[
"3\n"
] |
[
"digger\nmargaidreggib\n\nSAMPLE\n",
"reggid\nmargaidreggib\n\nELPMAS\n",
"digger\nmargaieqeggib\n\nSPMELA\n",
"rdgigc\naghifregairan\n\nEKPTNA\n",
"dfhees\nv_idcfhfqbieo\n\nNCKDTQ\n",
"deehrf\nv_idbehfqbioe\n\nQCKCTN\n",
"digger\nmargaidreggib\n\nELPMAS\n",
"reggid\nmargaidreggib\n\nSAMPLE\n",
"reggid\nmargaiereggib\n\nSAMPLE\n",
"reggid\nmargaieqeggib\n\nSAMPLE\n"
] |
[
"2\n",
"5\n",
"0\n",
"1\n",
"4\n",
"3\n",
"2\n",
"5\n",
"5\n",
"5\n"
] |
CodeContests
|
I decided to move and decided to leave this place. There is nothing wrong with this land itself, but there is only one thing to worry about. It's a plum tree planted in the garden. I was looking forward to this plum blooming every year. After leaving here, the fun of spring will be reduced by one. Wouldn't the scent of my plums just take the wind and reach the new house to entertain spring?
There are three flowers that symbolize spring in Japan. There are three, plum, peach, and cherry blossom. In addition to my plum blossoms, the scent of these flowers will reach my new address. However, I would like to live in the house where only the scent of my plums arrives the most days.
<image>
As shown in the figure, the scent of flowers spreads in a fan shape, and the area is determined by the direction and strength of the wind. The sector spreads symmetrically around the direction w of the wind, and has a region whose radius is the strength of the wind a. The angle d at which the scent spreads is determined by the type of flower, but the direction and strength of the wind varies from day to day. However, on the same day, the direction and strength of the wind is the same everywhere.
At hand, I have data on the positions of plums, peaches, and cherry blossoms other than my plums, the angle at which the scent spreads for each type of flower, and the candidate homes to move to. In addition, there are data on the direction and strength of the wind for several days. The positions of plums, peaches, cherry trees and houses other than my plums are shown in coordinates with the position of my plums as the origin.
Let's use these data to write a program to find the house with the most days when only my plum scent arrives. Because I'm a talented programmer!
input
The input consists of multiple datasets. The end of the input is indicated by two lines of zeros. Each dataset is given in the following format:
H R
hx1 hy1
hx2 hy2
::
hxH hyH
U M S du dm ds
ux1 uy1
ux2 uy2
::
uxU uyU
mx1 my1
mx2 my2
::
mxM myM
sx1 sy1
sx2 sy2
::
sxS syS
w1 a1
w2 a2
::
wR aR
The numbers given on each line are separated by a single space.
The first line gives the number of candidate homes to move to H (1 ≤ H ≤ 100) and the number of wind records R (1 ≤ R ≤ 100). The following line H is given the location of the new house. hxi and hyi are integers between -1000 and 1000 that indicate the x and y coordinates of the i-th house.
In the next line, the number U of plum trees other than my plum and the number of peach / cherry trees M, S, and the angles du, dm, and ds that spread the scent of plum / peach / cherry are given. The range of U, M, and S is 0 or more and 10 or less. The unit of angle is degrees, which is an integer greater than or equal to 1 and less than 180. The following U line gives the position of the plum tree other than my plum, the following M line gives the position of the peach tree, and the following S line gives the position of the cherry tree. uxi and uyi, mxi and myi, sxi and syi are integers between -1000 and 1000, indicating the x and y coordinates of the i-th plum, peach, and cherry tree, respectively.
The following R line is given a record of the wind. wi (0 ≤ wi <360) and ai (0 <ai ≤ 100) are integers representing the direction and strength of the wind on day i. The direction of the wind is expressed as an angle measured counterclockwise from the positive direction of the x-axis, and the unit is degrees.
The input may be considered to satisfy the following conditions.
* All coordinates entered shall be different.
* There is nothing but my plum at the origin.
* For any flower, there is no house within 0.001 distance from the boundary of the area where the scent of the flower reaches.
The number of datasets does not exceed 50.
output
For each dataset, print the numbers of all the houses with the most days that only my plum scent arrives on one line in ascending order. Separate the house numbers with a single space. Do not print whitespace at the end of the line.
However, for any house, if there is no day when only the scent of my plum blossoms arrives, it will be output as NA.
Example
Input
6 3
2 1
1 2
5 2
1 3
1 5
-2 3
1 1 1 90 30 45
3 -4
-3 0
2 -2
45 6
90 6
135 6
2 1
1 3
5 2
0 1 1 90 30 45
-3 0
2 -2
45 6
0 0
Output
5 6
NA
|
stdin
| null | 302 | 1 |
[
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 3\n1 1 1 90 30 45\n3 -4\n-3 0\n2 -2\n45 6\n90 6\n135 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n45 6\n0 0\n"
] |
[
"5 6\nNA\n"
] |
[
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 3\n1 1 1 90 30 45\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n135 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n45 6\n0 0\n",
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 3\n1 1 1 90 30 14\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n135 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n45 6\n0 0\n",
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 2\n1 1 1 90 30 16\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n135 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n37 6\n0 0\n",
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 2\n1 1 1 90 30 16\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n135 6\n2 1\n1 3\n5 2\n0 1 1 90 30 22\n-3 0\n2 -2\n37 6\n0 0\n",
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 3\n1 1 1 90 30 45\n3 -4\n-3 0\n2 -2\n45 6\n90 11\n135 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n45 6\n0 0\n",
"6 3\n2 1\n1 2\n5 0\n1 3\n1 5\n-2 2\n1 1 1 90 30 16\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n36 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n37 6\n0 0\n",
"6 3\n2 1\n1 2\n5 2\n1 3\n1 5\n-2 2\n1 1 1 90 30 16\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n135 6\n2 1\n1 0\n5 2\n0 1 1 90 30 22\n-3 0\n3 -2\n37 6\n0 0\n",
"6 3\n2 1\n1 2\n5 2\n1 2\n1 5\n-2 3\n1 1 1 90 30 45\n3 -4\n-3 0\n2 -2\n45 21\n90 6\n55 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n45 6\n0 0\n",
"6 3\n2 1\n1 2\n5 0\n1 3\n0 5\n-2 2\n1 1 1 90 30 16\n3 -4\n-3 0\n2 -2\n45 11\n90 6\n36 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n37 6\n0 0\n",
"6 3\n2 1\n1 2\n5 3\n1 2\n1 5\n-2 3\n1 1 1 90 30 45\n3 -4\n-3 0\n2 -2\n45 21\n90 6\n179 6\n2 1\n1 3\n5 2\n0 1 1 90 30 45\n-3 0\n2 -2\n45 6\n0 0\n"
] |
[
"6\nNA\n",
"2 6\nNA\n",
"2\nNA\n",
"2\n2\n",
"1 2 5 6\nNA\n",
"1 2 5\nNA\n",
"2\n1 2\n",
"1 2 4 5\nNA\n",
"1 2\nNA\n",
"1 2 4 5 6\nNA\n"
] |
CodeContests
|
There is a tree with N vertices, numbered 1 through N.
The i-th of the N-1 edges connects the vertices p_i and q_i.
Among the sequences of distinct vertices v_1, v_2, ..., v_M that satisfy the following condition, find the maximum value of M.
* For every 1 \leq i < M, the path connecting the vertices v_i and v_{i+1} do not contain any vertex in v, except for v_i and v_{i+1}.
Constraints
* 2 \leq N \leq 10^5
* 1 \leq p_i, q_i \leq N
* The given graph is a tree.
Input
The input is given from Standard Input in the following format:
N
p_1 q_1
p_2 q_2
:
p_{N-1} q_{N-1}
Output
Print the maximum value of M, the number of elements, among the sequences of vertices that satisfy the condition.
Examples
Input
4
1 2
2 3
2 4
Output
3
Input
10
7 9
1 2
6 4
8 1
3 7
6 5
2 10
9 6
2 6
Output
8
|
stdin
| null | 891 | 1 |
[
"10\n7 9\n1 2\n6 4\n8 1\n3 7\n6 5\n2 10\n9 6\n2 6\n",
"4\n1 2\n2 3\n2 4\n"
] |
[
"8\n",
"3\n"
] |
[
"10\n7 9\n1 2\n6 5\n8 1\n3 7\n6 5\n2 10\n9 6\n2 6\n",
"10\n7 9\n1 2\n6 4\n8 1\n3 7\n2 5\n2 10\n9 6\n2 6\n",
"10\n7 9\n1 2\n6 4\n8 1\n3 1\n6 5\n2 10\n9 6\n2 6\n",
"4\n1 2\n2 3\n4 4\n",
"4\n1 2\n3 3\n4 4\n",
"4\n2 2\n3 3\n4 4\n",
"4\n1 3\n2 3\n4 2\n",
"10\n7 9\n1 2\n6 4\n8 1\n3 7\n2 5\n2 10\n9 8\n2 6\n",
"10\n7 9\n1 2\n6 5\n8 1\n3 10\n6 5\n2 10\n9 6\n2 6\n",
"10\n7 9\n1 2\n6 5\n8 1\n3 7\n6 5\n1 10\n9 6\n2 6\n"
] |
[
"6\n",
"8\n",
"7\n",
"3\n",
"2\n",
"0\n",
"4\n",
"9\n",
"5\n",
"6\n"
] |
CodeContests
|
Xsquare loves to play with arrays a lot. Today, he has an array A consisting of N distinct integers. He wants to perform following operation over his array A.
Select a pair of consecutive integers say (Ai,Ai+1) for some 1 ≤ i < N. Replace the selected pair of integers with the max(Ai,Ai+1).
Replace N with the new size of the array A.
Above operation incurs a cost of rupees max(Ai,Ai+1) to Xsquare.
As we can see after N-1 such operations, there is only 1 element left. Xsquare wants to know the most optimal transformation strategy to reduce the given array A to only 1 element.
A transformation strategy is considered to be most optimal if it incurs minimum cost over all possible transformation strategies.
Input
First line of input contains a single integer T denoting the number of test cases. First line of each test case starts with an integer N denoting the size of the array A. Next line of input contains N space separated integers, where i^th element denotes the value Ai.
Output
For each test case, print the minimum cost required for the transformation.
Constraints
1 ≤ T ≤ 10^5
2 ≤ N ≤ 10^5
1 ≤ Ai ≤ 10^9
sum of N over all test case does not exceed 5*10^5
SAMPLE INPUT
2
3
1 2 3
3
1 3 2
SAMPLE OUTPUT
5
6
Explanation
Testcase 1 :
1. Initially A[] = {1,2,3}. During first operation, Xsquare selected A_1 and A_2. Cost of this operation is 2 i.e max(A_1,A_2) .
2. Now, A[]={2,3}. During second operation, Xsquare selected A_1 and A_2. Cost of this operation is 3 i.e max(A_1,A_2) .
This way Xsquare manages to transform the given array with minimum cost i.e 5.
Testcase 2 :
1. Initially A[] = {1,3,2}. During first operation, Xsquare selected A_1 and A_2. Cost of this operation is 3 i.e max(A_1,A_2) .
2. Now, A[]={3,2}. During second operation, Xsquare selected A_1 and A_2. Cost of this operation is 3 i.e max(A_1,A_2) .
This way , Xsquare manages to transform the given array with minimum cost i.e 6.
|
stdin
| null | 2,475 | 1 |
[
"2\n3\n1 2 3\n3\n1 3 2\n\nSAMPLE\n"
] |
[
"5\n6\n"
] |
[
"2\n3\n1 2 3\n3\n1 3 2\n\nSALPLE\n",
"2\n3\n1 2 3\n3\n1 5 2\n\nSALPLE\n",
"2\n3\n1 2 4\n3\n1 3 2\n\nSALPLE\n",
"2\n3\n0 2 5\n3\n1 3 2\n\nSAMPLE\n",
"2\n3\n1 2 0\n3\n1 3 1\n\nSAMPLE\n",
"2\n3\n0 2 5\n3\n1 0 2\n\nSAMPLE\n",
"2\n3\n0 2 5\n3\n0 0 2\n\nSAMPLE\n",
"2\n3\n0 2 0\n3\n0 0 2\n\nSAMPLE\n",
"2\n3\n1 2 2\n3\n1 5 2\n\nSALPLE\n",
"2\n3\n0 2 9\n3\n1 3 2\n\nSAMPLE\n"
] |
[
"5\n6\n",
"5\n10\n",
"6\n6\n",
"7\n6\n",
"4\n6\n",
"7\n3\n",
"7\n2\n",
"4\n2\n",
"4\n10\n",
"11\n6\n"
] |
CodeContests
|
In your garden, there is a long and narrow flowerbed that stretches infinitely to the east. You have decided to plant N kinds of flowers in this empty flowerbed. For convenience, we will call these N kinds of flowers Flower 1, 2, …, N. Also, we will call the position that is p centimeters from the west end of the flowerbed Position p.
You will plant Flower i (1 ≤ i ≤ N) as follows: first, plant one at Position w_i, then plant one every d_i centimeters endlessly toward the east. That is, Flower i will be planted at the positions w_i, w_i + d_i, w_i + 2 d_i, … Note that more than one flower may be planted at the same position.
Find the position at which the K-th flower from the west is planted. If more than one flower is planted at the same position, they are counted individually.
Constraints
* 1 ≤ N ≤ 10^5
* 1 ≤ K ≤ 10^9
* 1 ≤ w_i ≤ 10^{18}
* 1 ≤ d_i ≤ 10^9
* All input values are integers.
Input
Input is given from Standard Input in the following format:
N K
w_1 d_1
:
w_N d_N
Output
When the K-th flower from the west is planted at Position X, print the value of X. (The westmost flower is counted as the 1-st flower.)
Examples
Input
2 6
20 10
25 15
Output
50
Input
3 9
10 10
10 10
10 10
Output
30
Input
1 1000000000
1000000000000000000 1000000000
Output
1999999999000000000
|
stdin
| null | 3,436 | 1 |
[
"1 1000000000\n1000000000000000000 1000000000\n",
"2 6\n20 10\n25 15\n",
"3 9\n10 10\n10 10\n10 10\n"
] |
[
"1999999999000000000\n",
"50\n",
"30\n"
] |
[
"2 5\n20 10\n25 15\n",
"3 9\n16 10\n10 10\n10 10\n",
"2 5\n20 16\n25 15\n",
"2 5\n20 13\n25 15\n",
"2 6\n20 10\n43 15\n",
"3 9\n10 10\n7 10\n10 10\n",
"3 9\n10 10\n7 10\n10 18\n",
"2 5\n20 11\n25 10\n",
"3 9\n7 10\n13 10\n10 10\n",
"2 5\n38 9\n25 15\n"
] |
[
"40\n",
"36\n",
"52\n",
"46\n",
"58\n",
"30\n",
"37\n",
"42\n",
"33\n",
"55\n"
] |
CodeContests
|
In 2215 A.D., a war between two planets, ACM and ICPC, is being more and more intense.
ACM introduced new combat planes. These planes have a special system that is called Graze, and fighting power of a plane increases when it is close to energy bullets that ICPC combat planes shoot.
Both combat planes and energy bullets have a shape of a sphere with a radius of R. Precisely, fighting power of a plane is equivalent to the number of energy bullet where distance from the plane is less than or equals to 2R.
You, helper of captain of intelligence units, are asked to analyze a war situation. The information given to you is coordinates of AN combat planes and BN energy bullets. Additionally, you know following things:
* All combat planes and energy bullet has same z-coordinates. In other word, z-coordinate can be ignored.
* No two combat planes, no two energy bullets, and no pair of combat plane and energy bullet collide (i.e. have positive common volume) each other.
Your task is to write a program that outputs total fighting power of all combat planes.
Constraints
* Jude data includes at most 20 data sets.
* 1 ≤ AN, BN ≤ 100000
* 0 < R ≤ 10
* 0 ≤ (coordinate values) < 10000
Input
Input file consists of a number of data sets. One data set is given in following format:
AN BN R
XA1 YA1
XA2 YA2
:
XAAN YAAN
XB1 YB1
XB2 YB2
:
XBBN YBBN
AN, BN, R are integers that describe the number of combat planes, energy bullets, and their radius respectively.
Following AN lines indicate coordinates of the center of combat planes. Each line has two integers that describe x-coordinate and y-coordinate.
Following BN lines indicate coordinates of the center of energy bullets, in the same format as that of combat planes.
Input ends when AN = BN = 0. You should output nothing for this case.
Output
For each data set, output the total fighting power.
Example
Input
2 2 1
0 0
0 4
2 2
2 8
0 0 0
Output
2
|
stdin
| null | 542 | 1 |
[
"2 2 1\n0 0\n0 4\n2 2\n2 8\n0 0 0\n"
] |
[
"2\n"
] |
[
"2 2 1\n0 0\n0 5\n2 2\n2 8\n0 0 0\n",
"2 2 1\n0 0\n0 4\n2 2\n2 12\n0 0 0\n",
"2 2 1\n0 0\n0 5\n2 4\n2 9\n0 0 0\n",
"2 2 1\n0 0\n0 4\n2 2\n2 2\n0 0 0\n",
"2 2 1\n1 0\n0 2\n1 10\n0 8\n0 0 0\n",
"2 2 1\n0 0\n0 5\n2 4\n2 8\n0 0 0\n",
"2 2 1\n0 0\n0 1\n2 2\n2 12\n0 0 0\n",
"2 2 1\n0 0\n0 1\n2 2\n2 4\n0 0 0\n",
"2 2 1\n0 0\n0 5\n1 2\n2 8\n0 0 0\n",
"2 2 1\n0 0\n0 1\n2 2\n2 5\n0 0 0\n"
] |
[
"3\n",
"2\n",
"1\n",
"4\n",
"0\n",
"2\n",
"2\n",
"3\n",
"3\n",
"2\n"
] |
CodeContests
|
The ACM ICPC judges are very careful about not leaking their problems, and all communications are encrypted. However, one does sometimes make mistakes, like using too weak an encryption scheme. Here is an example of that.
The encryption chosen was very simple: encrypt each chunk of the input by flipping some bits according to a shared key. To provide reasonable security, the size of both chunk and key is 32 bits.
That is, suppose the input was a sequence of m 32-bit integers.
N1 N2 N3 ... Nm
After encoding with the key K it becomes the following sequence of m 32-bit integers.
(N1 ∧ K) (N2 ∧ K) (N3 ∧ K) ... (Nm ∧ K)
where (a ∧ b) is the bitwise exclusive or of a and b.
Exclusive or is the logical operator which is 1 when only one of its operands is 1, and 0 otherwise. Here is its definition for 1-bit integers.
0 ⊕ 0 = 0 0 ⊕ 1 = 1
1 ⊕ 0 = 1 1 ⊕ 1 =0
As you can see, it is identical to addition modulo 2. For two 32-bit integers a and b, their bitwise exclusive or a ∧ b is defined as follows, using their binary representations, composed of 0's and 1's.
a ∧ b = a31 ... a1a0 ∧ b31 ... b1b0 = c31 ... c1c0
where
ci = ai ⊕ bi (i = 0, 1, ... , 31).
For instance, using binary notation, 11010110 ∧ 01010101 = 10100011, or using hexadecimal,
d6 ∧ 55 = a3.
Since this kind of encryption is notoriously weak to statistical attacks, the message has to be compressed in advance, so that it has no statistical regularity. We suppose that N1 N2 ... Nm is already in compressed form.
However, the trouble is that the compression algorithm itself introduces some form of regularity: after every 8 integers of compressed data, it inserts a checksum, the sum of these integers. That is, in the above input, N9 = ∑8i=1 Ni = N1 + ... + N8, where additions are modulo 232.
Luckily, you could intercept a communication between the judges. Maybe it contains a problem for the finals!
As you are very clever, you have certainly seen that you can easily find the lowest bit of the key, denoted by K0. On the one hand, if K0 = 1, then after encoding, the lowest bit of ∑8i=1 Ni ∧ K is unchanged, as K0 is added an even number of times, but the lowest bit of N9 ∧ K is changed, so they shall differ. On the other hand, if K0 = 0, then after encoding, the lowest bit of ∑8i=1 Ni ∧ K shall still be identical to the lowest bit of N9 ∧ K, as they do not change. For instance, if the lowest bits after encoding are 1 1 1 1 1 1 1 1 1 then K0 must be 1, but if they are 1 1 1 1 1 1 1 0 1 then K0 must be 0.
So far, so good. Can you do better?
You should find the key used for encoding.
Input
The input starts with a line containing only a positive integer S, indicating the number of datasets in the input. S is no more than 1000.
It is followed by S datasets. Each dataset is composed of nine 32-bit integers corresponding to the first nine chunks of a communication. They are written in hexadecimal notation, using digits ‘0’ to ‘9’ and lowercase letters ‘a’ to ‘f’, and with no leading zeros. They are separated by a space or a newline. Each dataset is ended by a newline.
Output
For each dataset you should output the key used for encoding. Each key shall appear alone on its line, and be written in hexadecimal notation, using digits ‘0’ to ‘9’ and lowercase letters ‘a’ to ‘f’, and with no leading zeros.
Example
Input
8
1 1 1 1 1 1 1 1 8
3 2 3 2 3 2 3 2 6
3 4 4 7 7 b a 2 2e
e1 13 ce 28 ca 6 ab 46 a6d
b08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b
4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc
ef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007
7a4e96ad 6ee5cef6 3853cd88
60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da
22047c88 e5524401
Output
0
2
6
1c6
4924afc7
ffff95c5
546991d
901c4a16
|
stdin
| null | 1,060 | 1 |
[
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 3 2 6\n3 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a6d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n22047c88 e5524401\n"
] |
[
"0\n2\n6\n1c6\n4924afc7\nffff95c5\n546991d\n901c4a16\n"
] |
[
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 3 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a6d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n22047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 3 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a6d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 3 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 eed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n8bf20206 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 f27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 fed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n8bf20206 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 e27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd14 6ac1 fed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n8bf20206 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 e27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd15 6ac1 fed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n8bf20206 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 8\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 e27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd15 6ac1 fed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n",
"8\n1 1 1 1 1 1 1 1 5\n3 2 3 2 3 2 4 2 6\n6 4 4 7 7 b a 2 2e\ne1 13 ce 28 ca 6 ab 46 a5d\nb08 49e2 6128 e27 8cf2 bc50 7380 7fe1 723b\n4eba eb4 a352 fd15 6ac1 fed1 dd06 bb83 392bc\nef593c08 847e522f 74c02b9c 26f3a4e1 e2720a01 6fe66007\n7a4e96ad 6ee5cef6 3853cd88\n60202fb8 757d6d66 9c3a9525 fbcd7983 82b9571c ddc54bab 853e52da\n12047c88 e5524401\n"
] |
[
"0\n2\n3\n1c6\n4924afc7\nffff95c5\n546991d\n901c4a16\n",
"0\n2\n3\n1c6\n4924afc7\nffff95c5\n546991d\n801c4a16\n",
"0\n2\n3\nfffffe56\n4924afc7\nffff95c5\n546991d\n801c4a16\n",
"0\n92492491\n3\nfffffe56\n4924afc7\nffff95c5\n546991d\n801c4a16\n",
"0\n92492491\n3\nfffffe56\n4924afc7\nffff95c5\n546991d\n945994bc\n",
"0\n92492491\n3\nfffffe56\n4924afc7\nffff25c5\n546991d\n945994bc\n",
"0\n92492491\n3\nfffffe56\nb6db52c7\nffff25c5\n546991d\n945994bc\n",
"0\n92492491\n3\nfffffe56\nb6db52c7\nffff25c4\n546991d\n945994bc\n",
"0\n92492491\n3\nfffffe56\nb6db52c7\nffff25c4\n546991d\n801c4a16\n",
"24924925\n92492491\n3\nfffffe56\nb6db52c7\nffff25c4\n546991d\n801c4a16\n"
] |
CodeContests
|
Training is indispensable for achieving good results at ICPC. Rabbit wants to win at ICPC, so he decided to practice today as well.
Today's training is to develop physical strength and judgment by running on a straight road. The rabbit is now standing at the starting line and looking out over a long, long road.
There are some carrots along the way, and rabbits can accelerate by eating carrots. Rabbits run at U meters per second when not accelerating, but by eating carrots, the speed is V meters per second from the last carrot eaten to T seconds later. Rabbits can also carry up to K carrots without eating them. Even if you have a carrot, the running speed does not change.
Assuming that it does not take long to bring and eat carrots, I would like to find the shortest time required to reach the goal.
Input
N K T U V L
D1
...
DN
N is the number of carrots, L is the distance from the start to the goal (meters), and Di (1 ≤ i ≤ N) is the distance from the start where the i-th carrot is located (meters).
1 ≤ N ≤ 200, 1 ≤ K ≤ N, 1 ≤ T ≤ 10,000, 1 ≤ U <V ≤ 10,000, 2 ≤ L ≤ 10,000, 0 <D1 <D2 <... <DN <L. All input values are integers.
Output
Output the shortest required time (seconds) on one line. Absolute errors of 10-6 or less are allowed.
Examples
Input
1 1 1 2 3 100
50
Output
49.500000000
Input
3 1 1 2 3 100
49
50
51
Output
48.666666667
|
stdin
| null | 1,460 | 1 |
[
"1 1 1 2 3 100\n50\n",
"3 1 1 2 3 100\n49\n50\n51\n"
] |
[
"49.500000000\n",
"48.666666667\n"
] |
[
"0 1 1 2 3 100\n50\n",
"1 1 1 2 3 110\n50\n",
"3 1 1 2 3 100\n49\n50\n74\n",
"2 1 1 2 3 100\n49\n72\n74\n",
"2 1 1 2 4 100\n49\n72\n40\n",
"1 1 1 3 3 110\n50\n",
"3 1 1 2 3 110\n49\n50\n51\n",
"0 1 1 2 3 000\n50\n",
"0 1 1 2 3 101\n97\n",
"1 1 1 1 3 110\n50\n"
] |
[
"50.0\n",
"54.5\n",
"48.5\n",
"49.0\n",
"48.0\n",
"36.6666666667\n",
"53.6666666667\n",
"0.0\n",
"50.5\n",
"108.0\n"
] |
CodeContests
|
There is a sequence X of length N, where every element is initially 0. Let X_i denote the i-th element of X.
You are given a sequence A of length N. The i-th element of A is A_i. Determine if we can make X equal to A by repeating the operation below. If we can, find the minimum number of operations required.
* Choose an integer i such that 1\leq i\leq N-1. Replace the value of X_{i+1} with the value of X_i plus 1.
Constraints
* 1 \leq N \leq 2 \times 10^5
* 0 \leq A_i \leq 10^9(1\leq i\leq N)
* All values in input are integers.
Input
Input is given from Standard Input in the following format:
N
A_1
:
A_N
Output
If we can make X equal to A by repeating the operation, print the minimum number of operations required. If we cannot, print -1.
Examples
Input
4
0
1
1
2
Output
3
Input
3
1
2
1
Output
-1
Input
9
0
1
1
0
1
2
2
1
2
Output
8
|
stdin
| null | 3,435 | 1 |
[
"3\n1\n2\n1\n",
"9\n0\n1\n1\n0\n1\n2\n2\n1\n2\n",
"4\n0\n1\n1\n2\n"
] |
[
"-1\n",
"8\n",
"3\n"
] |
[
"3\n0\n2\n1\n",
"4\n0\n0\n1\n2\n",
"3\n0\n1\n0\n",
"3\n0\n0\n0\n",
"9\n0\n1\n1\n0\n2\n2\n2\n1\n2\n",
"3\n0\n2\n2\n",
"9\n0\n1\n1\n0\n2\n2\n2\n1\n4\n",
"4\n0\n0\n0\n2\n",
"3\n0\n1\n2\n",
"9\n0\n1\n1\n0\n2\n2\n2\n1\n3\n"
] |
[
"-1\n",
"2\n",
"1\n",
"0\n",
"-1\n",
"-1\n",
"-1\n",
"-1\n",
"2\n",
"-1\n"
] |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.